WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Lepisosteus oculatus AHAT00000000.1 (AHAT01) 287 62 1 43 104 53 19 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Lepisosteus oculatus Vs213 trbv AHAT01031853.1 1135 LSNSVTVKQAPPELLSLPDHPLDLNCSHDDTNYSYMFWYQQVNGGALKLIGYLSFKSETMEDEFSVKFSIAGDAQTKGSLQSKAVTDADSAVYFCAVS
Lepisosteus oculatus Vs212 trbv AHAT01031852.1 826 QSHSVHQSPPNLLEKSGGSSVFQCLNHDKNYVYMYWYQQKGGKGALKLIGHLYRKNLRPEEEFRDQFTISGDATLNGTLEVSNITAADSAVYFCAVS
Lepisosteus oculatus Vs358 ighv AHAT01042319.1 2370 VQSQVLTESEPAVVQPGGSHRLTCTASGFTFDDYAMGWVRQAPGKGLEWVATISWSGSSKYYAQPVQGRFTISRDNSNNKLYLQMSSLKTEDTAVYYCARE
Lepisosteus oculatus Vs210 trbv AHAT01031850.1 1293 VSVSLNIHQSPLALYKKLGESIALNCSTDDSSYDRMYWYRQDRNGALSLIGYFYREALTMEKEFENKFSLSGDATKTVSLQTSAITTEDSAVYFCAVS
Lepisosteus oculatus Vs217 trbv AHAT01031857.1 6550 SSASVSVAQSPLFLAKHPGESDTLKCNGQSSYFYMYWYQQLGDGALKLIGYLYTTTANPEREFEDRFKISGDATKEGFLQISDITAADNAVYFCAIS
Lepisosteus oculatus Vs216 trbv AHAT01031857.1 5413 LSNSITVLQAPLALLRRPGESIELSCSHDDRSYDTMYWYQQENTGKPITLIGYLYYKQITIESGFAEKFNITGDAKKKGLFQSSAVTTADSAVYFCAVS
Lepisosteus oculatus Vs214 trbv AHAT01031857.1 2526 SSKVLNVLQSPSELFKKPEESAEFSCSHDDTNYDKMYWYRKENGEGTLTLIGYLSFKQVFPEPEFSGKFNITGDAEKESFLQTSAVTPADNAVYFCAVS
Lepisosteus oculatus Vs352 igkv AHAT01041637.1 627 SSGQIVLTQSPAQSVLSGSSVSISCTASSTITSGSTSYLHWYLRKPGQAPELLVYYATNRYSGVPDRFTGSGSGITFILTITGVQAEDTGDYYCGQSGYSFP
Lepisosteus oculatus Vs353 trav AHAT01042025.1 4331 SSGQVTVTQTPAVKSVLSGQTVTVSCKTSPAVFGNEYLAWYQQKAGEAPKLLIYAATNRDTGIPERFSGSGSGTDFTLTIKGVQAEDAADYYCQS
Lepisosteus oculatus Vs219 trbv AHAT01031857.1 11421 HVDCISVQQSPHKLLKKPGESAELVCAHGQNTYNYMYWYQQAAEGALKLVGHLFIRNVNPEKEFQGRLFLSGDATKEGYLNISTVTVADSAVYFCAIS
Lepisosteus oculatus Vs218 trbv AHAT01031857.1 9850 PLNSSSIQQFPSVLFKNPGQSAEFSCSQNFSGYNTLLWYQQAESKSSLKLIGYLVYANPVLEDNIGKRFNVTGDAKKSGFLNISEVTPADSAVYFCATS
Lepisosteus oculatus Vs356 trav AHAT01042274.1 1532 TSVLPAQTVTVSCKTSSSVGNNCYYSGSSYTCLAWYQQKARETPKLLIYGATIRQSGIPGCFSGSGSGTDYTLTITGVQAEDAGDYYCQQYDSTP
Lepisosteus oculatus Vs357 trav AHAT01042275.1 1047 SSGQVTVTQTPAVKSVVSGQTVTVSCKTSPAVYSNNRLAWYQQKAGEAPKLLIYKATTRQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs354 trav AHAT01042028.1 3036 VTSVLPAQTVTVSCKTSSSLGTCSYTGLCGHCLAWYQQKTGEAPKLLIYYATARQTGIPERFSGSGSGTDFTLTITRVQAEDAGDYYCQQGSSYP
Lepisosteus oculatus Vs289 trav AHAT01036675.1 7417 SSGQVTVTQTPAVRSVLPGQTLTVSCKTSPAVYIYDSKHRLAWYQQKAGESPKLLIYYATTRQTGIPERFSGSGSGTDFSLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs359 ighv AHAT01042322.1 698 VTAQSSITLTQPASADLKKPGESLKLSCQVSGFQIDSYWKGWIRQAPGKGLEWLARYVNEGNSKYYASSVQGHFTASMDTSSSTFFLQMNDLRAEDTAVYYCAR
Lepisosteus oculatus Vs301 ighv AHAT01036802.1 6400 VESQIVLTESEPAVKKPGESHKLSCTASGFTFKDWYMDWIRQAPGKGLEWVAHISTGGSSTWYSQAVQGIFTISRQDSGSTLYLQMSSLKTEDTAVYYCARE
Lepisosteus oculatus Vs136 trav AHAT01019609.1 1219 MTAEDSVISLQTRVSRKEGESVTLSCSYNSTSEYVYLYWYRQYSDQPPQYILQRGARSYSGSAHTADFAKGHFSSIAERTFTTLTISSPTVGDTALYLCALRA
Lepisosteus oculatus Vs535 trav AHAT01042120.1 1943 TSVFPAQTVTVRCKTSSSVGTCSYSGSNYPCLAWYHQKVGEAPKLLIYGASIRQSGIPGRFSGSGSGTDFTLTITEVQAEDAADYYCQSLHSGV
Lepisosteus oculatus Vs537 igkv AHAT01042228.1 824 CSGQVTATQSPSVRSVLQGQTVTVSCKTSSPVYSDSNGNHIAWYHKKSEGAPRLLIYLVNKLNSVTPSWFSGSGSGTDFTLTITVQPEDATDYYCQI
Lepisosteus oculatus Vs311 ighv AHAT01036812.1 249 VTSQSSITLTQPASAEVKKPGESLKLSCQVSGFQIDSNWKSWIRQAPGKGLEWLLNYHSGSSVEYSSTIQGHFTPSIDTSSSTFFLQMNNLRAEDTAVYYCAR
Lepisosteus oculatus Vs534 igkv AHAT01042026.1 945 TEGQITMTQTPATVLVSPGQDVSLQCSASQGISWSLTWYQLKPGHSPRLLIKAGDERFDGVSTHFGGSRSGTVFTFKITGVQAEDAEDYYCQQYD
Lepisosteus oculatus Vs106 trav AHAT01019593.1 355 LTNGDSIHQLKDMETTKELQDIKIWCNYSVTYSSTSDDLFWYQQRPGRNPRYILYRTGGSTQDVKSKEYDDRFTGYLNTSAKLTYLSISNTQLSDSALYYCALR
Lepisosteus oculatus Vs105 trav AHAT01019588.1 14195 EDTVTQSPESVNIAEGGEATLNCTYSTSSTSPSLFWYIQYRNDFPRIILQRDVSGYKDNAEGFKNRFDAELNPKSNAVPLTIGETALTDSAVYYCALRPPATKR
Lepisosteus oculatus Vs104 trav AHAT01019588.1 12780 LAVGDSISPRQTVIHKTEGDWVTLSCSYSKSSSSDYYLYWYRQYPHQSPQFILYRGEQSRSSEYKADFAKTRFSSTVRGSSATMRIELLTASDSAVYYCALRR
Lepisosteus oculatus Vs103 trdv AHAT01019588.1 11017 ASFGDSVHPLSNEVYSEDGQAVTLMCNYSTSTTATHYLFWYRQSPNGNPEYLIHTDSYQGTKRTEGYEILVDKDTKQVQLNISKLDVAESATYYCALS
Lepisosteus oculatus Vs102 trav AHAT01019588.1 8660 LAFSDSLSPKKTEVSATEGDSVTLDCSYSTSITDPYLYWYRQYPQQAPELILYKRRSWDSSSTYKADFARSRFTTIVTDKSTTLTITTLSLSDTGVYFCALS
Lepisosteus oculatus Vs100 trav AHAT01019588.1 5048 ITSGNEITQKSAPVLKTEDEKAVLECTFSTSSSDYLIHWYRHYSGSEPQFILYGGSETYTEDFAKERFSSAVSKRRGTATLTISRVLLEDSTIYYCALQ
Lepisosteus oculatus Vs137 trav AHAT01019609.1 3021 MTAEDSITPLQTQVSRKEGESVTLSCSYDTSDEYVYLYWYRQYSDQPPQYILLRGARTYRGDTNTAEFAKARFSSTAERTSTTLTISNLAVGDTAVYLCALRP
Lepisosteus oculatus Vs516 trav AHAT01037388.1 4261 SNGQISVTQTPRISIAAGQTLTVNCKTSPAVYNNNRLSWYQQKAGEAPNLLIYDATTRQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQG
Lepisosteus oculatus Vs517 trav AHAT01037392.1 4588 CNGQISVTQPPVISSAPGQTVTVSCKTSPAVYNNNLLAWYQQKAGEAPKLLIYGATNRQTGIQERFSGSGSGTDFTLTITGVQAEDVADYYCQS
Lepisosteus oculatus Vs510 ighv AHAT01036854.1 10808 VQSQIVLTESEPAVVQPGGSHRLTCTASGFTFSSYEMHWVRQASGKGLEWVAFISSGGGTTNYPDSVKGRFTISRDNSKNQLYLQMSSLKTEDTAVYYCAKD
Lepisosteus oculatus Vs350 trav AHAT01041460.1 20732 TSVLPAQTVTVSCKTSSFVGTCFYSSFQSGICLAWYQQKAGEAPKLLIYAATIHESGIPEHFSGSESGTSGTDFTMTITGVQAEDEGDYYCQQYG
Lepisosteus oculatus Vs109 trav AHAT01019593.1 6977 DSSGNTLTPASESEHVREGGSVTFSCVYTGDVLYLQWYRQYPGQRLAFIVLIHEATLTESRSDPADHRFNIELDKEKKRVELKLSSATVTDSALYYCALN
Lepisosteus oculatus Vs108 trdv AHAT01019593.1 4168 VSSANQIRSKGTVALKTEGEQAVLECTFSTSSSSYLIYWYRQYPGMAPQFILYTGALSNTADFAKGRFSANADTTTGLTTLTISKVLLEDSAVYHCALR
