WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Condylura cristata AJFV00000000.1 (AJFV01) 159 13 12 40 37 4 26 27
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Condylura cristata V39 trgv AJFV01014442.1 34367 SQLSFNSEWRKVSVTKPTKMPAIITCDIDDQKVNYIHWYRHRVGEAPQRILYFSFHDSKPVVEAGISPEKYHAYIVSGRSCKFLIQNLEESDAGIYYCAAW
Condylura cristata V40 trgv AJFV01014442.1 40898 CQAAVTLDQPMVKLGHPGDTATLPCVGRTKVSYIHWYRHQEGRAPERLLRLDTSNSNVQFDLGLKEDKVKAKLSRDGSSCTLSVQNLQKSDEGMYYCAAWD
Condylura cristata V41 trgv AJFV01014443.1 5446 SQLSFNSEWRKVSVTQPTKSLAEITCDIHDQNVNYIHWYRHRVGEAPHRLLYFSFFDSNPVFDSGVSTRKYIASASSERRCKLVVQNVQQSDAGIYYCAAWE
Condylura cristata V42 trgv AJFV01014444.1 2207 CQAAVTLEQPMALLGRPGSWAVLHCEIRTKVSYIHWYRHQESRAPERLLRLDTSNSAVQWDSVLKEDKVSATLSSDGSSCTLLVLRLQKDDEGMYYCAAWD
Condylura cristata V43 trgv AJFV01014447.1 2751 SPISFSSEWRTMSVTRRTGSLAEITCDIVDQKVNYIHWYRHRVGEAPHRLLYFSFSDSKSVVEAGIESEKYRVSASSGRRCKIVVLNIKQSDAGIYYCAAW
Condylura cristata V44 trgv AJFV01014447.1 4671 SLISFSSKWRTLSVSRRIGNLADITCDIDDQKVNYIHWYRHRLGEAPHRLLYFSFHDSKPVVEEGISPVKYHAYKGSGRSCKFVIQNLEESDAGIYYCAAW
Condylura cristata V45 trgv AJFV01014448.1 4938 SQAAVTLEQPMAVLGRAGHSVVLHCKIRTKVSYIHWYRHQEGRAPERLLRLATFKSDVEWDSVLKSDKVTAMESSDGSSCTLSVLKLQKEDQGMYYCAAWD
Condylura cristata V46 trgv AJFV01014448.1 8290 SQLSFNSERRKVSVTKPTKSLAVITCDIVDQKVNYIHWYLQQVGEAPRRLLYFSFSDSNPVVEAGISPEKYHVFQGSGRSCELVVRNVQQSDAGIYYCAAWE
Condylura cristata V47 trgv AJFV01014448.1 10396 SPISFRSERRKMSVTGRTGFLADIICDIVDQNVHFIHWYRHRVGEAPHRLLFISFSDLKAVVEAGISPEKYKAYGGSRRRYKLVIQNVQLSDAGIYYCAAW
Condylura cristata V48 trgv AJFV01014449.1 533 SQAAVTLEQPMAVLGAPGDSAFLHCKIRTNVRHIHWYQHQEGRAPERLLRLDTSTSDVELDSVLKEDKVSATLSSDGSSCTLLVLRLQKDDEGMYYCAAWD
Condylura cristata V49 trgv AJFV01014450.1 674 SPISFSSEGRKMSVTRRTGFLAEITCDIVDQNVNYIHWYRHRVGEAPHRLLYYEFSGSKTVVEPGIKSEKYRLSATSGKTSKLVVRNVEQSDAGIYYCAAW
Condylura cristata V50 trgv AJFV01014453.1 5183 CQAAVTLEQPMALLGSPGGSVVLHCEIRTKVRYIHWYRYQEGRAPERLLRLDTSNSAVQWDSVLKVDKVSARPSSDGSRCTLLVLRLQKDDEGMYYCAAWD
Condylura cristata V51 trgv AJFV01014455.1 8770 GVGQLQQPEMSISKMKDQRAQISCKVSVTNFNDAYIFWYRQKPNQIIEYLIGVDSTRQPAQKKTSWGIKLEASKDSSTSTSTLKVYFLTKEDEAMYYCAIW
Condylura cristata V52 trgv AJFV01014461.1 24156 GVGQLNLEQHKTSISSLRYHNVIISCKVFSLNFDNKYIHWYRQKPGEHIEHLIYVASTTTLVQKQAGGRKKIEASKDSATSTSRLRINYLEDEDEAMYYCACW
Condylura cristata V53 trgv AJFV01014461.1 25968 GVGQLKLEQPRISVSKRIYQSVFISCKVFSAKFENAYIHWYRQKPAKHIEHLIYVVSTTALAQKQIGGKTKLEAGKDSRSSTSTLKINYLEDEDEAMYYCACW
Condylura cristata V54 trgv AJFV01014461.1 53868 GFGQLKLEQPKISISSIRYQDAIISCQVSSNNFDNAYIHWYRQKLGQNIELLIYVVSTKNVAQRQVDGKEKLKASKDSHASTSTLKIIYVEKEDEATYYCASW
Condylura cristata V55 trgv AJFV01014461.1 57715 VAGQLKLEQAKISISKLRYQTVQINCKMSSGNFDKAYIHWYQQKSGQNIEHLLSVQSITKPYQKTIDGKNKLEASKNSRTSTSTLKINYFDKEDEGMYYCACW
Condylura cristata V56 trgv AJFV01014461.1 63057 VAGQFKLEQPKISITGSRYQNVHISCKMSFGYFDNEYIHWYQQKPGQNIEHLMFVQSTMEPVQKKIGYKKKFEATKDSHTSTSRLKIIYLEDEDEATYYCACW
Condylura cristata V57 trgv AJFV01014462.1 5995 VAGQFKLEQPKISITRSRYQNVHISCKVSSGYFNNEYIHWYQQKPGQNIEHLMFVQSTTEPVQKKIGYRNKFEARKDSRTSTSSLKIIYLEDEDEATYYCACW
