WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Alligator mississippiensis AKHW00000000.1 (AKHW01) 259 74 40 19 77 26 13 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Alligator mississippiensis Vs384 trdv AKHW01054317.1 7719 VRSAVLLRQHPPDLAVREGEEVTFQCSVDGGSMGSYYMFWYRKGEQGPLTWIYQEEKGRYGDGFQGRFEGEVDISENRFTLRLLQAARADRAVYYCAAE
Alligator mississippiensis Vs1291 trbv AKHW01072020.1 27073 LCTGVTVTQKKFIAIKNGTTASLPCEHDDTSYYVILWYRQQEGAGGEMEFVAQHAEGNEVEIGPKFKERFTLNRKNTLKASLDIKETAEDSAVYFCAASK
Alligator mississippiensis Vs1546 trdv AKHW01101500.1 13069 KDLLCDHVTQSPSVLLATAGSQAKLFCSYTTSFGNPDLYWYRQLSDNSLQYILYRDNSQSHNADFAKERFTVEHRTSERTFHLVVSAVRVEDSALYLCALS
Alligator mississippiensis Vs594 ighv AKHW01085717.1 37190 XHPQIQFFQSGAEIKKPGESMKLTCKASGYTFTNHRIVWVRQAPGKRLEWIASIRTDNFNTFYPEGLKGRITVSVDTSISTSYLQLNTLKTEDTAVYYCA
Alligator mississippiensis Vs595 ighv AKHW01085718.1 290 ATSAVKLVEFGAGVAKPGETLVLSCAVYDVSISDGNYIWNWIRQPPGKGLEWVAGIYPYDGRTWFNPSLQSRTTISADKSKNQFSLQLRSLAAADTATYFCARR
Alligator mississippiensis Vs596 ighv AKHW01085718.1 5570 ALSQVTLTQSGAAVKKPGESHRLQCVTSGFALSSTNMYWIRQAPGKALEWLIYFYSSSDNIYDSSIKGRFTASKDSSTFYLQMNNLKAEDTAVYYCAR
Alligator mississippiensis Vs590 ighv AKHW01085717.1 14845 GSSQIQLTQSGAEVKKPGESAKLSCKTSGYMFTSNNMYWIRQPPGKGLQRVGEINPSSDGTWYGQGFQGRFTISKDTSTSTVFLQLSSLRTDDTATYYCAR
Alligator mississippiensis Vs591 ighv AKHW01085717.1 18722 VQAEVQLVESGGAVKKPGESLRLSCKWSGADFSSSDMNWVRQAPGKGLEWVAYISGPSGSSKYYSDAVKGRFTISRDNPSSLVHLQMTSLKAEDTALYYCAM
Alligator mississippiensis Vs592 ighv AKHW01085717.1 23888 VCSQVQLLQPGAAQEKPSGTLRLTCTVSGFSLTASGYGVGWIRQPPGKALEWLCTVYWNDDKYYQDSLKSRLTISRDTSKSEVYLELRGLEAGDSSTYYCAG
Alligator mississippiensis Vs593 ighv AKHW01085717.1 30169 PGVVKPGETLTLTCTVTGDSDKIISSDCCYWTWIRQSPGKALEWLGRITKSGSTNYAPSLQSRISLTVGSSKNQYSLQLRSMTAADTAMYFCAR
Alligator mississippiensis Vs1317 ighv AKHW01074868.1 3475 VQSAVELVQSGVGVNKPGGTVKISCKTSGFTLNQYFMTWVQQAPGKGLVWVGRIYAANGNANYAVTMQGKASITTDNSISTVYLQLSHLSPADTAMYYCVR
Alligator mississippiensis Vs916 trbv AKHW01018093.1 6754 FCSVYVEQPPFLTGVPGATTPLQCTLIKTSHYHMFWYRQRAGRELEALFYSAGVGETSFTKEPMEAKKNGSDWTLTWKSLSHSDSAVYYCACSD
Alligator mississippiensis Vs1313 ighv AKHW01074396.1 688 VFSAVQLVESGPGVVKPAETLTLTCAVSGVSISDSSYAWNWIRQPPGKGLEWIARIYPHDGRTWFNPSLQSRTSISADKPKNQFSLQLRSLTTTDTAMYYCATD
Alligator mississippiensis Vs1413 trav AKHW01087663.1 62725 ALRGDSVHPEKPLVTAAEGDTVTLRCNYKTSSSADYYLYWYRQHPDQTLQYILLRGTKTVSGVQDTAPFAEQRFSSQGGDSDTSLNITALELADTAVYHCALR
Alligator mississippiensis Vs991 iglv AKHW01030093.1 2027 SLAEYVLTQPPAVSVSLGQTAQLTCRGEKFDKNYVYWYQQKPGSVPKLVMYKDKERPSDVPDRFSGASSGDTATLTITGVQAQDEANYYCQVWDSDSS