Lepisosteus oculatus Vs351 trav AHAT01041633.1 2010 SSGQVTVTQTPTVKSVLSAQTVTVSCKTSPAVYVYNSKHYLAWYQQKAGEAPKLLIYYATTRQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs208 trbv AHAT01031848.1 12182 HIQGFSVIQTPPILWKNAGESAEMRCEHQDSSYYQMYWYRQLPEERIQQIVYSDTTGKPDFGEFSKEKYEVHKTIAQNGSFTVKKLEPGDNAMYFCAAG
Lepisosteus oculatus Vs209 trbv AHAT01031848.1 14402 LAEGISVTQTPLILLKEPGRSAEMRCEHQDSSYYQMYWYRQLLGERIQLIVYSTAGGDPDFGEFNKEKYEVHKTIAQNGSFTVKNLEPGDSATYFCAAS
Lepisosteus oculatus Vs543 trav AHAT01042947.1 2359 STGQATVTQIPAVISVKTGDIVTITCKASPAAFNNHQLAWYQHKAGQAPKRLIHFATNRDTGVPERFSGSGSGTDFTLTITGVGAEDAADYYCQS
Lepisosteus oculatus Vs204 trbv AHAT01031848.1 4434 GHCEVNKVLQTPILWKKSGESAEMHCEHKLDITYTAMYWFHQRPGERMQLIVYSVVGGDPDFGEFSKEKYEVNKSEAQKGSFSVKNLEPGDSATYFCAAG
Lepisosteus oculatus Vs205 trbv AHAT01031848.1 6889 NCKRIDVSQTPTILWNNTGESTEIHCAHKEGVEYNAMYWFRQLPGERTHLIVYSAVGADPDFGEFSKEKYGVKKPAAQTGSFSVKNLEPGDSATYFCAVS
Lepisosteus oculatus Vs206 trbv AHAT01031848.1 9483 NCQKISVSQTPSIAWNKTGESAEIRCEHQRGADYSTMYWFRQLPGEKIQLIVYSFVGGDPDFGKFSKEKYDVKKTEAQKGSFTVKNLEPGDTATYFCAAG
Lepisosteus oculatus Vs531 igkv AHAT01041786.1 5191 SSGQIVLTQSPTQSVLPGSSVSISCTASKSVSSSYLNWYLQKPGQAPQLLVYGATNRYSGVPDRFTGSGSGTAFTLTITGVQAEDAGDYYCQSYRSGV
Lepisosteus oculatus Vs201 trbv AHAT01031847.1 22524 GHCEVSKVLQTPILWRKPGGSAEMHCEHKLDINYNAMYWFRQLPGERIQLIVYSVVGGDPDFGEFSKEKYEVHKTIAQNGSFTVKKLEVGDGATYFCAAG
Lepisosteus oculatus Vs202 trbv AHAT01031848.1 325 GRGQELHVSQTPLILWNNTGESVSMHCEHQGGVTYNAMYWFRQLPGERIQLIVYSAVGIDPDFGEFSTEKYDVKKPEAQKGSFTVKNLEPGDSTTYFCAAG
Lepisosteus oculatus Vs524 trav AHAT01040496.1 3475 SSGQVTVTQTPAVKSVLSGQTVTVNCKTSPAVNSNNHLHWYQQKAGEAPKLLIYDATSRYTGIPERFSGSGSGTDFTLTVTGVQAEDAADYYCQS
Lepisosteus oculatus Vs304 ighv AHAT01036802.1 14164 IQSQVLTESESAIVQPGGSHRLTCTGSGFTFSSHYMDWVRQAPGKGLEWVAEISSNGGSTWYSQSVQGRFTISRDNSKNQLYLQMSSLKTEDTAVYYCARN
Lepisosteus oculatus Vs140 trav AHAT01019611.1 6671 MTAEDSITPLQTQASGKEGKSVTLSCSYDTSDEYVYLFWYRQYSDQPPQYILRKGARSYSGTDTAEFAKARFSSTAEKTSTTLTISSLTVGDTAVYLCALRA
Lepisosteus oculatus Vs533 igkv AHAT01042026.1 7824 SSGQIVMTQTPPALSVLSGGSVTIHCKASSSITGSKNYLNWYQQKPGEAPKLLIYWATTRQTGIPERFSGSGSGLDYSMIISGVQAEDAADYYCGQGW
Lepisosteus oculatus Vs355 trav AHAT01042262.1 1255 SSGQVTVTQTPEVKSVLPGQTVTVSCKTSPAVYGNNRLAWYQQKAGEAPKLLIYYASSRYTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs199 trbv AHAT01031847.1 18726 GCGQELHVSQTPLILWNNTGESVSIHCEHQGGISYNAMYWFRQLPGERIQLIVYSVVGIDPDFGELSTKKYDVKKTEAQKGSFTVKNLEPGDSVTYFCAAG
Lepisosteus oculatus Vs285 trav AHAT01036087.1 4044 LTQTEEVTQPGLIQTTLLGSQVTLHCYLSKEKADYTVWLKQRIGQKPQYIAMYYSNLKRAMFYDQFKDNPRFMVKNDKKQFHLMISRTQPSDTAMYYCGII
Lepisosteus oculatus Vs305 ighv AHAT01036806.1 323 VQSQVLTESEPAIVQPGGSHRLTCTASGFTFSSYNMNWVRQASGKRPEWLAYINGNGGTIHYSQSVQGRFTISRDNSKNQLYLQMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs110 trav AHAT01019593.1 8717 VRSQSQVSQRPASLTVTEGETAILYCNYSSSDARSLHWFRQRANGSPEIIMILFSTQNEENQFSGSVDMEKRTGVFNVSNSQAEDSGSYYCAVE
Lepisosteus oculatus Vs111 trav AHAT01019593.1 10688 VTTGDSIRSEETEASSQEGEPVTLHCTYSITGSYVYLYWFRQDPDKPLEYILFRPARSSTYSHTADFAKGYFDSSTTKDSTTLTIKTVSLADTAVYFCAMQ
Lepisosteus oculatus Vs112 trav AHAT01019593.1 22266 ESGANTIVPTSKSQVVSEGHSTSLICNYTGDVKNLQWYRQLPGRTMEFIILIYETGTDVKASPPIPGFSAAVDKEKKRVELKLSSATVTDSALYYCALS
Lepisosteus oculatus Vs113 trav AHAT01019593.1 23498 HARGQSVNQSMSSITAKEGQNATIPCFYKEGSTTSYLFWYIQTVPQPPYLIYNELLKQQSVPEKFKNRLSAEKKENTFHLQISPVELSDSSVYFCALQ
Lepisosteus oculatus Vs114 trav AHAT01019593.1 25460 VRSAEQVSQIPAQVTVAEGRTASIHCNYTDSRVTVVHWYRQQPSTKPEKVISSYGDLERENQLSAWLNTKGRFGVFNISLSQTGDSALYYCAVE
Lepisosteus oculatus Vs115 trav AHAT01019593.1 29092 VRSQTQMSQRPASLTVTEGGTATLHCNYTANNFYSLQWYRQKPNASPEKVLILTTDKIEEDKQFRGSLDTGKRIGVLNVSSSQAEDSATYYCAVQ
Lepisosteus oculatus Vs116 trav AHAT01019593.1 31235 EVFPWRDIKTSVETQETRIYCNYSLTNKAYTEYLFWYQQRPGRNPRYILHRYKSGSKTEGVKSEDFDSRFTGHLNLTAKFTYLSISSTQLSDSALYYCALS
Lepisosteus oculatus Vs117 trav AHAT01019594.1 1609 MSYGDKVYPWMDFQTSEETQETRIYCNYSLTSTANEYLYWYQQRPGGNPRYILYRIGSNNEDFRSEEFDGRFTGYLNTSAKFTYLSISRTQLSDSALYYCALK
Lepisosteus oculatus Vs118 trav AHAT01019594.1 3002 KVYPWEDIQTSEESQETRIYCNYSLTSSTTEYLFWYQQRPGGNPRYILHRYKSGSKTERVKSEDFDSRFTGHLDLNAKFTYLSISSTKLSDSALYYCALR
Lepisosteus oculatus Vs119 trdv AHAT01019594.1 4653 LSTGNQIDQKGTSVITTEDAEATLECTFSTNSYFYYLHWYRQYPGKPLQFILFRGTGAHTADFAQERFSSSADKSTSLTSLTISGVVLEDSAVYYCALQ
Lepisosteus oculatus Vs291 ighv AHAT01036782.1 9485 VRSDVVFTQSGPEIKKPGESFKISCKASGYTYTDYNINWIRQSPVKGFEWLGYITSRYSTGYADAVKGKMTFTRDNSNSMAYLQMSNPTSEDTAVYYCARY
Lepisosteus oculatus Vs297 ighv AHAT01036797.1 2281 VLGEVVLTQPEAQVKKPGETLTIPCTASGFTFTSHTMFWIRQLPGKELQWLGYINSGSSTSYADFVKGRLTLTRDNSRNRVEMQMSSLKTEDTAVYYCARE
Lepisosteus oculatus Vs296 ighv AHAT01036795.1 1294 ADADVSLTSSEPQVKKPGESVRLSCTVSGFSMSSYHMYWVRQAPGKGLEWIGVIWNNGGTVYTDSLKSRLTITRDTSSSMVYMQLNSLSTEDTAVYFCTRE
Lepisosteus oculatus Vs295 ighv AHAT01036792.1 1148 VRCITLTSSDPEVKQPGEAVKISCKISGYSLTDYGTVWVRQPPGKRMEWIGIIWGGGSIDYLESLKSRFVISRDTSSNVLYLEMKSLTDEDTAVYYCAKT
Lepisosteus oculatus Vs294 ighv AHAT01036785.1 1590 VKCGLESIPSSPEVKKPGETLSLSCKGSEFNFGSYGMHWIRQPQGKPLDWMGAIWYDASKTVYSEAVKDRITITRDNPKNMVYLQLTGLRPEDSAVYYCAK
Lepisosteus oculatus Vs279 ighv AHAT01035647.1 7285 VQSDVVLTQSESAVVTPGGSHRLKCTVTGFNVAGYSMFWIRQAPGKGLEWIVYFYSSSDNNYAPAVQGRFTASKDSSSLYLDMTSLRAEDTAVYYCAR
Lepisosteus oculatus Vs271 ighv AHAT01035632.1 8096 ARSDVVLTQTDAQLKAPGDKITLSCTGSGYTFKDYGMHWVRQAPQKGLEWLAYNSYSSASHDEYADFIKERIKVTRDNSKSVAHLEISSLKTEDTAVYYCARR
Lepisosteus oculatus Vs270 ighv AHAT01035632.1 878 VQSAVVLTQPGPQLVAPGGKLNLTCTGSGYEFKDYSMSWIRQAPQKGLEWVASISSPSGSNKYYSNSVQGRFTISRDNSKSTVYLEMSSLKTEDTAVYYCARQ