Condylura cristata V58 trgv AJFV01014476.1 7362 GVGQLKLEQPKMSISKTRDKTAHIPCIVTSKNFNSDYIHWYRQKTDQNIEHLLHVISTTQSVSKNIGGKTKLEANKDPTTSRSTLKVNFVQKEDEAVYYCAVW
Condylura cristata V59 trgv AJFV01014476.1 13753 TDGNNLLSQIKISITKRKGSTAFLECPINTKAFKKNVYVHWYRQKPEQPLQRILYISSNENVVHEQGISEERYEAKKRHDDLPASLRIHRVNESDAGLYYCACWD
Condylura cristata V212 trdv AJFV01058360.1 24168 THTQVVQVNDSMYGFIGADVVLHCNFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLNPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Condylura cristata V239 iglv AJFV01063324.1 18937 SWAQFELTQPCSALRSVGQMVTISCTHSSGIIEGAYVVWYQKRPGTVIYAHHQISSGVPDRLSGSINSSSSAAALTISGLQPKDEADYYCLS
Condylura cristata V246 iglv AJFV01064021.1 10926 SLLQPMLTQPPSLSVAPVATARLTCTLRSDINVGSYGIFWLQQQPGRPPRYLLYYKSDSDKGQGAGVPSRFSGAKDTSANAGVLVISGPQPEDEADYYCEL
Condylura cristata V247 iglv AJFV01064022.1 2071 SRAQSELTQPSSASGALGQSVVISCTGSGSDLGAGYTLQWYQQLPGTVPKLLIHDSSKRRPGVPDRFSGAVSGTSGSLTIAGLQPEDEAEYICQ
Condylura cristata V248 iglv AJFV01064029.1 18729 SVVSYELTQPPSASVALGGTVTITCQGDKLGSYYAHWYQQKPGQAPVLVIYNDKERPSGIPERFSGSSSGKTATLTISGVQAEDEADYYCLSSESDYD
Condylura cristata V249 iglv AJFV01064032.1 275 SVVSYELTQPLSASVDLGGTVTITCQGDNLGSYYAHWYQQQPAQAPVLVIYNDKERPSGIPERFSGAKSGKTATLTISGAQAEDEAVYHCQSYDSSSD
Condylura cristata V250 iglv AJFV01064035.1 162 ALIIAALRQPAAVSVALGQTATVTCKGTIGDAAWYQQKPGRAPVLLVDASDKRAPGIPEQFSGSSSGSSATLTISRAQAEDDAEYHCQSLDISDD
Condylura cristata V251 iglv AJFV01064037.1 789 SVVSYALTQPPSASVALGGTVTITCQGDNLGSYYTQWYQQQPGQAPVLVIYKDKERPSGIPERFSGTSSGKTATLTISGVQAEDEADYYCQSADSNGK
Condylura cristata V252 iglv AJFV01064044.1 1050 PVVSYEVTQPASMSADPGATVKLTCQGNNIGSYYTSWHQQHPGQAPVTLIYGSSNRPSGIPARFSGANSGNTATLTISGVQADDEADYYCAASSSSIG
Condylura cristata V253 iglv AJFV01064046.1 100 TVISYEVTQPASMSADPGATVTITCQGDKIGRYYASWHQQKSGQAPVTLIYNNRYRPSGIPERFSGTVSGNTATLTISGVQAEDEADYFCAASSSNDD
Condylura cristata V254 iglv AJFV01064047.1 3053 PVVSYEVTQPASLSAALGATVKITCQGDNIGNYYASWHQQHPGQSPVTVIYSNNDRPSGIPERFSGAKSGNTATLTISGVQAEDEATYFCAAGSSSIG
Condylura cristata V255 iglv AJFV01064048.1 62 VVVSYEVTQPASLSAALGSTVKITCQGDNIGNYYASWHQQHPGQAPAPVIYSNSKRPSGIPERFSGAKSGNTATLTISGVLAEDEADYYCAAGG
Condylura cristata V298 trbv AJFV01074379.1 4694 CLQGTTVTQNPRFQVVRTGQPVNLSCSQTLSHGIMYWYQQKPGQAPVLLLYYYDQYLTKEKGTPDNFQASRPALPECLLHLGSPAVGDSALYLCASSR
Condylura cristata V299 trbv AJFV01074381.1 1577 LVLGGITQTPKYLLQKEGLAVTLQCEQNLNHDAMFWYRQDLGRLFYSSVSKNVQKVELSEGYNASRDQKPAFLLSLASPQRGQSALYLCASSV
Condylura cristata V300 trbv AJFV01074382.1 9379 HAAAKVTQDPRYLIAEPGRRLVLQCSQTMGHDAMYWYRQDPGLHPELIYYSINTNLTNKGDASEGYSVSRQYKENFPLTLEAATLRQTSLYLCASSK
Condylura cristata V306 trdv AJFV01075660.1 1860 QAVLCDKVTQSSQIQTMVAGSKGTLHCTYETGYSNPDLYWYRMRADHSLQFVLYRDNSQSINADFTQGRFSVQHSKTKKTFHLVVFPAKIEDSATYYCALN
Condylura cristata V316 ighv AJFV01080937.1 5096 AGEVWGRLGAARGSLRLSCATSGFTFSSSRMHYVHQAPGKGLQWVAVIWYEGSEKYYADSMKGLLTIPRDNGKNSLYLQMNSLRPEDTAIYYCVR
Condylura cristata V317 ighv AJFV01080941.1 562 VWCEEKLLETGGDLVQPGGSLRLSCAASAFTTSSYWMYWVRQAPGKGLQWVARIYANSGSTDYADYVKGRFTISSDNAKNTIYLQMNSLKPEDTAVYYCAG