Alligator mississippiensis Vs1227 trav AKHW01063855.1 3627 AALGDSIWAMEAQVSGEEGGTVTLHCSYESNVDYISLMWYRQFLSRGLQYILARGAKVIRDAQDFTEFSRGRFSSQTSDNSTELTLPALQLADSEVYYCA
Alligator mississippiensis Vs5 igkv AKHW01000448.1 8641 AQRQIVVMQSPGSVAVSVGETVTIQCRSSRSIGTEMSWYQQKPGQAPKLLINSGSRYTGIPDRFSPSGSGTDFTPTISGLEAEDAGNYYCQQD
Alligator mississippiensis Vs1169 iglv AKHW01056457.1 4472 SLAQYVLTQPPSVSLSPGQTAQLTCSGDNVASKNVYWYQHKVSSSPLLVMYNSRSRPSGVPDRFSGASSGNTAVLTIIGVQAQDEAVYYCEVWVTASS
Alligator mississippiensis Vs7 ighv AKHW01000766.1 10633 VLSQVTLKESGPKPGERLSLTCTVSEFSLTSYDTRWVRQAAGKGLEWVGAMWRGGGGGPDYNSDLQSLLSISRDPSSNQVDLSMTGLQPADIAWYYCARD
Alligator mississippiensis Vs187 ighv AKHW01027651.1 2611 VLSAVQLVXSGPGVVKPAETLTLTCTVTGYSISSDCGWHWIRQPPGKGLEWMGYISYSGSTSYNPSLQSRITISRDTSKNQFSLKLGSLTATDTAMYYCAR
Alligator mississippiensis Vs1419 trav AKHW01087663.1 35551 AVLGDSIQSQELEVSRREGDSVTLSCSYSTSHDFVALYWYRQYPNRSPQFILFRGARSWSSLDDTAGFAQKRFSSQASHNTTVLNITTLERPDTAVYYCGLWS
Alligator mississippiensis Vs1418 trav AKHW01087663.1 42069 AVRGDSIEPEETQVSAVEGDAVTLRCNYTTSNTFAYYLYWYRHYPDRALQFILYQGTRTAKSVSSTADFARERFSSQTEDSSTALNILALKRADTAVYYCALQE
Alligator mississippiensis Vs1398 iglv AKHW01084987.1 1211 SLAQYVVTQPPSVSASPGQTAQLTCSGTKIGSYNVHWYQKKPGSAPLLIIYNDSKRPSGIPDRFSGANSGNTATLTITGVQAQDEAEYYCQVGSSSIAP
Alligator mississippiensis Vs107 ighv AKHW01016938.1 462 VQSKVEFLESGGDLKKPGDSLRLSCKTSGFTFSNHWMSWYRWSPTKGLEWVSSIEKLPGSTKKYANSVQGRFTISRDDSKNMLYLEMKNLRLEDTAVYYCRA
Alligator mississippiensis Vs364 trgv AKHW01053167.1 26849 LLWAIHLEQTPSVIVQQSHSSNTAAFTCKITDGLSSTYVHWYRVLPGQAPQRLVHLTLDGSNIKRESGISWDKLSASANPKVCTLEIYKLEKKDSGYYYCAAWD
Alligator mississippiensis Vs920 trbv AKHW01018094.1 6951 SGLGVLITQVPKSATQRLGGAVKLTCYQNDTTYTYMYWYKQHQGEGLSLMAWGADKSKVSYEEGYKKQTLITERTSSKAFTMNFTELEAQDSASYFCAASD
Alligator mississippiensis Vs108 ighv AKHW01016940.1 2781 VQSKVEYVASGGTVKMLGDSLGISCTTSGIDFDNSWLGWVRHVPGRGLQQVAYISKLAGDTVYYSDAVKGRFTISRDNSRKLLHLQMSNLRPEDAAEYYCSWV
Alligator mississippiensis Vs1283 trbv AKHW01072019.1 72194 LLDARITQTQSLVLRKGGTAQLQCEQTYGHDGMFWYRQDLDQGPQLLFYFYYGKETEKGNIPDRFTAKMAGAKVLRLNISAVESQDSAVYFCASSE
Alligator mississippiensis Vs34 trbv AKHW01007547.1 3873 VSSAYVEQPPFVVEVPGRSPSVQCKLIQTSCIFLYWSRQRAGGQLEALFYSLGGAPQNNTAEPMNAERSGNIWTLNWKQLSQSDSAMYYCACSE
Alligator mississippiensis Vs35 trbv AKHW01007548.1 186 AGAGDLISQWPKSTVQSPGETVAVSCYQNHTTHIYMFWYLQPQGHGLMLIASAHTNREASYEKGYNKTKFPITRDETKLSVMTVTNITAGDAATYFCA
Alligator mississippiensis Vs37 trbv AKHW01007548.1 14377 AGAGDLISQWPKSTVQSPGETVAVSCYQNHTTHIYMFWYLQPQGHGLMLIASAHTNREASYEKGYNKTKFPITRDETKLSVMTVTNITAGDAATYFCA
Alligator mississippiensis Vs32 trbv AKHW01007546.1 34315 VGSAPVEQTAFLMGVPQSNLTLQCTLKQADCKWMYWYRQQGSKALEALFYSYEKSLVNFTAEPMQAERKMGYFTLKWINLSPSDSAVYYCACSS