Lepisosteus oculatus Vs330 trav AHAT01037398.1 22193 CNGQISVTQPPVMSIAPGQTVTVSCRTSPAVHNNNHLNWYQQKAGEAPKLLIYLATSRQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs512 trav AHAT01036890.1 22015 VIPENVVNQPHLSVTAGLGGSVSLECFIFTEETLINWVWFKQVLGHPPRYFLTSFGKSDKATFYSEFEDTTRFTMKKMYSQFTLTISQVQLSDVATYYCGFQS
Lepisosteus oculatus Vs275 ighv AHAT01035635.1 7322 SSTISLTPSTSSELRKPGESLTISCETSGFTLSSSLWMDWIRHAPGTSLQWLGDDGGSFAPSIKARLTLRRDSSNTRSTMVLKDLQPEDTAVYYCSRH
Lepisosteus oculatus Vs141 trav AHAT01019612.1 538 MTAEDSITPLQTQVSRKEGESVTLSCSYDTSDEYVYLYWYRQYSDQPPQYILLRGARTYRGDTNTAEFAKARFSSTAERTSTTLTISNLAVGDTAVYLCALRP
Lepisosteus oculatus Vs277 ighv AHAT01035635.1 21682 VQSDVVLTQSESAVVTPGGSHRLKCTVSGFNVASYSMYWIRQAPGKGLEWIVYFYSSSDNSYAPAVQGRFTASKDSSSLYLDMTSLRAEDTAVYYCAR
Lepisosteus oculatus Vs276 ighv AHAT01035635.1 18070 VQSDVVLTQSESAVVTPGGSHRLKCTVTGFNLASYSMFWIRRAPGKGLEWIVYFYSSSDNSYAPAVQGRFTASKDSSSLYLDMSSLRAEDTAVYYCAR
Lepisosteus oculatus Vs314 ighv AHAT01036812.1 13583 VTAQSSITLTQPASAEVKKPGESLKLSCQVSGFHIDSYWKGWIRQTPGKGLEWLAHYHDESNTKYYASSVQGRFTASMDTSSSTFFLQMNNLKAEDTAVYYCAR
Lepisosteus oculatus Vs99 trav AHAT01019588.1 3477 VSSELEVSQLPSSLSVMEGETAVLHCSYSFTTIQSLQWYRQRTNNSPEKLLVMAVTGTVSENQFSASLDEKNRSGVLNISSSQTEGSVMYYCAVE
Lepisosteus oculatus Vs147 trav AHAT01019614.1 9393 AVHCDSISSLQTKVSKEEEGSVSLQCSFSTSSSGYGLYWYRQYPHTPLQFILFKEGGTWSGEHTEDFAKDRFSSAVDGSSTTLTITKLSLNDSAVYFCALRA
Lepisosteus oculatus Vs300 ighv AHAT01036802.1 3576 VHTQVLTESEPAVVQPGGSHRLTCTASGFTFSSAWMDWVRQAPGKGLEWVAEINSNGGSTWYSQSVQGRFTISRDNSKNQLYLQMNSLKTEDAAVYYCARG
Lepisosteus oculatus Vs284 trav AHAT01036085.1 15541 MANIDNIVQPSILKMVQPGDSVTLECFLPFDKISYMLWFKQTIGQGPRCILRSYYLSNDTTFFDEFKKSHFMVEKNTGKGFFHLIISRTKKSDTATYYCATA
Lepisosteus oculatus Vs85 trav AHAT01019585.1 618 ARSQIQVSQRSTSQTVTEGETAILHCNYTITATNFGSLQWYRQKVNRRPENIMILFSGNKEDKQFSGSVDTGKRIGVLNVSNSQAEDSATYYCAVG
Lepisosteus oculatus Vs287 trav AHAT01036631.1 7314 SSGQVTVTQTPAVKSVLPGQTVTVSCKTSPAVHIYDSKHRLAWYQQKPAEIPKLLIYDATTHQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs280 igkv AHAT01036076.1 5633 VISAHTVSQSHPSVLVQLGDSVTLKCTIEQEQLSQLLWYKQVVGQAPRAILSSSGYDSSLTLYKGFRDSRFVMQKNGTCFNLHISKVKFSDTATYYCGTID
Lepisosteus oculatus Vs281 igkv AHAT01036078.1 8316 VISPDLISQPRSSVMVQLGKSATLECTIEQKHLSHLVWYKQVIAQAPSCILSSFGHSNLFTLYEGLKDTRFVMQKNGTRFNLHISKVEFSDIATYYCGAIR
Lepisosteus oculatus Vs283 igkv AHAT01036084.1 1435 SESISRSVVQQPVSAPVRPGDNATLQCTIHMETCAGDHSVYWFRHDSEESLPGIIYTYENRSDHCERSSVTGAPTQNCVYNLPKRNISPSDAGTYYCAV
Lepisosteus oculatus Vs274 ighv AHAT01035635.1 4762 KCLNEYKKYPQPSQPEIKKPEEMVKLSCRVSGFTLSSSHYMSWIRQAPGQCLEWLLYIRGDNTDISYAQSIQGRALASTDSSTTAYLELRSLQTDDTALYYCA
Lepisosteus oculatus Vs302 ighv AHAT01036802.1 8480 LQTQIVLTESEPAIVQPGGSHRLTCTASGFTLSSYCMNWVRQAPGKGLEWVARDCNPTAHYAQSVQGRFTISRDNSKSQLYLQMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs288 trav AHAT01036661.1 1797 SSGQITVTQTPVISTAPGQTLTLSCKTSSAVYIYNSKHLLAWYQQKTGEAPKLLIYGETTPQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCLAHSTSGL
Lepisosteus oculatus Vs87 trav AHAT01019585.1 4265 KVYPWKDFQTSEENQETRIYCNYSLTNTVDYEYLYWYQQRPGGNPRYILQCYKSGSDYKTSRSEDFDSRFTGHLDLNAKFTYLSISSTQLSDSAFYYCALK
Lepisosteus oculatus Vs367 igkv AHAT01042956.1 10372 CNGQISVTQPPVISSAPGRTVTVSCRTSPAVYNNNNLNWYQQKAGEAPKLLIYGATNRQTGIPERFSGGGSGTDFTLTITGVQAEDVADYYCQS
Lepisosteus oculatus Vs366 igkv AHAT01042928.1 4303 SSGQVTVTQTPSVRSVLQGQTVTVSCKTSSPVYSDSNGNRMAWYHQKSEGAPRLLINLVNKLNSGTPSHFSGSGSGTDFTLTITGVQAEDAGDYYCQS
Lepisosteus oculatus Vs471 iglv AHAT01026653.1 6275 SQGLVMTQQKSLSVSPGASAKISCAIDSHRSWVITWYQQKTGSAPRFLLYDSTRGSGTPERFTASEESSGKMEYLNIASVQQEDEATYYCACHGCPSD
Lepisosteus oculatus Vs86 trav AHAT01019585.1 2350 KNVAAEVDQPIMIFSYKGQKAALRCNHSIASFQNMYWYLQRSNGAPELLIYGYDKAEPKGRFSMEFDRAGRVTELHISDTQLEDAVMYYCAVQ
Lepisosteus oculatus Vs363 igkv AHAT01042617.1 12155 SSGQIVLTQSPAQSVLSGSSVSISCTASQSIRDDVHWYLQKPGQAPQLLVYGATNRQSGVPDRFTGSGSGTAFTLTITGVQAEDAGDYYCQQSD
Lepisosteus oculatus Vs362 igkv AHAT01042600.1 2395 SSGQIVLTQSPAQSVFPGSSVSISCTASSSVYCSTHKVEELSWYQQKPGEAPKLLIYTVNTRHSEIPERFSGRKSGLIYTLSISEVQTQDAGVYYCMQTALRP
Lepisosteus oculatus Vs361 igkv AHAT01042578.1 1527 GTEGQITMTLTPATVSVSPEQDVSLQCSASQGISWSLTWYQLKPGHSPRLLIKAGDERFHGVPTHFGGSRSGTVFTFKITGVQAEDAGDYYCQQYD
Lepisosteus oculatus Vs360 trav AHAT01042408.1 4173 SSVQVTVTQTPAVKSIAPEQTITVTCKTSRAVYNKNHLPWYQQTAGEAPKLLIYYATTHQTGIPEHFSGSGSGIDLTLTITGIQVEDAGDYYCQS
Lepisosteus oculatus Vs149 trav AHAT01019614.1 14444 ARSGLSVAPERTEVHGEAGGSARLACSHSAESSSALLLWYRQRPLASPEHILYQGVGSYRDTQYVEDFAEGRFTSAADSASTTLHISDLTPTDSALYFCALR
Lepisosteus oculatus Vs143 trav AHAT01019613.1 26 GISFGNQITQKDTPVFKTEGERATLECTFSTSSTSYWIHWYRQYPGSAPQFITFSGSRSYTADFAKQRFSSTADKNSGLASLTISGVLLDDSTVYYCALE
Lepisosteus oculatus Vs142 trav AHAT01019612.1 2687 AHSADEVIQTPDTEVITEGESLLIQCDYKTSSFYAMHWYKQSHLQTLQQIGRMRSSGKNGGASDKFQFSLDTSRKTGSLTIKPTVADSAVYYCAIEP
Lepisosteus oculatus Vs98 trav AHAT01019588.1 1247 ICLGDSITPISSEVQAEEGQEVTLICNYNTTSTGTQYLFWYRQSPNRSPEYLIQTDTYSGSNRKDGYETRVDKDSKRVWFKISEPGAADGAVYYCALR
Lepisosteus oculatus Vs91 trav AHAT01019585.1 11232 TAGGQSVDQSSSVTVKEQGDTTIPCSYKDPPTGFTMFWYVQTSGKAPEAIYNELLPKDSVPPRFQNRLSAAHEKKEKTFHLQISPVELSDSSVYFCALQ
Lepisosteus oculatus Vs138 trav AHAT01019611.1 1943 TEAKDSITPLQTRLIVKEEESVTLNCSYNTSSEDVLLYWYRLYPDQAPQYILLRGARSYSAASNAAYFAEDRFSSTADRTTTTLTALSLRLGDTAVYHCALQVL
Lepisosteus oculatus Vs146 trav AHAT01019614.1 6253 AVRCDSISPRQPKVSGEEEGSVSLQCSFSTSSAGYALYWYRQYPHRPLQYILFKEGGTWSREHTADFAKDRFRSAVTGSSTTLTISKLTLSDSAVYFCALRA
Lepisosteus oculatus Vs145 trav AHAT01019614.1 4364 EVHQLERIQTAMETQTTRIYCNYSLTDPTDFEYLFWYQQLQGSHPRLILNCYRTGNGQDCTPGQLDNRFTGDLNTSAKITAVSLSGTQLSDSALYYCALK