Condylura cristata V318 ighv AJFV01080945.1 2270 VQCEEKLVESGGDLVQPGESLRLSCAASGFYFSSYWMYWVRQAPGKGRQWVAGINNNGGSTGYADSVKGRFTISRDNGKNSLYLQMNSLKPEDTALYYCA
Condylura cristata V319 ighv AJFV01080950.1 8730 VQCEEKLVESGGDLVQPGGSLSLSCAASGFTFSSYSMSWVRQAPGKGLQWVAGIYYDGSSTNYADAVKGRFTISRDNGKNSLYLQMNSLKPEDTAMYYCA
Condylura cristata V320 ighv AJFV01080954.1 891 VQCEEKLMESGGDLVQPQGSLRLSCAASGFTISSYSMDWVRQAPGKGLQWVARIYADGGSTYYADAVKSRFTISSDKAKNTVYLQMNSLKPEDTAVYFCAR
Condylura cristata V321 ighv AJFV01080954.1 4776 VQCEEKLVESGGDLVQPGGSLRLSCAASGFTISSYWMNWVRQAPGKGLQWVASIYADGGSTYYADAVKGRFTISSNKAKNTVYLQMNSLKPEDTAVYYCAR
Condylura cristata V322 ighv AJFV01081271.1 2567 VQCEKKLVESGGDLVQPGGSLRLSCAASGFDFSSKDMSWVRQAPGKGLQWVAWIRYDGGSTWYADAVKGRFTISRENGKNTVYLQMNSLPEDTAVYYCAR
Condylura cristata V323 ighv AJFV01081275.1 471 VRCEEKLVESGGDLVQPGGSLRLSCVTSGFTFSNCYINWVRQALGKGLQWVARIYADGGSIYYADSVKGRFTISSDKAKNTVYLQMNSLKPEDTAVYFCARE
Condylura cristata V324 ighv AJFV01081276.1 42 VQCEEKLVESGGDLVQPGGSLRLSCAASGFDFSSYWMSWVRQAPGKELHWVGEINANGGTTNYADSVKGRFTISRDNGKNSLYLQMNSLKPEDTAVYYCAR
Condylura cristata V325 ighv AJFV01081277.1 816 VQCEVKLVESGGDLVKPGGSLRLSCAASGFTFSSYSMHWVRQAPGKGLQWVARIYDDGSSTNYADAVKGRFTISRDNGKNTVYLQMNSLKPEDTAVYFCAR
Condylura cristata V326 ighv AJFV01081470.1 707 VRCEEKLVESGGDLVQPGGPLRLSCAAIGFTSSNNYMNWVRQAPGKGLQWVARTYSNGGNTYYADSVKGRFTISNDNAKNTIYLQMNSLKPEDTAVYYCGR
Condylura cristata V327 trgv AJFV01082349.1 6047 SPISFSSVGRKMSLTRRTGSLANITCDIVDQKVNYIHWYQHRMGEAPHRLLFLSFSDLKAMVEAGINPEKYEAYKNSRRRCKLVVRNVQQSDAGIYYCAAW
Condylura cristata V328 trgv AJFV01082610.1 1538 SPISFSSEGRKMSVTRRIGSLAEITCDIVDQKVNYIHWYRHRVGEAPHRLLYFSFSDSKPVLESGISPGKYHAYEGSRRSCKLVVRNVQQSDAGIYYCAAW
Condylura cristata V329 trgv AJFV01082610.1 3493 SPISFSSEWRTMSVTRKTGSLAEITCDIVDQKVNFIHWYRHGVGEAPHRLLYFSFSGSESVVEAGIESEKYRVSAISGRRCKIVFLNIQQSDAGIYYCAAW
Condylura cristata V330 trgv AJFV01082622.1 1538 SPISFSSEGRKMSVTRRIGSLAEITCDIVDQKVNYIHWYRHRVGEAPHRLLYFSFSDSKPVLESGISPGKYHAYEGSRRSCKLVVRNVQQSDAGIYYCAAW
Condylura cristata V331 trgv AJFV01082622.1 3493 SPISFSSEWRTMSVTRKTGSLAEITCDIVDQKVNFIHWYRHGVGEAPHRLLYFSFSGSESVVEAGIESEKYRVSAISGRRCKIVFLNIQQSDAGIYYCAAW
Condylura cristata V332 igkv AJFV01083436.1 1095 SSGEIVLTQSPASLSLFPGERATISCRASQSINSNLAWHQHKPGQAPRLLIYSASNRPDGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQHYMGYT
Condylura cristata V516 igkv AJFV01049766.1 26700 SSGEIVLTQSPASLSLSQGERATISCRASQSVSNWLAWYQQKPGQAPRLLIYKVNSRPNGIPARFSGSGSGTDFTLTITSLEPEDVATYYCYQHNSG
Condylura cristata V517 igkv AJFV01049766.1 20316 ARGDIQLTQSPPSVSASPGDRVTMTCRASQSASNNLHWYQQKPGQAPRLLIKYANSRPDGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQQWYNNP
Condylura cristata V518 igkv AJFV01049766.1 17343 SRGEIVLTQTPASLSGTRGESATITCRSSQSISTSLHWYQKKPNQSPKLLVKYASQSVPGIPSRFSGSGSGTDFTLTISSLEPEDAATYYCMESKGWF
Condylura cristata V519 igkv AJFV01049768.1 2903 SSGEIVMTQSPASLSLSTGEKATISCRASQSAYSWLNWYQQKPGQAPRLLISWANSRPDGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQQYDSYP
Condylura cristata V520 igkv AJFV01049774.1 2319 SSGEIVLTQSPASLSLSLGEKATISCRASQSVSSYMAWYQQKPGQAPRLLIYKANNRPNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCLQHNSWP
Condylura cristata V521 igkv AJFV01049777.1 7812 SSGEIVLTQSPASLSLSPGQKATISCRASQSLSNNWLHWYQQKPGQAPRRLIYNANSRPNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCYQSNS
Condylura cristata V522 igkv AJFV01049777.1 4179 TSGEIVLTQSPASLSLSPGERATISCRASQSVSNYLNWYQQRPGQAPRLLIYYANSRPDGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQHYMGYT
Condylura cristata V523 igkv AJFV01049779.1 4740 SSGETVMTQTPASLSLSPGEKATISCRASQSVSNWLAWYQQKPGQAPRRLIYEASKRPNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCLQHNSG
Condylura cristata V524 igkv AJFV01049780.1 9031 SSGDVVLTQTPLSLAVAPGEQVSISCRASQSLFHSDGYTYLSWLQQKPGQSPRHLIYWASNRATGVPDRFSGSGSGTDFTLKISRLEAEDAGVYYCLQN
Condylura cristata V525 igkv AJFV01049780.1 2102 SRGDIQLTQSPPSMSASRGDRVTISCRASQSFNSLAWYQQKPGNSPKPLIYASSSLQPGVPSRFSGSGSGADYTLTISSLEPEDAATYYCQQYYNWP
Condylura cristata V526 igkv AJFV01049781.1 5988 SIGEVVLTQTPLSLAVAPGEQVSISCRASQSLVASNGNTYLHWLQQKPGQSPRGLIYEVSNRHTGVPDRFSGSGSGTDFTLKISRLEAEDAGVYYCRQG
Condylura cristata V527 igkv AJFV01049781.1 1179 ARGDIQMTQSPPSVSASPGDRVTISCRASQDISKYIAWYQQIPGQAPKLLIYDTSNLQPGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQRKSYP
Condylura cristata V528 igkv AJFV01049782.1 7339 SSGEIVLTQTPLSLAVAPGEQVSISCRASKSVVSSNGNTYLSWFQQKPGQSPRLLIYKVSNRPTLVPDRFSGSGAATDFTLKISRVEAEDAGVYYCGQFGYIP
Condylura cristata V529 igkv AJFV01049782.1 2814 SSGEVVLTQTPLSLAVAPGEQVSISCRASQSLEYNGLNFLNWYLQKPGQSPRLLIYAASNRATGVPDRFSGSGSGTDFTLKISRLEAEDAGVYYCLQAIYAP
Condylura cristata V530 igkv AJFV01049785.1 619 SSGEVVLTQTPLSLAVAPGEQVSISCRASQNLVHSNGNTYLEWYQQKPGQSPSLLIYLVSKRYSGVPDRFSGSGAGTDFTLKISRLEPEDAGVYYCMQG
Condylura cristata V531 igkv AJFV01049788.1 7123 SSGEVVLTQTPLSLAVAPGEQVSLSCRASQSLVHSNGNTYLRWFQQKPGQSPRLLIYLVSKRYSGVPDRFSGSGAGTDFSLKISRLEAEDAGVYYCAQG
Condylura cristata V532 igkv AJFV01049789.1 1730 SSGEVVLTQTPLSLAVAPGEQVSISCRASQSLEYNGFSILNWYLQKPGQSPRLLIYAASNRETGVPDRFSGSGSGTDFTLKISRLEPEDAGVYYCQQSRHDP
Condylura cristata V533 igkv AJFV01049790.1 11542 SSGEVVLTQMPFSLAITLGEQISISCKASQSLVHSDGNTYLHWLQQKPGQSPRRLIYKVSNRDTGVPDRFSGSGSGTDFTLKISSLEAEDAGVYYCQQG
Condylura cristata V534 igkv AJFV01049790.1 5397 SSGEVVLTQTPLSLAVAPGEQVSLSCRASQSLVHSNGKTYLYWYQQKPGQSPRLLIYGVSNRYTGVPDRFSGSGAATDFTLKISRLETEDAGVYYCMQNIHDP
Condylura cristata V535 igkv AJFV01049790.1 1388 ARGDIQMTQSPPSVSASPGDRVTMTCRSSENVGNSLHWYQQKPGKVPKLLIYGASNLHPGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQRTNS
Condylura cristata V536 igkv AJFV01049791.1 10043 SSGDVVLTQTPLSLAVAPGEQVSISCRASQSLVDSDGDSLLYWYLQKPGQSPRLLIYWASNRATGVPDRFSGNGSETDFTLKISRLEPEDAGVYYCQQG
Condylura cristata V537 igkv AJFV01049791.1 3908 ARGDILLTQSPPSVSASPGDRVTISCRASQSVGNSWLHWHQERPGQAPRLLIYGASKRPNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCLQGNSFP
Condylura cristata V538 igkv AJFV01049791.1 1221 ARGAIQLTQSPSSVSASRGDRVTISCRASQSVSSSLHWYQQKPGKVPKLLIYGASNLQPGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQHSNGFP
Condylura cristata V539 igkv AJFV01049792.1 5092 CRGQIVLTQSPETLPAFHGAFVSITCQSSMEVGSSMAWYQQKPNEAPRLLIFGASALAAKTPSRFRGSGYGSDFSLSIHGVEAEDVGVYYCQ