Alligator mississippiensis Vs33 trbv AKHW01007546.1 36868 VGSDYVEQPPFLMGVSGASPILHCELKEAIYLYMYWYRQQAGRELQVLIYSAGDGSGYNFTAEPMTANRRGNNWTLTWKSLSHLDSAVYYCACSD
Alligator mississippiensis Vs1455 trav AKHW01089914.1 8341 SCCGAQVSQSPEALVTREGDRSAMVCTYSSAYFPFQWYRQVPSGEITHLLSVPANRNVTEGRFTGESQDGGKKSSLNLAETRVADSGRYFCAVA
Alligator mississippiensis Vs1362 trav AKHW01080127.1 15034 SSCGAQVSQSPEVLVTREGDRSAMVCTYSTTYRTFQWYRQAPSGEITHLLTVAADQNVTAGRITGERLESGTRSALRLVPHGLADSGRYLCAVG
Alligator mississippiensis Vs1290 trbv AKHW01072020.1 33159 RLDARISQTQSLVLKKEGLALLKCEQTYGHNTMFWYRQDLGQGPQLLFCFYHETETERGNISHQLTAARSGEKVLHLNISAVQPQDSAVYFCASSK
Alligator mississippiensis Vs1268 ighv AKHW01070779.1 5149 AVSAIQLVLSGPGMVKPGETLALTCAVSGESIATSTTWWTWVWQAPGKELEWMGEISYSVGTSYNLPLKSRVTISRDTSKNQFSLQAQLLMAADTATYYCAR
Alligator mississippiensis Vs1269 ighv AKHW01070779.1 2109 VCSQVQLLQATXAQEKPXGTLRLTCAVSGFSLTASGSVVSWIRQPPGKGLEWLCLIFWNDYKYYQDSMKSRLTISQDTSKSEVYLELRGLEARDSGTYYCAK
Alligator mississippiensis Vs1385 ighv AKHW01083109.1 1861 AWCEIQLVESGGDXRKPGASLHLSCKGSGYTFSSYQMVWVRQAPGKGLEWIAFIDVTTIYYADSVKGRFTISRDNPSSLLHLQMTNLKPEDTALYYCAR
Alligator mississippiensis Vs919 trbv AKHW01018094.1 11547 VASDKVEQPPFLMGVPEEFPPLQCTLKDQAFFNMYWYRQRGSKEMEALFYSATNDRETNFTAEPMTAKRRGNTWTLTLNSPSREDSAMYYCACSK
Alligator mississippiensis Vs1557 trav AKHW01103153.1 915 AVTGDSIQPEEAQVSAGERNAVTLRCFYTTTYSDGYYLYWYRQHRDRALQYILYRGTKERSRVSDTAEFAQQRFSSRADDNSTVLNITALERADTAVYHCALQR
Alligator mississippiensis Vs616 iglv AKHW01089251.1 19 CLAQTAPTQPPSVSVSPGQTATLTCTGSSIGSYGVSWYQQKPGSAPLLVMDSYNERPSGISDRFSGSSSGNTATLTITGVQAEDEADYYCSAYDSGSSS
Alligator mississippiensis Vs967 igkv AKHW01025760.1 9676 SSGDIVMTQTPRSLALSPGDTATIKCKSSSSLTYSGREELAWYQQKPGQAPKLLIYNAVTRQSGVPARFSSSGSGTDFTLTISSVEAEDAGEYYCQQYY
Alligator mississippiensis Vs1111 igkv AKHW01047280.1 3057 SSGDILITQTPESLAVSPGDTVTIKCKASSSVSSWMHLYQQKPGQAPKLLVYRTNNRPSGIPDRFSGSGSGTDFTFSISRVENGDAGDYYCGQSSYNP
Alligator mississippiensis Vs1464 ighv AKHW01090683.1 450 ILSQITLKESGPGVVKPGETLSLTCTVSGVSLTSSYITWVRQAAGKGLERVGVIESGGSTYYNSALQSRLTITRDTSSSQVHLRLTGVQPEDTARYYCAR
Alligator mississippiensis Vs1462 trav AKHW01089916.1 2551 AVRGDSIEPEGTQVTAAEGDNVTLRCNYKTSNTYAYYLYWYRHYPDRALQFIVYRGIRTARSTSNTADFAQKRFSSQTDDNSTALEIMALELADTAVYYCALRD
Alligator mississippiensis Vs692 trav AKHW01099424.1 4628 VASQEGLWLQQSPAEIWMIPGQTAELNCTILHKRSFLHWYKEHQDGSLQWVAQSGKYVVPKQRYSSKVSSTGKTHSLVINKLQEEDSGVYYCALDVS
Alligator mississippiensis Vs1460 trav AKHW01089916.1 8692 AVRGDSIRPEEAQVSAAEGATVSLRCFYTSTYSAGYYLYWYRQHRDGAPQYILYRGTKDLSTYSDTAGFATVRFSSKADANSTVLNITALERADTAVYHCALRY