Lepisosteus oculatus Vs144 trav AHAT01019614.1 3016 HRVSSAVQQTEQTASADGETAQMSCNHSVSSYNSMQWYRQLPGQSPEVILVSYTDPVSVGRFRMTVRKESLSTALEIQGVQVQDSESVYYCAVR
Lepisosteus oculatus Vs92 trav AHAT01019585.1 16240 EVQEWRDIQTSEETQETRIYCNYSLTNKTDNEYLYWYQQRPGGNPRYILQRYKAGSENKTSKSKDFDSRFTGHLNLTAKFTYLSISNTQLSDSALYYCALR
Lepisosteus oculatus Vs93 trav AHAT01019586.1 1423 QVYPWKDFQTSEENQETRIYCNYSLTNTVNYEYLYWYQQRPGGNPRYILQCYKSGSDYKTSRSEDFDSRFTGHLNLTVKFTYLSISSTQLSDSALYYCALR
Lepisosteus oculatus Vs90 trav AHAT01019585.1 9222 STNGDQVYPWVDIQTSEETQETRIYCNYSVTSSTTEYLYWYQQRPGRNPRYILYRMSNVLKDFRSEEFDKRFTGYLNTSAKFTYLSISRTQLSDSALYYCALR
Lepisosteus oculatus Vs522 igkv AHAT01040262.1 591 TEGQITMTQTLDIVSVSPGQDVNLQCSASQDIGWGLSWYQLQPGHSPKLLIKAGNERFDGVPTRFSGSRSGTVFTFKITGVQAEDGGDYYCLGYKSNQ
Lepisosteus oculatus Vs96 trav AHAT01019587.1 4241 LSVGDSISPQQTKVSKTEGESVTLHCSYSKSSSNYYYLYWYRQYPRQSPEFILYRGESERSDTKADFAKERFSSSTTDKSTALTIQTLTLSDTAVYYCALRQ
Lepisosteus oculatus Vs97 trav AHAT01019587.1 6664 ADSADEVTQTPRAQEVSEGDSVRIQCSYTVTNFYAMQWYKQSKNNGIQYINKATGSSTYGDVSDKYKPAVDTSKKTGSLTIKPTMADSAIYYCAIEP
Lepisosteus oculatus Vs94 trav AHAT01019587.1 596 RHISLGDQISQKDTPVFKTEGERATLECTFSTSSTSYWIYWYRQYPGSAPQFILYSGTTSRTSDFAKERFSSTADKNTGLTVLTISRVLLEDTSIYYCTL
Lepisosteus oculatus Vs95 trav AHAT01019587.1 3122 TAGGQSVDQSSSVTVKEQGNTTIPCSYRDPPMSFNMFWYIQTSGKAPEAIYNELLPKDSIPPRFQNRLSAAHEKKEKTFHLQISSVELSDSSVYFCVLQ
Lepisosteus oculatus Vs293 ighv AHAT01036784.1 2617 VLSDVVLTQSGPQIKKPGESFKIFCKASGYNYGEYTIHWIRQSPAKGFEWLGYITSSYSTGYAAAVKGKIAFTRDNSNSLADLQISNPSPEDSAVYYCARE
Lepisosteus oculatus Vs298 ighv AHAT01036798.1 226 VFCISLTSSEPQIKKPGDSVQVSCKISGYSITSHGTHWVRQAPGKGLEWIGIIWSDGSTDYSQSFKSRFTITRDTSSSTVFLQGKSLSTEDTAVYYCAR
Lepisosteus oculatus Vs292 ighv AHAT01036783.1 2975 VRSDVVLTQSGPEIKKPGESFKISCKASGFTFTDYSMNWIRQTPEKGFEWLGYINNALNTGYADSVKGKITLTRDNSNSITYLQMSNPTSEDTAVYYCARY
Lepisosteus oculatus Vs328 trav AHAT01037382.1 13899 SSGQVTVTQTPAVKSVLPGQTVTVSCKTSPAVQIYDSKHRLAWYQQKAGEAPKLLTYDATPHQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs547 trav AHAT01043326.1 3146 SSGQVTVTQTPAVKSVLSGQTVTVSCKTSPAVYGNVYLAWYQQKAGEAPKPLIYRATNRETGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs546 igkv AHAT01043326.1 5354 LSGQVTVTQTPAVKSFLTGQTVTVSCKTSPAVYTAGSYHYLHWYQQKAGEAPKLLIYAATSRQTGIPERFSGSGSGTDFILTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs545 igkv AHAT01043100.1 1743 SSGQVTVTQTPAVKSVLSGQTVTVSCKTSPAVYVYNSKHYLTWYQQKAGEAPKLLIYLATTRQTGIPERFSGSGSGTDFTLTITGVQAEDAAEYYCQS
Lepisosteus oculatus Vs544 igkv AHAT01043001.1 5347 SSGQIVLTQSPAQSVLPGSSISISCTASQSISNNLQWYLQKPGQAPQLLVYWATNRQSGVPDRFTGSYSGTVFTLKITGVQAEDAGDYYCQQSNSWP
Lepisosteus oculatus Vs333 trav AHAT01037953.1 6876 CNGQISVTQPPVISTAPGQTVTVSCKTSPAVYNNNHLAWYQQKAGEAPKLLIYGATNRQTGIQERFSGSGSGTDFTLTITGVQAEDVADYYCQS
Lepisosteus oculatus Vs542 trav AHAT01042617.1 8364 TSIIPAQTVTVSCKTRSFVGNNCQHSGSNYPCLAWYHQKSGEAPKLLIYEATIRQSGIPVSGSGSGTDFTLTITGVQAEDADYYCQQYQSYA
Lepisosteus oculatus Vs541 igkv AHAT01042575.1 2072 SSGQVTVTQTPSERSVVPGQTVTVSCKTSSPVYSSSVGERMAWYHQKSEGAPRLLIYLVNKLNPGTPSRFSGSGSGTDFTLTITRIEAEDAGDYYCQS
Lepisosteus oculatus Vs540 igkv AHAT01042306.1 1855 SSGQVVLTQSPAQSVLPGSSVSVSCTASQSVSSYLHWYLQKPGQAPQLLVYYATNRQSGVPDRFTGSYSGAVFTLKITGVQAEDAGDYYCQQSNSFP
Lepisosteus oculatus Vs307 ighv AHAT01036808.1 547 VESQVLTESEPAAVQPGGSHRLTCTASGFTFSSSWMSWVRQAPGKGLEWVARINPNSSPAQYYAASVQGRFTISRDDSSSKLYLQMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs529 trav AHAT01041785.1 8296 SSGQVTVTQTPAVKSVLPGQTVTVNCKTSPAVYNNNELAWYQQKAGEAPKLLIYAATTRQTGIPERFSGSGSGTDFTLTISGVQAEDVADYYCQS
Lepisosteus oculatus Vs549 igkv AHAT01043428.1 665 SSGQITVTQGPSVRSVLQGQTVTVSCKTSSPVYSDSNGERMAWYHQKSEGAPRLVIYLVNKLNSRTTSRFSGSGSGTDFTLTITGVQAEDAGDYYCHS
Lepisosteus oculatus Vs528 trav AHAT01041613.1 2576 SSGQVTVTQTPAVKSIAPGQTITVTCKTSRAVYNKNHLPWYQQTAGEAPKLLIYYATTHQTGIPEHFSGSGSGIDLTLTVTGIQVEDAGDYYCQS
Lepisosteus oculatus Vs371 trav AHAT01043501.1 2145 TSVLPAQTVTVSCKTSSSVGNCYYSGSNYPCLAWYQQKAGEAPKLLMYGASIRQSGIPGHFSGSGSGADFTLTITGVQAEDAGDYYCQQYGSTP
Lepisosteus oculatus Vs372 igkv AHAT01043501.1 6545 SSGQIFLTQSPAQSVLPGSSVSISCTASRSISNNLHWYLQKPGQAPQLLIHYATTRQSGVPDRFAGSYSGTVFTLKITGVHVEDAGDYYCQQSNSLP
Lepisosteus oculatus Vs373 trav AHAT01044723.1 441 AVHCDSISPQQTKVSGEEEGSVTLQCSYSTSNAGYRLYWYRQYPHRPLQYILYKGAGTWSGDHTADFAKDRFRSAVSGSSTTLRITKLSLSDSAVYFCALRA
Lepisosteus oculatus Vs374 ighv AHAT01044753.1 770 VQSQITLTESEPAIKKPGESHRLSCKVSGFSFSSYEMSWVRQAPGRGLEWVAYIGTYGTPTRYSQSVEGRFTISEDSSSSTLYLQMNQLKTEDTAVYYCA
Lepisosteus oculatus Vs375 igkv AHAT01045028.1 700 SSGQVTVTQTPSVIFFFSGQTVTVSCKTSTAVYSDSYGERMAWYHQKSEGAPKLLIYLVNKLNSGTPSLFSGSGSGTDFTLTITGVQAEDAGDYYCQS
Lepisosteus oculatus Vs530 trav AHAT01041785.1 1295 LWVFIARQVTVTQTPAVKSVLSGQTVTVSCKSSPAVHGNVYLAWYQQKGGEPPKLLIYAATNRSTGISGFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs316 ighv AHAT01036813.1 1236 VQSQVLTESEHIMVQPEGSHRLICSASGFTFSSYWMGWVRQAPGKGLEWVAYINTDGSSTNYAESVKGRFTISRDNSKNQLYLQMSSLKTEDTAVYYCAR
Lepisosteus oculatus Vs317 ighv AHAT01036817.1 239 ARTQSSITLTQPASADLKKPGESLKLSCQVSGFSIGSSWKGWIRQAPGKGLEWLALYYDESSTKYYASSVQGRFTASMDTSSSTFFLQMNDLRAEDTAVYYCAK
Lepisosteus oculatus Vs267 ighv AHAT01035630.1 5391 VTAQSSITLTQPASAEVKKPGESLKLSCQVSGFSISSYWKGWIRQAPGKGPEWLARYANEGNSKYYASSVQGRFTASMDTSPSTFFLQMNDLRAEDTAVYYCSR
Lepisosteus oculatus Vs315 ighv AHAT01036812.1 16238 VETQCSITLTQPASVEPKKIGQSVKLSCVVSGFSIGDHHKIWVRQAPGKGLEWLASYRTESFTNYYAPSVQGRFTASIDTSSSTFFLQMNDLRAEDTAVYYCTR
Lepisosteus oculatus Vs312 ighv AHAT01036812.1 2427 VTAQSSITLTQPASADLKKPGESLKLSCQVSGFSIGSYWKGWIRQASGKGLEWLALYYDESNTKYYASSVQGRFTASMDTSSSTFFLQMNNLRAEDTAVYYCAR