Condylura cristata V610 igkv AJFV01066403.1 944 SSGQIALTQAESLPASPGESVSISCRASESLLYSDGRHYLSWYQHRPGQAPKLLIYHASTLVTGVPTRFRGSGSGADFTLTIANMEPEDSAVYYCLQTLKGP
Condylura cristata V611 igkv AJFV01066406.1 463 ARGDIQMTQSPPSVSASPGDRVTISCRASQSVSSSYLYWYQQKPGQAPRLLIYGASNRPNGIPARFSGSGSGTDYTLTISSLEPEDAATYHCQQGSSYP
Condylura cristata V612 igkv AJFV01066408.1 1478 ARGDIQMTQSPPSVSASPGDRVTISCRASQSVSYTRLAWYQQKPGQAPRLLIYGASNRPNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQQYNSYP
Condylura cristata V613 igkv AJFV01066409.1 1873 ARGDIQMTQSPSSVSASQGDRVIMTCRASQDVSNLLSWYQQKPGKTPMLLIYSASTLQPGVPSRFSGSKSGRDFTLTISSLEAEDFATYYCMQ
Condylura cristata V614 igkv AJFV01066410.1 907 SRGDIQLTQSPPFVSASPGDRVTISCRASQDISKYLAWHQQRPGQAPMRIIYDASSRPDSVPARFSGSGSGTDFTLTISSLEPEDAATYYCQQGKSTP
Condylura cristata V651 trbv AJFV01074386.1 3625 VRAQTIQQCPRSTVKQAGGRLSLECTVKGTSNPNLYWYHQATGGTLQLLFTSISVGSVQSEAPTHLNAVRPQDGQFNLTSENLTLGDSGLYLCAWS
Condylura cristata V655 trdv AJFV01075663.1 20299 VMSAIVLVPQDQEVTVSVGASVTLKCSMQGGKMTDYYISWYRIQSHTMAFIYREGGRYGHGFQGRFQGRIDNSNNQAELKIRKALQGDEGSYHCTAD
Condylura cristata V656 trav AJFV01075664.1 19365 GFCRTEIAQPLKVTTVIGTDVKLQCQYNFPDKNYESVYWYLQRADQRLRYICHVFQGTVEVKHYQLSVDRELSSSSLTIKHVQPRDKATYFCAFR
Condylura cristata V657 trdv AJFV01075664.1 12451 SPLDITLESEAKTLSVKVGEPATFRCSITGGDLKSYQMSWYKKSKNNSLVLLYKLSNNSDDNIINHFKGKIDTLKSQYVLDIPKATIKDAGTYYCGSD
Condylura cristata V658 trav AJFV01075671.1 11211 LIGEVKVEQRPPSLSTQEGENCAIYCNYSSTISVTLYWYRQDLGRSLKSLFSLASNGVVKQEGQLTASLDTKNLLSTLSFWATHQGLSATYFCAV
Condylura cristata V659 trav AJFV01075672.1 29514 PVRANWIRPQETEVSGTEGRSVSFRCDYGTSSGGSVDLYWFRQYPNQALEFILFKGWGYSGKGEADFAKHRFYSKTTADSTDLSISNLMPSDTALYYCALR
Condylura cristata V660 trav AJFV01075672.1 9821 ASTAQTVNQPQPEMSVQETETVTLNCTYETSESSYYLFWYKQPPRGEMVFLIRQESFTLQNATNNRFSGNFQKENKYFGLKISDSQLEDAVMYFCAFMG
Condylura cristata V661 trav AJFV01075672.1 1669 ATMARTVNQPQPEMSVQETETVTLNCMYETSESSYYLFWYKQPPRGEMVFLIRQESFILQNATNNRFSGNFQKANKYFGLKISDSQLEDAAMYFCA
Condylura cristata V662 trdv AJFV01075674.1 14615 PSVAYSITQDQVTVTAQEGDPGILDCEYETNSSQYYLSWYKQPPSGGLVFLINQGSNQPNKRYSRYMVKFQQEKKSITFVITSLKLEDSARYFCALW
Condylura cristata V663 trdv AJFV01075674.1 7879 SSMAQSVTQDPGPVTRQEGISGILICRYETSRYNYVLSWYKQTSSGKMVLLLIQSSSQPNKRQGRYRVNFQKEKKSISLTISSLKLEDSAMYFCALW
Condylura cristata V664 trdv AJFV01075675.1 2766 SSMADSVTQDQGTVTAQEGESAILDCNYETSWNNYYLKWYKQTPGGRIVFLINQGSLMPSNVAGRYRVNFQKERKSISLTISSLQREDSARYFCTLH
Condylura cristata V665 trdv AJFV01075676.1 1418 SSVAHSITQDQVTVTAQEGDPEVLDCKYETSWGSYYLKWYKQTPGGRIVFLINQGSLMPSNVAGRYSVNFQKERKSISLTISSLQIEDSARYFCTLH
Condylura cristata V666 trav AJFV01075678.1 60016 MNGQEVNQIPEFLRAQEGKDVTIYCNSSKTFGNLQWYKQTPRGSPVQLVMLTKGGEERKLGRLTAQYGDTRIHSSLHITAVQNADVGNYFCAQTQCSG
Condylura cristata V667 trav AJFV01075678.1 54232 GSGAQSVTQPDAPITVSEGASLELRCNYKYGGTLILFWYVQYPNQGLQLILKYLSGDSVVKGINSFEAKLETGENSFHLRKQIADQSDSAQYFCAVT
Condylura cristata V669 trav AJFV01075678.1 42390 VRGQTSVEQHPGVLVVQEGNNSSLVCNFSFSMTSVQWFQQSSGGQLVSLFYTASEVKHKGRLTCIVSGKKSYTQLNIRDSQPEDSTMYFCAVE