Alligator mississippiensis Vs1461 trav AKHW01089916.1 6544 AVRGDTVHPEKAQVTAAEGDAVTLRCNYETSSSVGYYVYWYRQHPNGTLQYILRRGAKENSGVRNNAPFAEERFSSQAGASDTTLNITALERADTAVYHCALQ
Alligator mississippiensis Vs1556 trav AKHW01103153.1 3465 QANANSVSQSAGTVTVREGDSVFINCTYSLTGTPYLFWYVQFPNEAPRLLLTQYEAQDEEDEKRRRGFSADLQKDSSSFHLRKTSSQASDSAVYYCALR
Alligator mississippiensis Vs368 trgv AKHW01053167.1 45195 GSAQVLKQTQVSITKVESKTIRIECHVTVSNFGNAYIHWYRQRPGAPPEQILYFSSQLHLDSDSDKEKINAEKKIDKSLCILTIRRIASSDAATYYCATWT
Alligator mississippiensis Vs295 ighv AKHW01044344.1 978 AVSAVTLVESGPGVVKPGETLTLTCAVSGVSITDSSYSWHWIRQPPGRELKWVAQIYPYDGRTWFNPALQSRTTISADKSKSQFSLQLRSLAAADTATYFCAR
Alligator mississippiensis Vs1358 trav AKHW01080126.1 9769 FCCGAQVSQSPEALVTREGDHSTMACAYSSAFQTFQWYRQVPSGVITHLLSVPTNRNITEGLFTGESREDGKKGSLHLSQTQMGDSGRYFCAVQD
Alligator mississippiensis Vs966 igkv AKHW01025759.1 1602 SSGQIVQTQTPESLVVSPGDRVTIKCKASSSLTYSGNEYLAWYQQRPGQAPKLLIYGASTRQLGVPARFSGSGSGTDFTLTISSDEAEDAGGYYCHQ
Alligator mississippiensis Vs173 igkv AKHW01026133.1 4574 SSGQIVLTQTPESLAVXPGDQVTIKCKASSSLADSSSWSSYQQLAWYQQKPGQAPKLLIYGASTRQSGVPAWFSGSVSGTDFTLTISGVAAEDAGDYYCQQYFR
Alligator mississippiensis Vs1555 trav AKHW01103153.1 11082 AAGTAQILQPPSAEAPEGASLNLTCTHSSIEMSENIFWYRQFPGRGLQFIVSGYKGTVPSTAPEGALHISADRRASVLALRRAGRGDAAVYYCARS
Alligator mississippiensis Vs1458 trav AKHW01089914.1 458 AARSDSVHPENPQVTAPEGDTVTLRCNYKTSSSGSYYLYWYRQHTNRALQYILHRGTKDYSAVXGNAPFAKERFSSQASDSATMLNISALELXDTAVYHCALQ
Alligator mississippiensis Vs365 trgv AKHW01053167.1 30735 LLWAIGLEQEPSFIVKQSKLGSTARITCHVTGGSSSTLIHWYQALPGQALQRILYLSLSGDNLEQDIGSKDKFSAYGKQQACNFIVRNLKKTDSGDYYCAIWDL
Alligator mississippiensis Vs1270 ighv AKHW01070781.1 1478 VLAQVTLKESGPGVVKPGETLSLTCTVSGFSLTSCAVSWVRQAAGKGLEWVGDRWSGGNTNYNSTLQSCLTISRDTSSSQAHLRLTGVQPVDTSRYYCVR
Alligator mississippiensis Vs1576 ighv AKHW01105418.1 2176 VPSAVQLVESGPGVVKPAETLTLTCTVTDYSISGSIYWSWIRQPPGKGLEWMGYIVGSSGGTSYNPSFQSCITISKDNSKNQFSLQLRSPAAADTATYYCTV
Alligator mississippiensis Vs1577 ighv AKHW01105419.1 5202 ARSQVVLTQSGPEVKRTGESTTLRCAVSGFDVNGWWMAWIRQRPGKGLDWLASYRSSSQSNHYSPVIQGRIRVSKDSSNFYLELKSLKPEDMAMYYCARD
Alligator mississippiensis Vs1573 igkv AKHW01105028.1 315 SSGQIVLTQTPESLAVSPGDRVTIKCKASSSLTHNIYQVLAWYQQKPGQATKLLIYDGSTRQSGVPARFSGSGSGTDFTLTISSVEAEDAGDYYCQQYKS
Alligator mississippiensis Vs985 iglv AKHW01028519.1 1507 SLAQYVVTQPPSVSVSPGQTARLTCSGNNIGGKNVQWYQQKPGTAPLLIIYNDSKRPSGIPDRFSGANSGNTATLTVTGVQAQDEAEYYCQAWDSSSDL
Alligator mississippiensis Vs972 ighv AKHW01026575.1 5697 VQSAVELVQSGAVVKKPGGTVKISCKTSRFTFTDYYMYWVQQAPGKGLVWVGEIIPEDDTTNYAETLKGRVSITTDNSISTVYLQLSRLSPADTAXYYCA
Alligator mississippiensis Vs1428 trav AKHW01087663.1 10175 AAVTAEILQPGSAEALEGAPLNLTCSHGSVSTQYILWYRQVPNGGFQFLGSGFKGSVPVSALEGALHISADRRASALALRRAGLGDAAVYYCALS