Lepisosteus oculatus Vs313 ighv AHAT01036812.1 8219 VQSQVLTESEPAVVQPGGSHRLTCTASGFTFSSYAMSWVRQAPGKGLEWVAHIYNSGSSTFYSQSVQGRFTISRDNSKNQLYLQMNSLKTEDTAVYYCAKD
Lepisosteus oculatus Vs310 ighv AHAT01036810.1 4153 VQSQVLTESEPAVVQPGGSHRLTCTASEFTFSSYAMHWARQAPGKGLEWVAYINGGGTTTYYSQSVQGRFTISRDNSKNQLYLQMNSLKTEDTAVYYCAKD
Lepisosteus oculatus Vs278 ighv AHAT01035647.1 4229 LHCVQLTQSASEIGKPGQSLRLSCQVSGYSLTDNSYATHWIRQPPGKGLEWLGHYYTSGNSYAPSVQGRFTISTDSGSTVYLEMTSLKAEDSGVYYCARE
Lepisosteus oculatus Vs150 trav AHAT01019614.1 18021 RDAELQVLQEDSAIVAEGSPAEMHCANNITSTNRPVFWYKQLARQEPKLLVGGLTRTEKYKHFVLTIDEKERSSTLGTKSAEVEDSGVYLCAIS
Lepisosteus oculatus Vs318 ighv AHAT01036819.1 1488 VQSQIVLTESEPAIKKPGESHTLSCTATGFTFSSYAMSWVRQAPGKGLEWVAYIGTSSTPIYYAQSVQGRFTISRQDSSSKLFLQMNNLKTEDTAVYYCTRE
Lepisosteus oculatus Vs319 ighv AHAT01036819.1 10607 VYCEISLAQSPAVVKTPGESVKLSCKISGFTMTSYYMGWVRQAPGKGLEWIGRVNSGSSNSPDYADSLKGQFVLTEDVPSNMQYIEAKSLKPEDTAVYYCARQ
Lepisosteus oculatus Vs139 trav AHAT01019611.1 5074 LSLQDSVAQAPLSVSVEEGRVLSVSCSYNVSAASYSLQWYRQERTGAPEYLLQRYKAGSDFKELRREGLEHRFSSSLDSSARLTVLLLQKLRLSDSAVYYCALR
Lepisosteus oculatus Vs498 igkv AHAT01036346.1 3163 SRGDIVVTQSPTFLSAPLGGTVKINCKSVTAIDDDMAWYHQRPGQEPKLLIYEGPKRFTGVPDRFSASGYDFDFNLTISNIQAEDAGDYYCQQHEARP
Lepisosteus oculatus Vs299 ighv AHAT01036799.1 2025 VQSQVLTESEPAVVQPGGSHRLTCTASGFTFSSYYMGWVRQAPGKGLEWVARITSSGGSTWYSQSVQGRFTISRDNSKNQLYLQMSSLKTEDTAVYYCARE
Lepisosteus oculatus Vs339 igkv AHAT01040255.1 5414 SIGQINVTQSPKAVSALPGQTATINCKTSESVTDSDGDDLIYWFQQKPGEAPKHLIYWANRRQSGIPERFSGSGSGTDFTLTVSGVLAEDAGDYYCLGYKSNQ
Lepisosteus oculatus Vs550 igkv AHAT01043703.1 1132 SSGQVVITQTPPALSVLSGGSVTIHCKASSSITGYYNYLNWYQQKPGEAPKLLIYWATERQSGVPERFTGRGSGLDYSLTISGVQAEDAADYYCGQG
Lepisosteus oculatus Vs552 trav AHAT01043941.1 800 SSGQVTVAQTPSVRSVLSGQTVSVSCKTSPAVYNNNYLAWYQQKAGEAPKLLIYYATTRQTGIPERFSGSGSGTDFTLTITGVQTEDAADYYCQS
Lepisosteus oculatus Vs553 igkv AHAT01043963.1 1168 SSGQVVMTQTPPALSVLSGGSVTIHCKASSSITGYYNYLNWYQQRPGEAPKLLIYWATVRQSGVPERFTGRGSGLDYSLTISGVQAEDAADYYCGQG
Lepisosteus oculatus Vs554 trav AHAT01044277.1 1634 SSGQVTVTQTPAVVSVLPGQTVTVSCKASPAVHNDNQLAWYQQKAGEAPKPLILYATDRQSGIPKRFSGSGSGTDFTLTITAVQAEDGAEYFCQS
Lepisosteus oculatus Vs364 ighv AHAT01042662.1 1746 VQSQIVLTESEPAVMQPGGSHRLTCTASGFTFKDYYMNWVRQAPGKGLEWVAQIQITSIYYAQSVQGRFTISRDNSKNQLYLQMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs132 trav AHAT01019607.1 6131 MVQADKVTQPQNPVLVKENENTTIQCQYETTGSPRLFWYIQKNGQAPQHMLGTYSVPDPRFKRFSAEPGTKGTEKTYDLKISAAALSDSATYFCALS
Lepisosteus oculatus Vs272 ighv AHAT01035634.1 7729 VSGDIQLNQSGPEVKKPGESVKLSCTVSGFSLSSNYMAWIRQAPGKGLEWIGDTGSNYAPSFQGRFTISEDVSSETTYLQSSSLKAEDTAVYYCARI
Lepisosteus oculatus Vs365 ighv AHAT01042663.1 3193 VRSQIQLTESEPAVKKPGESHTLSCKTSGFTFGNYYMSWIRQAPGKGLEWVAHISYWAGTDIKYGSAVQGRFTISRDNPKSTLNLQMNSLKTEDTAVYYCATD
Lepisosteus oculatus Vs518 trav AHAT01037396.1 26016 SSGQISVTQTPRISIAPGQTVTVSCKTSPAVYNNDCLSWYQQKAGEAPKLLIYLATTCQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQG
Lepisosteus oculatus Vs273 ighv AHAT01035634.1 13281 IHCDVILEESEPQVKRPGDSVRLSCRVTGFSLSSYSVHWIRQPVNKALQWVGYYSNALESRFKVTEDSSNSIAYLDITGLKPEDTAVYYCARE
Lepisosteus oculatus Vs519 trav AHAT01037398.1 9849 SRGQVTVTQTPAVKSILPGQTVTVSCKTSPAVNIHDSKHRLTWYLQKAGEIPKLLIYAATTRQTGVPECFSGSGSGTDFTLTITGVQAEDAADYYCTG
Lepisosteus oculatus Vs129 trav AHAT01019604.1 2123 VSSQEQVSQTPFVTQTEGQAVTIHCTFTISNVFYMHWYRQQPNTSPQNVLIIRGDKSTENQFSGSLEKNNSSGVLNISSSQLEDSGTYFCAVE
Lepisosteus oculatus Vs128 trav AHAT01019604.1 184 AVHCDSISPLQTKVSGDEEGSVSLQCSYSTSSAGYRLYWYRQYPHTPLQYILYKGAGTSSAEHTASFAKGHFSCETDRSSTTLTISDLSLSDSAIYFCALRW
Lepisosteus oculatus Vs321 ighv AHAT01036823.1 5021 TLSVSLVPSTFSEVKQPGQSLSITCQTSGYSFSCCNIHWLRQAPGKGLEWLGYDGSTNYADSVKGRLTLNRDNSNSRSSLTLNNLKVEDTAVYYCARQ
Lepisosteus oculatus Vs327 igkv AHAT01036899.1 2312 SKSITRSVVQQPPFVSVQTGDDVTLQCIIHTENCAGEHNVYWFRHGSGESLLGIIYTHGNQSAQCERSSVAGFSTQSCVYNLPKRNFSLSDAGTYYCAV
Lepisosteus oculatus Vs326 ighv AHAT01036827.1 5699 VQSDVVLTQSESAVVTPGGSHRLKCTVTGFNVASYNMFWIRQAPGKGLEWIVYFYSSSDNSYAPAVQGRFTASKDSSSLYLDMTSLRAEDTAVYYCAR
Lepisosteus oculatus Vs148 trav AHAT01019614.1 11132 LAAGDSISSRQTEVFSEEGESVTLSCGYSTDKSAAILYWFRQKPHSGLEYIQYIGARGNRGANHAAYFARVRFGSSADTDSTTLRISDLSLDDTAVYYCALRA
Lepisosteus oculatus Vs324 ighv AHAT01036825.1 13090 VSCDIQLSQSGPEVKKPGESVKLSCTVSGFSLNSYCAAWIRQAPGKGLEWIGDTCSNFASSFQGQFTISKDVPSETAYIQSSSLKVEDTAVYYCARR
Lepisosteus oculatus Vs121 trav AHAT01019594.1 9001 EDKVTQSPGSLKVVEGEAAVLNCSYSTSDSSPYLFWYVQYSNDFPRYVLRRLASGYKENADKFKKRFDATLDKNTILLTIQKTEISDSALYYCALR
Lepisosteus oculatus Vs120 trav AHAT01019594.1 7586 VCFGDSITPTENEVLTEEGQTVSLSCDYKATSTSTPTLYWYKQTSNGRPEYIVHTYSGSKKEGRYEIQVDDKNFKVWLHITEPGTADGAVYYCALR
Lepisosteus oculatus Vs122 trav AHAT01019596.1 1549 AVHCNSISSLQTVVSGEDGGSVTLQCSYSSSSSVYALYWYRQYTPRPPQFILYKVRGAASAEHTADFAKDRMTSVEDGSSTALTVSKLSLSDLAMYFCAVRG
Lepisosteus oculatus Vs125 trav AHAT01019602.1 304 AVHCDSISPRQPKVSGDEEGSVSLQCSFSTSSAGYDLLWYRQYPHTPLQFISLKGGGTWSGDHTADFAKDRFRSAVAGSSTTLRITKLSLSDSAVYFCALRA
Lepisosteus oculatus Vs124 trav AHAT01019599.1 483 AVRCDSISPRQTKVSGEEEGSVSLQCSFSTSSAGYRLYWYRQYPHIPLQYILLKGGGTWTGDHTADFAKDRFSSDVAGSSTTLTISKLSLSDSAVYFCALRA
Lepisosteus oculatus Vs127 trav AHAT01019603.1 2965 MAAGDSITSQEADLSGNEGDLVTLTCSYDSSSNNIYIYWFRQSSDQPLQYILQKGARSYSSIYTADFAKRRFSSTAERYSTTLTITGLTLEDTAIYYCALWE
Lepisosteus oculatus Vs331 igkv AHAT01037582.1 10887 SIGQITVTQTPVQPAQTGERVTITCVTSPALYGNINLNWYQQTAGEAPKLLIYGATNLQTGIPARFSGSGSGTDFILTITGVQVEDAADYYCQS
Lepisosteus oculatus Vs482 trbv AHAT01031872.1 8570 FLAQTVIEQSPRYIAKLPEEKAEMSCTLSGTSSPYLYWYRQHGSGEMEFLFFSRGKGMFDDSPVKDFIPERKEDLFLSLRTDSLRVNHTAVYYCAWS