Condylura cristata V670 trav AJFV01075678.1 35316 QQQVKQNPPSLSMQEGEISILNCYYSGNMLDYFQWYRQCPAKGPESLISITVTKGKEERGRYTVYHNRSAKHLSLHIEASQPGDSALYLCAGR
Condylura cristata V671 trav AJFV01075678.1 31964 VRSQDVSQNPQVLVIQEKEDVTMYCSSSATLYSMQWYRQRPGEGIMFLMMLLKSGEEKLQDELTVTFDEKKEKSSLVISASQPSHSGTYFCGGR
Condylura cristata V672 trdv AJFV01075678.1 24955 SSMAQSVTQDLSTVTKQEGRAVILDCRYETRSEYYTLFWYTQSSSGEMAYLIHQDSDKSSVRQGRYIVNFQKAKKSISLSITSLRLKDTAKYFCALW
Condylura cristata V673 trdv AJFV01075678.1 20123 SSVADHVTQRQSIVALQEREYATMHCTYETSSSYYTLYWYKQSPNGNMAFLIYQDYNKESAEKGRYTVDFQKAKNSISLTISSLQLEDTGRYFCALW
Condylura cristata V674 trdv AJFV01075678.1 17442 SSMAQNVTQGQLIVMAKEGESMTMDCSYVTSWSSYTLYWYKQTPSGNLIVLIYQHNNEENAKKDRYTVNFQKEKKSISLTISPLQLGDSAKYFCALW
Condylura cristata V675 trdv AJFV01075678.1 9644 SSMAQRVTQDHGTVTAQEGDPGILDCKYETTWYSYFLNWYKLTPSGEIVFLIAQDSLLQNNTDDHRYSVNFQRERKSISLIISSLQLEDSACYFCALE
Condylura cristata V676 trdv AJFV01075679.1 8784 SSVAQKLIQDQPVVATRAGSAVTLRCRYETSLSIYYLYWYKQLPDGKMTYIIHQSSYSNINKVQGRYAINFQKEDKTVSLIITPLQMEDSAMYYCALSD
Condylura cristata V677 trav AJFV01075679.1 2472 ASSLLKVEQTPQSLQVQEGENTNSTCTFPASNFYSLHWYKMEPTQNPKFLFALASDGDIKKKGRVRADLNTEGGYSHLYNEKSQLEDSATYLCAL
Condylura cristata V678 trdv AJFV01075680.1 8152 SNVAQKVIQDQPTTTIEEGSEVTLKCRYETSLSTYYLYWYKQLPDGKMTYIIHQYSSSAKYAKKYRYSINFQKADKSISLKIVSLQLDDSARYFCALRD
Condylura cristata V679 trdv AJFV01075680.1 2077 SSVAQKVTQNQPTIVTRQGSKVTLKCRYETSLSTYYLYWYKQLPDGKMTYIIHQYSSANNAEKGRYSISFQKAVKSISLNIVSLKLDDSATYLCALRE
Condylura cristata V680 trdv AJFV01075683.1 3074 PSVALKVIQDDPAIAKREGSEVTLMCRYDTGSVWATYYLFWYRQFPDGKLTNIIHQYSSEDSTVKGRYSISHQKTDKTISLTISSLLLEDSAIYFCVLDD
Condylura cristata V681 trdv AJFV01075688.1 2100 SSVAQKVIQDQSTTTKQEGSEVILKCRYETSWSYYSLYWYKQLPDGKMSYIISQYSASAKNAAEGRYTITFQKADKAISLKIVSLQLDDSAKYFCALRD
Condylura cristata V682 trdv AJFV01075690.1 2804 SGVAQKVIQDEPTTVQQIKLEVTLKCRYEVPWSWSYYYLYWYKQLPDGKMTNVIRQYSSDNNAVKGRFSVKLQKTDYTFSLTIKSLQLEDSAMYFCALRD
Condylura cristata V683 trdv AJFV01075691.1 2081 SGVAQKVVQDEPTTVQQKGFQVTLKCRYEVPWSWSTYYLYWYKQLPDGKMTNVIRQYSSDNNAVKGRFSVKLQKADYTFPLTIKSLQLEDSAMYFCALSD
Condylura cristata V684 trdv AJFV01075693.1 7112 SSVAQEVTQDQSSVSTREGSSVALRCRYETSLSGYYLHWYKQLPDGEMTYIIHQSSYSDINAAQGRYSIHFQKELKFISLTIKFLQLDDAAMYFCALEE
Condylura cristata V685 trdv AJFV01075693.1 2100 SSVAQKVTQDQPVITKQEGSTVTLNCRYETSLGTYYLYWYKELPDGKLTYLIHQPSSAKNAQSGRYFIHLKKADKSISFIIKRLQLDDSAKYFCGLQE
Condylura cristata V686 trdv AJFV01075694.1 4983 SSMSQKVIQDQEDISTREGSAVTLKCQYETSSNYYYLYWYSQLPDGKMTLLISQHSMNNNEVKGRYSINLQKADKSISLNIVPVQLEDSAMYFCALWE
Condylura cristata V687 trdv AJFV01075694.1 1690 PSVAQKESQEQPAITFQEGSAFTMYCRYEECESEYIISWYKLSPAGKISFLISQHSNKNNVIQGRYFINLRKADKILTLTISPLQLDDSGKYFCFIM
Condylura cristata V688 trav AJFV01075695.1 37193 GSGAQSVTQLDTHVVVSEGASLVLRCNYTISVPPYLFWYVQYPNQGLQLILKDFSGDTLVKGINGFEVKRETQNTFHLRKSFADWSDSAQYFCAVS
Condylura cristata V689 trav AJFV01075695.1 32563 VRGDQVQQSPQRLILQEGAITTLRCNSSIAMNSVQWFRQNPGGSLVTLFYIPLGTKSNGRLKATTVAVERHSSLQISPAETSDSAIYFCAITTVLP