Alligator mississippiensis Vs607 ighv AKHW01087166.1 147 VQSQLQESGPGVAKPGETLSLTCTVTGGSVTGSYWWSWIRQTPGKGLECMGAWAGSTNYNPAFQNRITISVDSSSTKYYLRLSSLTATDTATYYCA
Alligator mississippiensis Vs92 trdv AKHW01015819.1 4249 AARWALAQVFQPPRLTTVEGGKLLIQCNQNVTSADQMSWYHQSLQGRGGLIFLGSGFDGTSSVGEFTLTVDKTSRFTSLTRNXTRLRDAGIYYCAV
Alligator mississippiensis Vs769 trav AKHW01111693.1 2352 LLRPPEMSEISQPQSVTAGKKVTLSCRVAGHFPGELGVTWLRKGRGEARAAPLQDSAEYQLVPGQPVPAADGKSFQQEAKLLFTPSVRRDQGAEYICRV
Alligator mississippiensis Vs1429 trdv AKHW01087663.1 5761 AARGDSVQSQEPHVSAAEGHAVTLRCSYTTSYVPSVYLYWYRRYPDRPLQFILYKGSKEAGSVSNTADFVQGRFSSQVINKTTLLTISALELADTAVYYCAIQR
Alligator mississippiensis Vs685 trav AKHW01097747.1 26956 LGVQLHLHQPQRFLFVEVGRTAEIHCSFGEDVEAGVNVHWYLRRAGEVPKRMKDCGDGTNGSKFACKHQKYSTTLEIRDIQRNESGIYYCAHA
Alligator mississippiensis Vs93 trav AKHW01015822.1 4753 RAQQDSVTQSPSALVIPAGHTATLSCSFSTSDIYPFIFWYRQHPNXPLXMLMQLNEAEWKNQTGRLSAELHVGNSSGRLEIQGTTLQDSAGYLCALS
Alligator mississippiensis Vs688 igkv AKHW01098295.1 350 SRGDXIVTQTPESLAVSPGDTVTIKCKTSSSVSGWMHLYQQKPGQAPKLLLYYTSNRPSGVPDWFSGSGSGTDYTFTISRVEAGDAGDYYCQQYQSLP
Alligator mississippiensis Vs1426 trav AKHW01087663.1 13945 SCCGAQVSQSPEALETSEGDRAAMACTYSSAYQAFQWYRQVPSGEITHLLTVASNENSTNGRFTGERLESGQKSFLHVAETRLEDSGRYFCAVG
Alligator mississippiensis Vs917 trbv AKHW01018093.1 4317 SGSDYVEQPPFLTGISRKPRTVQCTLKQSDYGWMYWYRQRGSKELEAIFYSTGNGDGNPFTAELMTAKRSGNIWTLTWSNVSLADTAIYYCTCSS
Alligator mississippiensis Vs1479 ighv AKHW01092469.1 1583 AWSQVQLVESGGDVKKAGDSLHLSCKASGFTFSSTYMNWVRQTPEKGLDWLAEIRPDASKVWYSPAVQGQFTISRDNSQNLLYLQMSSLKPKDTALYYCAQD
Alligator mississippiensis Vs369 trgv AKHW01053167.1 50474 GDAQELTQSQLSVTKDESKTAPIQCRVSGISLDSAYIHWYRQKPGKAPERILYLSSGTPTFDRDSDKGKFEAEKIPTASICTLTVRRISKDDAATYYCAYWD
Alligator mississippiensis Vs764 iglv AKHW01110763.1 544 FGAQFVLNQPSSVSASPXGTVTVSCTRSSGSISSSYVXWFQQKPGSAPGMVIYGDTQRPSGIPSRFSGSIDSSANTATLTITGVQTDDEADYYCLSCDSSSN
Alligator mississippiensis Vs305 trav AKHW01045760.1 4456 LGVQLHLYQPQRFLVVEVGGTAEIHCSSGESVEWGGKVHRYLRRTGEAPMHIKKCADKRNESRFACKNQGSSTTLEIRDIQRKESGIYYCAHA
Alligator mississippiensis Vs304 trav AKHW01045759.1 11704 LGVQLHLHQPQRFLVVEVGGTAEIHCSSREDLDGAAKLHWYLRRVGEAPILIKKCKEQNESRFACKYQKSNTALEIKSVRRKDSGIYYCAHA
Alligator mississippiensis Vs1454 trav AKHW01089912.1 8448 AVLGELVQSEEQAVSRGEGDAVTLRCSYNTRDSNVRLYWYRQYPNRSSQYILFRGARSLSGQGNTAGFAXDRFSPRLDYNTFVLNISALQRADTAVYFCALR
Alligator mississippiensis Vs373 trgv AKHW01053167.1 90501 RDAQVLKQSQPSIVRGVHKTALIECHVSGISFSNAYIHWYRQKPREAPEQILYLSSGRPSFDKESDKGKFEAKKNIDDNTCTLTLNQIRTEDAATYYCAYWH