Lepisosteus oculatus Vs483 trbv AHAT01031872.1 6363 ISAQTVIEQSPRYIAKLPEEKAEMSCTLSGTSNPDLYWYRQHGSGEMEFLFFSRGKGMFDDSPVKDFIPERKEDLFLSLRTDSLRVNHTAVYYCAWS
Lepisosteus oculatus Vs480 trbv AHAT01031872.1 13700 TLARTSVWQEKFTVGHSGEAVHLVCKQNATDEYMYWYRQDPKEGLRLLLFSRYEGMEAENESEDKRLSASRPDRKNFLLTLTDLQLNDSAVYYCASSL
Lepisosteus oculatus Vs481 trbv AHAT01031872.1 10218 ISTETVIEQSPRYIAKLRGEKAKMSCTLSGTSTPFLYWYRQHGSGEMEFLFVSRGKGMFDDSPVKDFIPERKEDLFLSLRTDSLRVNHTAVYYCAWS
Lepisosteus oculatus Vs486 trbv AHAT01031872.1 1409 AVSVTVRQYPTVIFERQGSSFELNCEVTGSSSPSIYWFRQHSSSLLKPLFFSSAPGTVEPPTVDQFSSSRQNWSHFTLESTALAVDDSVVYFCAGS
Lepisosteus oculatus Vs332 igkv AHAT01037938.1 8934 GGQVTVTQIPVKSIAPGQTVTVNCKISPAVNIYNSKHLLAWYQQKARETPKLLIYAATTHQTGIPEHFSGSGSGTDFTLTISGVQAEDAADYYCQS
Lepisosteus oculatus Vs484 trbv AHAT01031872.1 5097 VDAMSAHQFPLSLVHRSGSPMNITCSITDHSNPNMYWYRQGPEHELELLFYSIGTGDVDPIRLDRFRGSRHNSSHFTLESTALAVDDSAVYFCAGS
Lepisosteus oculatus Vs485 trbv AHAT01031872.1 3014 AVSVTVRQYPTIEFGIQGSTLKINCEVTGSASPSIYWFKQQSHSDLNPLFYSVASGNVDPPTQGHFSATRPNGSHFILESTALTVDDSAVYFCAG
Lepisosteus oculatus Vs70 trgv AHAT01017679.1 10389 PVTSFSLEQDKATLTKGSGKTARIACKYKGSGFDSAIIHWYQKKENEAMRRILYIQSVGGTPTYDNVNDKEVFKASKNSNSESELMIVGAQSSHSATYYCACW
Lepisosteus oculatus Vs71 trgv AHAT01017679.1 14004 SVTPSDGTEIVMKRKGKTARIKCKLTNMNSCNDYIHWYQKKESETFKRVLYVSIASGAATLDIPSSGFEAEGMNILKITAAKESHSATYYCACWV
Lepisosteus oculatus Vs72 trgv AHAT01017679.1 15492 PVTTFTLEQDKITVTKGSGKTARINCKYVGSGFESAYIHWYQKKENEAMRRILYIQSIGGTAAYDNDKDKSVFKASKSSNSESELRIENLQNSHSATYYCACW
Lepisosteus oculatus Vs73 trgv AHAT01017679.1 17599 SETAITLKQDQVTLTKGTTKTARISCKVNAENFGREYIHWYQQKEGEALKRILYIAGAGNPTIEEEYKKAGFSADKITAKEESNLFIASVSDSHSATYYCACW
Lepisosteus oculatus Vs74 trgv AHAT01017679.1 22149 SVTPSDGLETVTKKDGKTARIKCKLNDMTSCNSYIHWYQQKENEPFKRVLIVTIASGAATPDIPSSGFESDGKEFLKITAAKDSHSATYYCACWV
Lepisosteus oculatus Vs75 trgv AHAT01017681.1 1912 PVTSFSLEQDKITVTKGSGKTARINCKYKDSGFDSAVIHWYQKKENEAMRRILYIQSIGGTPTYDNDEDKKVFRVSKSSNSESELTIVNAQSSHSATYYCACWD
Lepisosteus oculatus Vs76 trgv AHAT01017682.1 279 TVTALSLEQAKPTLTRKIGRTARFTCKFSGSSDFESAAIHWYQKKENEAMKRILYIQKAGTQPGYDDGSDRELFKANKNTNSESELIINAVQSDHSATYYCACW
Lepisosteus oculatus Vs77 trgv AHAT01017682.1 5839 AEAAVTLKQERLTLTKQKDKTARIGCKVEGTELKSAYIHWYQRKEGAAFKRILYVPGEGQIQVDPEFSGLGFSADKNSNDNTCSLIIERAQADHSASYYCAYWD
Lepisosteus oculatus Vs511 ighv AHAT01036854.1 5949 VTAQSSITLTQPASADLKKPGESVKLSCQVSGFPIGSDYKGWIRQAPGKGLEWLTSYYNEGNKYYASSVQGRFTASMDTSSSTFFLQMNDLRAEDTAVYYCAR
Lepisosteus oculatus Vs525 igkv AHAT01041137.1 1688 YCDSDSISDICNSRTTITVSCKTSTAVYSCYSSNDCLSWYQQKPGEAPKLLIYYATTRQTGIPERFSGSGSGSDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs84 trav AHAT01019578.1 4290 KVDPWKDTEITEETKESRIYCNYSVTNSAGYEYLFWYQQRPGRYPSYVLHCSKTGSGTADFKCEEFESRFTGHLNLTAKFTYLSISNTQLSDSALYYCALR
Lepisosteus oculatus Vs527 igkv AHAT01041141.1 5621 SSRQIVLTQSPAQSVLPGSSVSISCTASSSLISGITSYLNWYLQKPGHSPQLLVCYATTRQSGVPDRFTGSGSGTAFTLTITGVQAEDAGDYYCQQCY
Lepisosteus oculatus Vs526 igkv AHAT01041141.1 8176 CSGQVTVTQSPSVRSVLQGQTLTVSCKTSSPVYSDNNGYHIAWYHQKSEGAPRLLIYLVNKLNSVTQSWFSGSGSGTDFTLTIKGVRTEDAADYYCQS
Lepisosteus oculatus Vs253 trbv AHAT01031870.1 32067 FSKGVTITQKPVITFCNPGAASVTFHCEHDQSTHYFIFWYKQSQGGELFLITYSSGTGTADTEPAFNKSKFTMARPQIKKSSLEIKNLESSDTAVYFCASRE
Lepisosteus oculatus Vs252 trbv AHAT01031870.1 28777 FSHGINVRQRPENALRSPGDPITLHCEYESSSIYNILWYKQEKIKGTELSLMGYSFATGSVEKEQKFNSLRFVINRKETAKSSLKIKSLEHTDTAVYFCASSE
Lepisosteus oculatus Vs251 trbv AHAT01031870.1 24116 FSDGVTVIQEPSIMLRKPDDNSGNLRCEHDDDTHLRISWYSQNSDGQMELIGYSPGEGSADIEPAFDKSKFTIHRPKTRNSSLEIKRLEPTDTAVYFCASSK
Lepisosteus oculatus Vs250 trbv AHAT01031870.1 22730 YSDGVTVKQKPAICLIKNGSDYVKLDCEHDDSTYFSMYWYRQDSRGALPLIAFSSGTGSAETEPAFDKSKFTMTRPQITSSSLEIKNLDPADTAVYFCASSK
Lepisosteus oculatus Vs338 trav AHAT01039965.1 253 ASGQVTVTQTPVQVTAPGQAVTVSCKTSPAMYNDGSDDILAWYQQKPGEAPKLLIYWANRRHSSLSTRFSGSGSRTDFTLTITGVQAEDAGDYYCQS
Lepisosteus oculatus Vs89 trav AHAT01019585.1 7469 MCGGDRVDQLSDALTVLEEGTVIIHCNFSTMSNNPDLFWYQQHPQQPPQYILHMDSYNTYNSPAFSKEHFSSTLSMVNKTVTLKVSAVELRDSAVYYCALR
Lepisosteus oculatus Vs88 trav AHAT01019585.1 6080 GRSQTRVYQSPTSLTVNEGETATLPCNHTVSSTSFRNLQWYRQRMSRRLENMMILISEPAQVHQFSGSVDREKRTGVFNISDSHPEDSAIYYCAVE
Lepisosteus oculatus Vs306 ighv AHAT01036807.1 2235 VESQVLTESEPAVVQPGGSHRLTCTASGFTFSSYWMVWVRQAPGKGLEWVATIRTGSSPSTHYTQSVQGRFTISRDDSSSKLFLQMSSLKTEDSAVYYCA
Lepisosteus oculatus Vs548 trav AHAT01043428.1 6698 VTSVLPAQTVTVSCKTSKSVNTCYYRDTYYPCLAWYHQKAGEAVKLLIFDGSSRHTGIPERFSGSGSGTDFTLTITGVQAEGAGDYYCQQHSTG
Lepisosteus oculatus Vs234 trbv AHAT01031862.1 2216 SVVTSRVQQIPPVLFMNAGEKAELNCSHSITDYYTTLWYQQTGGGRSLKLIGYVSTKSPTLEGNTDKRFSLSGDGGKDTTLKVSSLKAEDSAVYFCAAS
Lepisosteus oculatus Vs236 trbv AHAT01031862.1 6940 LSVSNKVQQIPPALLLNRGETVELNCSHSISNYYTTLWYQQSRGERSLRLIGYVSTTSPTLEDNTDKRFTLSGDGRKDTTLKVASIKAADSAVYFCAAS
Lepisosteus oculatus Vs231 trbv AHAT01031861.1 610 PSNCLNVQQSPPALYRNSGDTDPAELHCMNKMNDINYDRMLWYQQREGKGALELIGYMISRQGYPEDKFKAKFKLSGDAEKNGSLEMSSVTAADNAVYFCAVS
Lepisosteus oculatus Vs230 trbv AHAT01031859.1 410 GYDGVLISQWPRVVVSSVNKAVEMHCYQNDTDYTWMYWYRQLEGEGLKMIASYAAGAATYEEDFKSGYKVSSSEPKKWSLTVESVNPEDSAVYLCAAS
Lepisosteus oculatus Vs233 trbv AHAT01031862.1 1118 LSVSGSVQQIPPGLFKNPGVKAELHCFNKDSSFHYMYWYRQAGNGHLKLIGYLQDSQPNPEEDFKNGFTLSGDATTNSSLQIFSATAADSAVYFCAVS
Lepisosteus oculatus Vs232 trbv AHAT01031861.1 2233 LSVSGSVQQIPPGLFKNPGVKAELHCFNKDSSFHYMYWYRQAGNGHLKLIGYLQDSQPNPEEDFKNGFTLSGDATTNSSLQIFSATAADSAVYFCAVS
Lepisosteus oculatus Vs334 igkv AHAT01037953.1 15545 CNGQISVTQPPVISTAPGQTVTVSCKTSPAVYSNNYLNWYQQKAGEAPKLLIYYATTRHAGIPERFSGSGSGIDFTLTITGVQSEDAADYYCQS