Condylura cristata V690 trdv AJFV01075695.1 21431 FSVAQKVIQDQPTTTIEEGSAVTLKCRYETSWSHYYLYWYKQLPDGKMSYLIHQSSSQNRAVSRRYSTSFQKADKSISLTVRSLQLEDSAMYFCALSD
Condylura cristata V691 trdv AJFV01075695.1 15032 SSVAQKVIQDQPVIAKQEGEGVTLKCRYETRQSLYVILWYKQLPDGKMDFIVYQLSSSKNATRDHYSINFQKAGKSISLTIASLNLEDSGKYLCALSE
Condylura cristata V692 trdv AJFV01075695.1 6458 SSVAQKVIQDQPTTTRQEGSAVTLKCRYETSWNNYYLYWYKQLPDGKMSYIIHQSSSEDNAVKGRYFIIFQKADKSISLTISPLQLDDSATYLCALWE
Condylura cristata V693 trdv AJFV01075695.1 3820 SSAAQNVTQVQPDISAREESRVTFFCQYEARWTYYYLYWYVQFPDGKMTFLVRQDSSDDNAEKGRYFTNFQRTNKSISLTISPLQLEDSAVYLCALRE
Condylura cristata V694 trav AJFV01075696.1 8347 GSGAQSVTQLDTQVVVSEGASLVLRCNYTISVPPYLFWYVQYPNQGLQLILRYTSGNSLVLGIKDFKAEHEEGKTSFHLRKSFVELSDSAQYFCAVS
Condylura cristata V695 trav AJFV01075697.1 3788 GSSKQEVSQSPALLRVQEEDSPGLNCSFTDSGIYFLQWFRQEPGRGLTSLLVIQSNERERASGRIRALLDTSSTHSALYIAAAQPGDSATYLCAV
Condylura cristata V696 trav AJFV01075698.1 13118 GSGAQSVTQLDAHVVVSEGGSLELRCNYSYRSSPYLYWYVQYPSQGLQLILKDYSGNAVVKSSKGFEAKLDKVKTSFHLKKLYANWSDTAQYFCAVS
Condylura cristata V697 trav AJFV01075698.1 7174 VRGDVVQQSPRDLILQEGANTILMCNSSNVYNVQWFRQNPGGDLVTLFYMTSGTQDKGRLKAKAPTSEKKSSLQIFSAETSDSAIYFCAMSHSASQ
Condylura cristata V698 trav AJFV01075698.1 1088 KKDQQQVEQRPQSVKAKEGETAIMNCTYKNSAFDYFPWYQQRSGQGPELLLAIRINKNREEKGRYSLLSNSSVKYLSLHIKTLEPGDSATYFCAA
Condylura cristata V699 trav AJFV01075699.1 32137 VSSQQIEQTLQTLSVQEGENATMTCSYKVSITNLQWYKQDLGRSLTRLILIRANEKKKDNGRFQVTLDASTQNSSMLITASEVADSAVYFCAVD
Condylura cristata V700 trav AJFV01075699.1 27654 RTSGDSVIQTAGPVILLEGGPLTLSCTFQSSYPATFFFWYVQRPNIGLEFLLRSSSENTKLDSSGFQASHTNKTSTLQKTWVQVSDSAVYFCAAE
Condylura cristata V701 trav AJFV01075699.1 25096 NSWTQKVTQPQSIVSVVEKEAATLRCDYEVKGFNYYLFWYKQPPGGQMTFLIHQSAYNEQGETKDQYSLDFKRNDNSINLTITASQLGDSAVYFCALRD
Condylura cristata V702 trav AJFV01075699.1 8802 GLSGEDQVEQNTQTLRTKEGDSVSLKCTYKVRGFTALQWYKQVPGRGPEMLFNLFSVGTSQHRENLNVSLSNDSSSLHIRAPMPGDSATYLCAVE
Condylura cristata V703 trav AJFV01075699.1 2824 GSSKQEVSQSPALLRVQEEDSPGLNCSFTDSGIYFLQWFRQEPGRGLTSLLVIQSNERERASGRIRALLDTSSTHSALYIAAAQPGDSATYLCAV
Condylura cristata V704 trav AJFV01075700.1 4967 GTGAQTVTQPDDHISVLAGKPVQLMCKYSYSGSSYLFWYVQYPKQPLQLLLNHLSKGTVKGFTANTGTDKSSFQLQKASAQEEDSATYFCALS
Condylura cristata V705 trav AJFV01075703.1 3630 VRGLQVNQIPPFLNLQEGKNVILICNFSTTVNYVQWFLQKPGGRLVNLFYIASATRKQEGRLSVALNANVKDKDKNSTLNIDGSQLEDSATYFCALE
Condylura cristata V706 trav AJFV01075706.1 12553 VRGLQVEQNPSVLNLQEGENTTLSCKFPNTVSYVQWFRQKPRGSPVTLFYITSVTPKQEGRLSAALHTEDKDKYSTLYIAGSQLEDSATYLCAG
Condylura cristata V707 trav AJFV01075706.1 7405 LSQGEKVEQKLSTLSVQEGSSAVLNCTYSDSASDYFPWYKQEPGKGLQLIIYIRSPRSDNKGPRYTVLLDTKAQLLSLLIPAAQVGDSAVYFCAA
Condylura cristata V708 trav AJFV01075706.1 3236 QTHGDNVTQEGQVTLSEGDSLTVSCTYSATGYPTLFWYVQCPGKGLELLLKAQKDNQKDEKGGFEATYKKGPNSFHLKKASVQASDSAVYYCALS
Condylura cristata V709 trav AJFV01075706.1 654 VKGAEVEQSPSFLSLQEGKNATLKCKTSMGVQYAQWFQQKPGGSLVMLIYTASATLKHEGRFSAALNIQDKNSTLNIDGSQLEDSATYFCAL
Condylura cristata V710 trav AJFV01075709.1 1115 VRGLQVEQSPTFLSLQEGKNATLICNFSTTVTQVQWFRQKPGGSLVTLFYITSETPKQEGRLITTLKFKDTDTDKDKYSTLNITGSQLEDSATYLCAG