Alligator mississippiensis Vs1412 trav AKHW01087663.1 68641 QANANSVSQSAGTVTVLEGDSVSINCTYSYSSFGTPYLFWYVQFPNEAPRLLLTQYEAQDEEDEKRRRGFSADLQKDSSSFHLRKTSSQASDSAVYYCALR
Alligator mississippiensis Vs781 ighv AKHW01113527.1 517 VLSAIQLLQSGPAVAKPGQTLTLTCAVSGESITSQTKGWTWLQQPPGRSLEWMGYLHHSGTTYYSSALQSRITISQDTSKNQFSLQLRSLTAADTATYYCATG
Alligator mississippiensis Vs780 ighv AKHW01113332.1 1366 VLSAVQLVQSGPGVVKPGETLTXTCAVSGFSITTQYYSWNWIRQPPGKGLEWVGYVYPYDGNTGYATALTSRTTISADNSKNQVSLQLRSLTAADTATYYCAR
Alligator mississippiensis Vs91 trav AKHW01015819.1 1248 SGGLESVTQVRLEVTVSEGENASLACNYTTTYAPSLLWYRRGPSHQLDYLLQVDSRGVRYGQDGSLSHLGAQLDXEQQTALLQIHATQLSDSAVYFCAL
Alligator mississippiensis Vs96 iglv AKHW01015874.1 7493 AGAQSLLTQPPSVSASPGGTVTITCARSSGSISDSWNSWYQQKPGRAPVMVIYKDTERPSGIPSRFSGSIDESANTATLTISGVQPDDEADYYCSAG
Alligator mississippiensis Vs94 iglv AKHW01015874.1 191 CLAQTAPTQPPLVSIFPGQTATLTCTGNSISSNGPDWYQQKPGSVPLLVVDRSNNRASGISDRFSGSKSSNTATLTITGVQAQDEADYYCGAYTGSYS
Alligator mississippiensis Vs95 iglv AKHW01015874.1 1053 CLAQTAPTQPPLVSIFPGQTATLTCTGNSISSNGPDWYQQKPGSVPLLVVDRSNNRASGISDRFSGSKSSNTATLTITGVQAQDEADYYCGAYTGSYS
Alligator mississippiensis Vs1134 igkv AKHW01050075.1 7424 SSGDIVMNQTPESLAVSPGDTVTITCKAVTYSGSNVAWFQQKSGQPPKLLIYSTNSRPSGIPDRFSGTRSGSDYTLTISQVEVGDAGDYYCQQYSSFP
Alligator mississippiensis Vs1135 igkv AKHW01050075.1 3089 SSGDAVVTQTPASLLVSPGDTVTINCNTGSYSTSSIAWYQQKPGQAPKLLIYSKTSRPSGIPDRFSGSGSSTAFTFTISRVEAGDAGDYYCQYHGATP
Alligator mississippiensis Vs1136 igkv AKHW01050076.1 9723 SSGDIVMNQTPESLAVSPGDTVTITCKAVTYSGSSVAWYQQKSGQSPKLLIYSTNSRPSGIPDRFSGTRSGSDYTLTISRVEVGDAGDYYCQQYSSFP
Alligator mississippiensis Vs1137 igkv AKHW01050076.1 3576 SSGDVVLTQTPESLMVAPGETATINCNAGSYTSGSIDWFLQKSGQPPKLLIYSTSSCASGISDRFSGARSGSDYTLIISRVEAGDAGNYYCQYNGAT
Alligator mississippiensis Vs918 trbv AKHW01018094.1 14745 SGSDYVEQPPFLTGISGKPRTVQCTLKQSDYGWMYWYRQXGSXELEAXFYSXGNGXGXPXTXELMTAKRSENIWTLTWSNVSLSDTAVYFCTCSS
Alligator mississippiensis Vs1133 igkv AKHW01050071.1 3218 SSGQAVLTQTPASLSMFPGDRVTINCRASSSIKSTSEVSYLNWYQQKPGQAPKLLIRYASSRPSGIPDRFSGSGSGTDFTFTISRVEAGDAANYYCQQSFQ
Alligator mississippiensis Vs19 ighv AKHW01003537.1 2656 ILAQVTLKESGPGVVKPGETLSLTCTVSGFSLTSYHMQWVRQAAGKGLECVGGIWSAGGTNYNSALQSRLNISRDTSRSQVHLRLTGVQPGDTALYYCARD
Alligator mississippiensis Vs1416 trdv AKHW01087663.1 51769 DPSLENRVTQRETDASDVEGGSVTLGCTYETAESSYFLHWYKQRPGGSLAFLLWQRSSGTKSNEAGPRFSVELQTGRRSVSLSISSLELGDSATYFCAFS
Alligator mississippiensis Vs775 iglv AKHW01112774.1 2365 LFAQNVVTQPPSVSVSPGQTARLTCSGPGSYMQWYQQKPGSAPLLIIYDNTXRPSGISDRFSGSKSGNTATXTITGVQAQDEADYYCSMWVSSSSQ
Alligator mississippiensis Vs1421 trav AKHW01087663.1 30467 CCCGAQVSQSPEALMTREGDRSTMTCTYSNTYRPFQWYRQVPSGEITHLLTVAANRNVTEGRVRGEWLESGQKSRLHIAGTRLDDSGRYFCAVE