Lepisosteus oculatus Vs133 trav AHAT01019607.1 8166 MTAEDSITPLQTRVSGKEGESVTLSCSYETSSEDVYLYWYRQYSDQPPQYILQKGARSNSRYSNTAGFAKGRFSSTSERTFTTLTISDLAVGDTAVYLCALRP
Lepisosteus oculatus Vs130 trav AHAT01019607.1 1198 MAAGDSITSQETDLSGNEGDSVTLTCSYDSSSNDIYLFWYRQSSDQPLQYILRKGARSYSGTNTAEFAKRRFSSTAERYSTTLTITGLTLEDTAIYYCALWE
Lepisosteus oculatus Vs337 igkv AHAT01039865.1 2889 SSGQVTVTQTPTVKSVLSGQTVTVSCKTSPAVYVSNSKHCLHWYQQKAGEAPKLLIYYATTRQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs239 trbv AHAT01031863.1 338 PSVSITVQQTPMEMLRSPGDKADLHCINPQSSYNYMYWYQKTGDGALKLIGYLNYAQQYPEEEFKENFSLSGDATNTGALHISLITATHRAVYFCAVS
Lepisosteus oculatus Vs238 trbv AHAT01031862.1 11537 PSVSITVQQTPVEMLRSPGDKADLHCINPQSSYNYMYWYQQMGDGALKLIGYLNYAQQYPEEQFKGNFSLSGDATNTGALHISLITATHRAVYFCAVS
Lepisosteus oculatus Vs134 trdv AHAT01019607.1 9614 MTAEDLISSLQTKVSRKEGESVTLRCSYDTSDEYVYLYWYRQYSDQAPQYILRKGARSYSNTHTADFAKDRFSSTADRTFTTLTISDLTVGDTAVYLCALRA
Lepisosteus oculatus Vs135 trdv AHAT01019608.1 5931 MTDEDFASSLQKWASRREGESVTLRCSYDSTTEYVYLYWYRQYPDQAPQYILLRGARSNSGTAHTADFAKRHFSSTAERTFTSLTISSPTVGDTAVYLCALRA
Lepisosteus oculatus Vs323 ighv AHAT01036825.1 9214 TLSVSLVPSTSSEVKQPGQSLSITCQTSGYTFSSYYIHWVRQAPGKGLEWLGYDGSTNYADSVKGRLTLNRDTSNSRSSLTLNNLKTEDTAVYYCARD
Lepisosteus oculatus Vs69 trgv AHAT01017679.1 8558 SVTPSDGTETFTKREGKTARINCKISNVGSCQNYIHWYQKKGEASKRILYVSLSGGDGVSDTNHGGADFQARQNGNERYLQIPKVKDSHSAMYYCACWV
Lepisosteus oculatus Vs68 trgv AHAT01017679.1 6405 SVTASDEPATLTKQAGKTARLKCKITNIGSCQSYIHWYQKKEGEAFKRLLYIIIDSGVVNRDPETSDFLAEKKGSEYNLKVPTLKDSHSGTYYCACWV
Lepisosteus oculatus Vs63 trgv AHAT01017676.1 61050 AAVTLQQEKITLTKTDGQIAQIRCRVSGTSFATATIHWYQRQDGEVMKRILYVADKTAQYDNKRDADVFVVGNIPGEHFTERYLAIRSVKSSYSATYYCACWD
Lepisosteus oculatus Vs62 trgv AHAT01017676.1 53819 CALTQINHPHPLKIAKPRKSARIECELGGSLSLDSTVLHWYRQKDELTIERILYLPAGSQTSENDPDFKERFVAGRKGNKISILTIASAQKEDSAMYYCAYWD
Lepisosteus oculatus Vs61 trgv AHAT01017676.1 46865 ECKGKVIVQSPYLMTKQLRKTAILNCKLEGTNIDRESIHWYRQQGSTIEWILHFASKSERRTADNFGNRFAASKSSQSNFCSLTIINIRETDGGTYFCAYYQ
Lepisosteus oculatus Vs60 trgv AHAT01017676.1 44393 RCSEFSITNTEISVSVSRDQLVSLTCKVEKESFKDEPIHWYRQTQSGGKMEWLLYIASEAKQETNTDEKARFFAKKWNDKNLCTLRINSVTDQDAGFYFCASWD
Lepisosteus oculatus Vs67 trgv AHAT01017679.1 3997 AVSPDEIQTLTKLTGKTARIGCKIADLNSCNTYIHWYQKKENEALKRLLYIQKDNGAVTRDPGASDFQVEKLENVYKLKILSVNDNHSAKYYCACWV
Lepisosteus oculatus Vs66 trgv AHAT01017679.1 11 AVTSLSLDQPRRTLTKGIRKTARITCKYEGPGFDSAIIHWYQKKENEAMKRILYIQKIGTDATHDNANDKDVFKANKKSNFESDLTVIGTQESHTATYYCACWD
Lepisosteus oculatus Vs65 trgv AHAT01017678.1 4328 TAAGVTLDQKVSLAKMPGKTARISCKVSNVGSSNYIHWYQKKDGEALKRLLYITVDKGIVTQDPTASDFKAEKQENEYNLVIPKVNSGFDATYYCACWD
Lepisosteus oculatus Vs64 trgv AHAT01017676.1 64883 AAVTLKQEQISLTLVMNNLAQIKCKVSGTNLAKTTIHWYQKKEREGMKRILYVSEKGAEYDNKNDAKDFMAGIVPAGGFVEGYLAVNSVKPSHSATYYCACWD
Lepisosteus oculatus Vs325 ighv AHAT01036826.1 1094 VRSDIVLTQPSQPEIKKPGETVKLSCRVSGFTLSSSYYMHWIRQAPGRTFEWLLYIRGDNADISYAQSIQGRALASTDRSTTAYLELRSLQTDDTALYYCARQ
Lepisosteus oculatus Vs322 ighv AHAT01036823.1 7851 VQSAVVLTQPDPQLVAPGGKLTLTCTWSGSDLSSSDMSWIRQAPQKGLEWVSYISGPSGSNKQYSSSVQGRFTISRDNAKNTIYLEMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs536 trav AHAT01042225.1 13224 SSGQVTVTQTSVVKSVLSGQTVTVSCKTSPAVYNNNYLHWYQQKAGEAPKLLIYDATSRYTGIPERFSGSGSGTDFTLTITVQPEDTADYYCQS
Lepisosteus oculatus Vs241 trbv AHAT01031870.1 5240 PVTGITFKQTPFLSSRSEQKVDIHCEHDDNSYNYMYWYQQLESKGALELIGYGYSLQEPNYEDKFKARFKLNRETTQKGSLTISNSTLEDSGIYFCAAS
Lepisosteus oculatus Vs243 trbv AHAT01031870.1 9537 PVVGITFEQTPFLSRRSEQKVDIHCQHDDSSYIIMYWYQQLKSKGALELIGSGYSLQDPNYEDKFKARFKLNRETTQKGSLTISNSTPEDSGTYFCAAS
Lepisosteus oculatus Vs244 trbv AHAT01031870.1 10699 FSDAVTITQRPENVIKRNGDPVTLYCEHDDNNHDYMYWYRQGEDRRLLLISYSNAPNMVYSDKAFESGFKMLRPEIKNSSLEIQGLKEEDAAVYFCASS
Lepisosteus oculatus Vs245 trbv AHAT01031870.1 12581 LSAGPLVLQQEDPMYPSVGDTVSLQCSIAAGSSMSSYTMQWYRQKDRHRAVEFIKNEYDASDSGPEEHFQVSIAASENQFTLEIRNLSKEDTATYYCAA
Lepisosteus oculatus Vs246 trbv AHAT01031870.1 15831 LCHAINVDQTPKEILITAKGAINLSCEHDITGTTYIYWYRHVGETGISLIGYSVATGVADMEADFKASRFVMNRKEAQKSTLEIQSLESADNGVYFCASS
Lepisosteus oculatus Vs247 trbv AHAT01031870.1 17827 LTFAYDVIQTPEKVLEHPGKTVKLQCEYDGTTTNYIYWYRQVGEGGLSLIGYSVGVGIINEEAEFKASRFVMNRNETKKSTLKIQPLESADTAVYFCASSM
Lepisosteus oculatus Vs248 trbv AHAT01031870.1 19351 YSDGVTIKQTPAIHFIKNGADYVKLDCEHDDGNHYRMYWYRQDSRGALPLIAFSSGTGSAETEPAFDKSKFTMTRPQITSSSLEIKNLDPADTAVYFCASSK
Lepisosteus oculatus Vs249 trbv AHAT01031870.1 20836 LTFAYDVTQAPEKVLEHPGKTVKLQCEYDATSTNNIYWYRQVGVGGLSLIGYSVGVGIINEEPEFKASRFVMNRNETKKSTLKIQPLESADTTAVYFCASSM
Lepisosteus oculatus Vs123 trav AHAT01019598.1 877 MAAGDSITSQEADLSGNEGDSVTLSCSYDSSSNYIYLFWYRQSSDQPLQYILQKGARSNSGTNTANFAKRRFSSAAERYFTTLTITGLTLGDAAIYYCALWE
Lepisosteus oculatus Vs539 trav AHAT01042306.1 6752 STGQATMTQIPAVISVETGAIVTITCKTSPAVFKNHQLAWYQHKAGEAPKHLIHFATNRDTGVSERFSGSGSGTDFTLTIAGVQAEDVADYYCQS
Lepisosteus oculatus Vs226 trbv AHAT01031857.1 19479 GCDGALISQWPECLLRVPSSATELHCYQNNTEHTYMYWYRWQKDGHLVLISVSIEGNKPTYEEGFQSGYEAKRSGSKKLSLTVESVKPEDSAVYLCAAS
Lepisosteus oculatus Vs227 trbv AHAT01031857.1 21526 PTACVLVQQSPPQLFKRSGERAPLYCINSDSSYILMYWYQQAEARGLKLIGYLQYGQVFPEEEFRGNFTLSGDATKNGSFEIHSLTVAHNAVYFCAVS
Lepisosteus oculatus Vs225 trbv AHAT01031857.1 18080 SSASVTVHQSPRDLLSKPEERAKLQCLNSQESYYYMYWYQQAGDGALKLLGFLHNDQSNPEVEFKGKFTLSGDAKNNGSLEITSLTAAESAVYFCAVS
Lepisosteus oculatus Vs222 trbv AHAT01031857.1 14636 HVDCISVQQSPHKLLKKPGENAKLVCAHGQNTYNYMFWYQQAAEGALKLIGHLIIRNVNPEKEFQGRLFLSGDATKEGYLNISKVTTADSAVYFCSIS
Lepisosteus oculatus Vs220 trbv AHAT01031857.1 12495 LSNSITVLQAPLALLRRPGESIELSCSHDDSNYDTMYWYQQENTGKPVTLIGYLYYKQITIESGFAEKFNITGDAKKKGLFQSSAVTTAESAVYFCAVS