Condylura cristata V711 trav AJFV01075711.1 10113 DARAQTVTQLDPHVLVSEGKSLELRCNYSYSGIPTRFWYVQYPNQGLQLLLQSFSPDPLVQGSKDFEAEFNKTNSSFNLKKSSAHWGDSAQYFCAV
Condylura cristata V712 trav AJFV01075714.1 3798 RTSGDSVSQKAGPILLLEGASLTLSCTFQTTYSSAFLFWYVQRPNKGLEFLLRSSSENTKLDSSGFQASHTKNTSTLQKTWVQVSDSAVYFCAVE
Condylura cristata V713 trav AJFV01075715.1 2763 VSGQQMKQSPQSLSIEEGEKAVLTCNFTNYSPILVHWYRQDLGQGLVFLVLIRENEAEKQAERLRVTFETTLKKSTLQIPASQPTDSATYFCAGD
Condylura cristata V714 trav AJFV01075716.1 23844 GLRAQSMTQPDDLVPVTEGDAMTVKCTYSISGFPYLFWYVQYPSQGPQFLLKYIGGDSLVKGSNGLEAEFNKNQTSFYLRKHSVTERDSGVYFCAGQ
Condylura cristata V715 trav AJFV01075716.1 19601 TLSLAKTTQPIFIDSYEGQKVNITCNHTEISTNEYIYWYRQLRNQEPKFILQTYKNNEVQEAASLFVTQDRKSSTLSLPPTTLSDSGVYYCIVR
Condylura cristata V716 trav AJFV01075716.1 7929 VKGMEVKQSLPLLSLQEGKKATLRCNFSTTVDYVQWFQQKPGGHLVSLFYIASETPKQEGRLTTTLKFKDKGKDPYSTLHIEGSQLEDSATYLCAG
Condylura cristata V717 trav AJFV01075716.1 1514 MSRGEEVKQDPSFLSVQEGATFVINCSYTDMASSYFIWYKQEPGKSLEMLIYILSTERKKQAQRLIAFMNKDKKEFLLHITATHPADSATYFCAAT
Condylura cristata V725 igkv AJFV01080801.1 9718 TSGEIVLTQSPASLLLSPGESATISCRASQSVSNNLQWYQQKSGQAPRLLIYWANSRPDGIPARFSGSGSGTDYTLTISSLEPEDAATYYCHQWSSKP
Condylura cristata V726 igkv AJFV01080801.1 5843 TSGEIVLTQSPTSLSFSPGEKVTISCRASQSVSSNLHWYQQSPGQAPRLLIYRASSRPNGIPARFSGSGSGTDFTLTISSLEPDDAATYYCQQGYSYP
Condylura cristata V727 igkv AJFV01080807.1 3359 IVLSQSPASLSLSPGEKAAISCRTSQSVGSSYLNWYQQKPGQVPRLLIYDANRRPDGIPARFSGSGSGTDFTLTISSLEPEDATTYYCQYVYYT
Condylura cristata V728 igkv AJFV01080814.1 7877 TSGEIVLTQSPALLSLSPGEKVTISCRASQSVNNNLHWYQQKPGQAPRRLIYDASNRPNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQHSYGYM
Condylura cristata V729 igkv AJFV01080816.1 1427 TTGDNVLTQSPAFLLLSPKEKATISCRASQSINNYLHWYQQKPGQAPRLLIYDASSRPNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQHSYGYM
Condylura cristata V730 igkv AJFV01080819.1 7186 STGETVLTQSPVSLSLSPGEKATISCRASQNVNSWLAWYQQKPGQAPRLLIYEASKRPDGIPARFSGSGSGTDFTLTISSLEPEDATTYYCQHYMG
Condylura cristata V731 igkv AJFV01080819.1 1656 SSGEIVMTQSPASLSFSPGEKVTISCRASESVSNYMAWYQQKPGQAPRLLIYRASSRPNGIPARFSGSGSGSDFTLTISSLEPEDAATYYCQQGY
Condylura cristata V732 igkv AJFV01080821.1 4093 SSGEIVLTQSPASLSLSPGEKATISCRASQSVSSYMAWYQQKPGQTPRLLIYDASNRLNGIPARFSGSGSGTDFTLTISSLEPEDAATYYCQQWSTWS
Condylura cristata V733 igkv AJFV01080821.1 540 SSGEIVMTQTPASLSLSPGEKATISCRASQNIYSYLAWYQQKPGQAPRRLIYAASSRPNGIPARFSGSGSGTDYTLTISSLEPEDAATYYCQYSYGYP
Condylura cristata V734 igkv AJFV01080822.1 520 SSGEIVMTQSPASLSLSPGERATISCRASQSVSNYMAWYQQKPGQAPRRLIYAASSRPDGIPARFSGSGSGTDFKLTISSLEPEDAATYYCQQYYSSP
Condylura cristata V736 ighv AJFV01081637.1 703 VQCEKLVESGETWCRLGGSLRLSCTTSGFTISSYGMSWVHQAPGKGLLWVAHISYSGGSLYYADAVKGRFTISRDNGKNSLYLQMNSLKPEDTALYYCA
Condylura cristata V738 ighv AJFV01082471.1 3023 VQCEEKLVESGGDLVQPGGSLRLSCAASGFTISSYYMQWARQAPGKGLQWVAYINSNSGSTYYADAVKGRFTISRDNGKNSLYLQMNSLKPEDTAVYYCAR
Condylura cristata V739 iglv AJFV01082893.1 644 SRARSELTQLSSVYGALDQSVVISCAGSSSNIRAGYTVQWYQQLPGIVPKLLIPASNKRPKVVPDRFSGAVSGTSGSLTIAGLQPEDEAEYICQLQSSKWGG