Alligator mississippiensis Vs770 trav AKHW01111905.1 39008 TFHPSALSRREGETASFFCNISRGNFHALDDNLNWYKATNGTQSLKIAGLQGNKKDIKTAKYHLINHTSVIEMKLLNLQKNDTGFYFCGLITFSP
Alligator mississippiensis Vs834 ighv AKHW01006465.1 1120 VLSAVQLVESGPGVVKPAETLTLTCTVTGFSITTSNYYWSWIQQPPGKGLEWMGYIYGYSDSTYYNPSLKSRITISKDNSKNQFSLQLRSLTAADTATYYCAR
Alligator mississippiensis Vs1365 trav AKHW01080127.1 1668 SSCRAQVSQSPEALESREGARAAMACAYSSAFQTFQWYRQAPSGEITHLLSVPANRNVTAGLFTGESLEGGKKTTLHLVELRLADSGRYLCATD
Alligator mississippiensis Vs1364 trav AKHW01080127.1 9245 AVRGDSVHPEKPLVTAAEGDTVTLRCNYTSNSIGYNDYLYWYRQFPNQTLQYILRRETKTDSGVHDNAPFAEERFSSXAXASDTTLNITALEWTDTAVYHCALQ
Alligator mississippiensis Vs1414 trav AKHW01087663.1 58196 AVRCGSIQPQESQVSRGEGDSVTLHCSYSTSEQYVFLYWYQQYPNRAPQYILYRGARSGSSVTHTADFAKNRFSSHADDTTTVLSITALGRADTAVYYCALQL
Alligator mississippiensis Vs1361 trav AKHW01080127.1 52315 AAGGAEILQPGSAAAPEGAPLNLTCSHGSVSGGDRVQWYRQFPTRGPQFLVSGYTGTVPVSAPEGALHISADTKSSALELRAAGRGDAAVYYCAVS
Alligator mississippiensis Vs779 ighv AKHW01113331.1 1970 AVSAGTLAESGPGVVKPGQTLTLNCTLFNESLSSESAWAWIRQPPGQGLQVMARTVFTGVRSYTDYASSLQGRLTISGVASEKPLELELRSLTAADTATYYCTR
Alligator mississippiensis Vs1363 trav AKHW01080127.1 12890 TCCRAQVSQSPAALVTREGDRSTMACTYSNTYRPFQWYRQVPSGEITHLLTVAASRNATEGRFTGESREDGKKCFLNLSQARLGDSGRYFCAVD
Alligator mississippiensis Vs564 trav AKHW01082708.1 6770 SVIDTCEVTVAQPSLREVDNTLSTVNITCSFSASGCPGSAQVLWFRFLAHKHEALCTPLCTNTGKFKATEPSKNNASLQISHLTVNDSAVYFCGVAF
Alligator mississippiensis Vs370 trgv AKHW01053167.1 58803 GDAQELKQPQVSITKQEYKTAPIQCRVSGISLDSAYIHWYRQKPGKAPERILYLSSGKPIFDRDSDKGKFEAEKILSDSTCTLTIEQTSKDDAATYYCAYWT
Alligator mississippiensis Vs371 trgv AKHW01053167.1 81513 GDSQGLRQSQTSVTRGVRKTARIQCHVSTESFSSVYIHWYRQMPEETPERILYFSSEKPVFDKDADKRKFEAEKELTESTCTLTIKTVNQNDSATYYCAYWD
Alligator mississippiensis Vs1288 trav AKHW01072019.1 23005 LCTGVTVTRNMFVAIQNGTNASLPCKHDDESYYYVLWYQQKDQGQLQLVAVSADVNKADTEEKYQSQYTIEQKVMLHNSLKIKSATVRNSAAYFCAASK
Alligator mississippiensis Vs1289 trav AKHW01072020.1 36622 LCTGVTVTQKKFIAIMNRTTASLPCEHDDSNKYAILWYQQQKGAGGELEFVAQQITGNEAEIEAKFKERFKWKQTNTFKSSLDIMVGAAEDSAVYFCATSK
Alligator mississippiensis Vs785 iglv AKHW01000340.1 1044 CLAQTAPTQQPSVSVSLGEIATLTCTANGIGSYRAGWYQQKPGSAPLTVMYYNNNRPSGILDRFSGSKSSNTATLTITGVQAKDESDYYCSTYDSGSSS
Alligator mississippiensis Vs375 trgv AKHW01053168.1 3394 LILTQSPLSTTKSEGSTARIKCVFTDFTGAFDSAAIHWYQQSPGEAPKRVLYFISAEAAVDDQSQKSRFTVVKDSLKLSCTFQINRAKKTDTGVYYCAYWD
Alligator mississippiensis Vs376 trgv AKHW01053168.1 8495 GDALVLTQSEPSKTREETKSASIKCHVTGTTTVIHWYRHKPGEGPERILYLSAGKAVYDKESEKKFSARQESTKGMYALTIHDISTDDAAMYYCASWDE