Lepisosteus oculatus Vs221 trbv AHAT01031857.1 13650 SSASVSVAQSPLFLAKHPGESDTLKCNGQNSYLYMYWYQQVGDGALKLIGYLYTTTANPEREFESRFKISGDATKEGFLQIFDITATDSAVYFCAVS
Lepisosteus oculatus Vs340 igkv AHAT01040497.1 1357 SSRQIVLSQSPAQSVLPGSSVMISCTTSSYITSGYSALHWYLQKPGQALQLLVYRATNHYSGVPDRFTGSGSGTDFTLTITGVQAEDAGDYYCQQSYSG
Lepisosteus oculatus Vs343 igkv AHAT01041017.1 2166 SSGQITVTQTPSVTVRCKTSSSVRRCFYSGSYHPCLAWYHQKAGEAPKLLIYAATYCQSGIPECFNGSGSRSDFSLTITGVQAEDAGGDYYCQQGY
Lepisosteus oculatus Vs342 igkv AHAT01040805.1 3258 LTQSPAQSVSPGNSVTITCKASSPVSSISLFVVTYYALSWYLQKLGEAPKLLIYGGDNRQTGIPERFSGSGSGTDFTLTIAGVQAEDAGDYYCQSYHDGDV
Lepisosteus oculatus Vs345 igkv AHAT01041285.1 4765 SSGQIVLTQSPTQSVLPGSSVSISCTASQSISNDLQWYLQKPGQAPQLLVYDATKRYSGVPDRFSGSYSGTVFTLKITGVQAEDAGDYYCQQDYRFP
Lepisosteus oculatus Vs347 trav AHAT01041381.1 265 VKSVLPGQTVTISCKTSRYVDTCEYTFSTYPCLAWYHQKPGEAPKLMINWATYVQSGIPGRFSGSGSGTDFTLTITGVQAEDAGDYYCLQYSSG
Lepisosteus oculatus Vs346 trav AHAT01041379.1 1885 VTSVLPAQTVTVSCKTSSSVDSSSCYYSGSYYPCLAWYHQKTGEAPKLLIYGATIRQSGIPERFSGSGSGTDLTLTITGVQAEDAGDYFCQS
Lepisosteus oculatus Vs309 ighv AHAT01036808.1 5348 VQSQVLTESESAVVKPGGSHRLTCTASGFTFSSYWMQWVRQAPGKGLEWVAAISNGGGSSTYYSQAVQGRFTISRDDSKNQLYLQMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs269 ighv AHAT01035631.1 18016 LHCVQLTQSASEIGKPGQSLLLSCQVSGYPLTDSSYATGWIRQPPGKGLEWLGHYYTYGNSYAPSVQGRFIISTDSGSTVYLQKTSLKAEDSGVYYCARD
Lepisosteus oculatus Vs126 trav AHAT01019603.1 1519 VRSQEQVSQDPFLTQTEGQTPTIHCQYTTASVYTMHWYRQRPNQSPEKVLLISGETGTENQFSGSHYKQNSSGVLKISSSQLEDSGTYFCAVE
Lepisosteus oculatus Vs78 trgv AHAT01017682.1 8329 AEPAVTLEQDTSLTKNQGRTTRIVCRVKGVDLSSAYIHWYQKKEGQAFKRILYISGENPATDEDFRNSGFSAEKSNTAQTSTLIIRPTQTDHSATYYCAYWD
Lepisosteus oculatus Vs320 ighv AHAT01036819.1 17897 VSSDIVLTQSGPQTKKPGKSATLSCTFSGFTLSGSGYYAGWVRQDPGKPLEWLGMIRGDKAYTYYADSVKGRFTVSVDSSSKSYLEMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs503 trav AHAT01036675.1 9524 SSGQVTVTQTPTVRSTAPGQKVTVSCRTSPAVYSNNYLNWYQQKTGEAPKLLIYGATNRQTGIPERFSGSGSGADFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs502 igkv AHAT01036675.1 20328 WNGQISVTQPPVISTAPGQTVTVSCRTSPAVYNNNNLNWYQQKAGEAPKLLIYGATNRQTGIPERFSGGGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs501 igkv AHAT01036668.1 1739 CNGQISVTQPPVIYTAPGQTVTVSCKTSPAVYSNNRLAWYQQKAGEVPKLLIYLATTRQTGIPERFSGSGSGSDFTLTITGVQTEDAADYYCQS
Lepisosteus oculatus Vs500 trav AHAT01036630.1 1072 CNGQITVTQPPVISTAPVQTVTASCRTSPAVHNNNHLSWYQKKTGEAPKLLIYLATTFQTGIPERFSGSGSGTDFTLTITGVQAEDAADYYCLS
Lepisosteus oculatus Vs507 ighv AHAT01036760.1 1438 VQSQVLTESEPAVVQPVGSHRLTCTGSGFTFSSYAMHWVRQAPGKGLEWVAIISYDSSYISYGSPFQGRFTISRDNSKNQLYLQMSNLKTEDTAVYYCAKD
Lepisosteus oculatus Vs506 ighv AHAT01036760.1 4869 VHCDVVLTQPESEVKRPGESFKISCSASGFTFTSYAISWARQPPGKGLEWLGYINSDMTVYYADSVKGRITLSRDNSRTTVEIQMSSLKTEDMAVYYCARG
Lepisosteus oculatus Vs505 ighv AHAT01036754.1 2319 VQSQVLTESEPAVVQPGGSHRLICTGSGYTFADYAMGWVRQAPGKGMEWVAYINYNSGYIYYGSPFQGRFTISRDNSKNQLYLQMSSLKTEDTAVYYCARE
Lepisosteus oculatus Vs504 trav AHAT01036676.1 8602 CNGQISVTQPPVISIAPGQTVTVSCKTSPAVYNNNYLNWYQQKSAEAPKLLIYLATNCQPGIPVRFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs509 ighv AHAT01036854.1 14051 VHSNIVLTESEPAAVQPGGSHRLTCTASGFTFSSAWMDWVRQAPGKGLEWVAYINSNGGTNYAQSVQGRFTISRDNSKNQLYLQMNSLKTEDTAVYYCAWQ
Lepisosteus oculatus Vs508 ighv AHAT01036853.1 5690 ASGDVLLTQSSSEIGKPGQSLRLSCAVSGYSLTDSSYATSWIRQPPGKRLEFLAEIYHDGSANYQDSIKGRFTVSKSGGSVYLQMNSLQSDDTAVYYCARR
Lepisosteus oculatus Vs268 ighv AHAT01035631.1 541 ASCDVVLTQSSSEIGKPGQSLRLSCAVSGYSLTDSSYATGWIRQPSGKGLEWLALIYYDADTSYADSIKGRFTISKPGSSVYLQMNSLQSDDTAVYYCARR
Lepisosteus oculatus Vs303 ighv AHAT01036802.1 10644 VQSQVLTESEPAVVQPGGSHRLTCTASGFTFSSYWMGWVRQAPGKGLEWVAAISNGGGSSTYYSQSVQGRFTISRDNSKSQLYLQMSSLKTEDTAVYYCARD
Lepisosteus oculatus Vs101 trav AHAT01019588.1 7291 LARGQTVNQSESSITVKEEEHVMIPCSYKDASGSFYMFWYFQALNQAPYAIYNELLKEESIPEKFKNRLSADHDKAQRTFHLQISSVELSDSSVYFCALQ
Lepisosteus oculatus Vs290 ighv AHAT01036782.1 6355 ADSSIVLSQTASEVQRPGEALKLSCEVTGFDVNSYWMVWVRQTAPGKALEWLASIGGRSDTEYHADAIKGRFRASKDFSRHIFFLQMNSLKAEDTAVYYCAKE
Lepisosteus oculatus Vs521 igkv AHAT01039885.1 2820 SCSQIVMTQSPTVRSNLQGERVTLSCKSSQQVYHLSWYHQRTGEAPRLLIHTKDTRASGIPDRFTGSYSGGSSSGYGTDFTLTITGVQAEDAGDYYCLQYDSLP
Lepisosteus oculatus Vs368 trav AHAT01043013.1 998 SSGQVTVTQTPAVKSAAPGQTVTVSCKTSPAVYGNNWLNWYQQKAGEAPKLLIYGAATRQSGIPEHFSGSGSGTDFTLTITGVQVEDAADYYCMG
Lepisosteus oculatus Vs308 ighv AHAT01036808.1 2847 AQSQIVLTESEPAVKKPGESHTLSCTASGFTFKDWCMGWVRQGSGKGPEWLALICTGSNPSKYYAQSVQGRFTISRDDSSSKLFLQMSSLKIEDTAVYYCARD
Lepisosteus oculatus Vs131 trav AHAT01019607.1 4144 AVHCDSISPRQTKVSGEEEGSVSLQCSFSTSRAGYRLYWYRQYPHIPLQYILYKEGGVGSGEHTADFAKGRFSSAVAGSSTTLTISKLSLSDSAVYFCALGA
Lepisosteus oculatus Vs329 igkv AHAT01037394.1 1476 CNGQISVTQPPVIFTAPGQTVTVSCRTSPAVYNNNLLAWYQQKAGEAPKLLIYGATTRQPGIPERFSGSGSGTDFTLTITGVQAEDAADYYCQS
Lepisosteus oculatus Vs235 trbv AHAT01031862.1 3916 PSFSITVQQTPMEMLRSPGDEADLHCINPQSSYNYMYWYQQTGDGALKLIGYLSHTQENLEEEFKGNLALSGDAKNNGSLHISSITGAHSAVYFCAVS
Lepisosteus oculatus Vs237 trbv AHAT01031862.1 9330 PSDSTKVHQNPPVLLMHPDETAELNCSHSITGYYVTLWYQQTGGERSLKLIGYVSTTSPSLEDNADKRFSLSGDGSKNTTLKVSSLKVTDSAVYFCAAS
Lepisosteus oculatus Vs242 trbv AHAT01031870.1 7827 VSDAVIVTQRPENGIKTNGDPVTMYCEHDDNNHDNIYWYRRGKDGGFLLIAYSYGTNMVANEKAFEKGFKMLRPEIKNSSLEIQSLKEEDAAVYFCASS
Lepisosteus oculatus Vs538 igkv AHAT01042258.1 635 SSGQIVLTQSPAQSVLPGSSVSISCTASQSISNNLHWYLQKPGQAPQLLVYAATNRQSGVPDRFTGSGSGSQYKLTITGVQAEDAGEYYCQQGY
Lepisosteus oculatus Vs223 trbv AHAT01031857.1 15482 LSDSSTSVWQSPPTLFKNPGQSADLNCSHRSDSYNTMLWYQQAGGGGQLKLIGYLYHESPSLEGSTDKRFRLSGHAKKSGSLHISELTTADSAVYFCAAS