Alligator mississippiensis Vs412 ighv AKHW01057935.1 5385 VLSSVTLVQSGPGVVKPGETLSLTCAVSGYSITSSSWHWIRQPPGEGLQWMGYISSGGSTGYATALQSRLSFSRDTSKNELYLQLSSLTAADTATYYCAR
Alligator mississippiensis Vs1518 trav AKHW01097747.1 12269 AASQEGLWLQQSPAEIRTTPGQAAELNCIVLFQQQRVSWYKEHQDGSLQWVAHIGTFVEPKGRYSSKVNSTGKMFSLIINQLQEEDSGLYYCALDVSL
Alligator mississippiensis Vs1425 trav AKHW01087663.1 19085 GCSLEDRVTQQQAFASRLERGSVTLDCTYETEETYYNLYWYKQRPGDSLAFLLWENSRGSKINEAGKRFSVDFQRSDRSFLLRISELQLGDSATYFCAFGK
Alligator mississippiensis Vs1286 trav AKHW01072019.1 43325 LCTGVVVTQNKFAAIQNGADANLPCEHDDDTYDAVLWYQQKDQGQLQLVVISIGMGNERTEEKYKPRYSMERKDMLHNSLKINSATITDSAVYFCAASK
Alligator mississippiensis Vs1285 trbv AKHW01072019.1 51402 LLDARITQTQSLVLRKGGTAQLQCEQTYGHQRKFWYRQDLDQGPQLLFQFYHEEETGKGNVSHQFTAKRSGAKVLHLNITSVEPQDSAVYFTVYFCASSA
Alligator mississippiensis Vs374 trgv AKHW01053167.1 94735 AHGEITITQTPEFTLKRENATVRMYCILQGISGNIANAIIHWYHQSPGEAPKRILYFTSGKSTVDDSSQEKSFQVALDSQKSRYTFYVNGIKKMDAGIYYCAYW
Alligator mississippiensis Vs793 iglv AKHW01000930.1 5059 CGAQFVLTQPPSVSASPEGTVTISCTRSSGSISDYYVSWFQQKPGGAPVLVIYQWNNRPSGIPSRFSGSTDSSSNTATLTIAGVQADDEADYYCLSYDSSSN
Alligator mississippiensis Vs490 trbv AKHW01072015.1 65328 QTYAEITQTPSVVLERKRTAYLRCKQNNGHENMFWYRQNPRQGQGLQFLFFFQYREERERDANFSHFKANRAQDDVLYLNISSVEPDDSAVYFCATSP
Alligator mississippiensis Vs492 trbv AKHW01072016.1 6176 ITDAKITQIASLILRRGGEAQLTCKQNDDHNNMYWYQQKQGQGLKLISYSIGTGNKNVEQGDNSDSFHPSRPNTENFNMNISAVLVDHSATYFCASSL
Alligator mississippiensis Vs1427 trav AKHW01087663.1 11644 AAGSAQILQPPSAEAPEGAPLNLTCAHSSINTNDNVFWCRQFPDRGLQFIVYGYTGTVPSSALEGALHISADRRASALALRRAGLGDSAVYYCALS
Alligator mississippiensis Vs366 trgv AKHW01053167.1 34046 VLRAISMKQEQISITQPVDLHSTVSISCKVTGGLASTYVHWYRALPGQALQRLLYLTLEGSNVKRDTGFSREKFTAIVRQSTCTLLVRKVEKTDSGHYYCATWE
Alligator mississippiensis Vs1295 trbv AKHW01072021.1 5329 LLDARISQTQSLVLKKGGLALLECEQTDGHYAMFWYQQDVGQGLQLVFYFYNEKEAERGNISDRFTASQLEAKVFHLNISAVEPQDSAVYFCASST
Alligator mississippiensis Vs809 iglv AKHW01003308.1 2454 SLAQHVMTQPPSVSVSPGEPAKLTCTGRNVGSSNVYWFQQKPGSAPVLIIYSNSNRPSGISNRFSGSKSGSTATLTITGVQAQDEADYYCEAWDSDSSA
Alligator mississippiensis Vs1000 ighv AKHW01031365.1 654 SFTQIQLVASGPGALSPGAALTVTCKVSGDSIATQAWWNWVRQPHGRGLQWVGRIHFSGSTNYAPALKARSSITKDDAKNEYYLQLQGVTAADTGTYYCTRWD
Alligator mississippiensis Vs705 iglv AKHW01101384.1 1207 CCAQVTQPLTATVSPGGTVRLSCTLGGSYTVSSNRVLWIQQKPENVPRSLLYFFTESKNGLGSGVPSRFSGSRSGSDKEGYLTITGALEEDDAMYYCVTWAGSA
Alligator mississippiensis Vs706 iglv AKHW01101384.1 4997 CYAQVTQPPTASVSLGGTVRLSCTLGGSYTVSSNRVLWLQQKPGNAPRFLLYFFTESNKGMGSGVPSRFSGSRSGSDKEGYLTISGAVEEDDADYYCTTWTGSA
Alligator mississippiensis Vs825 trav AKHW01004758.1 25509 IDLLSLTDPDAVTGPETVTGPEGRSVSVMCHYKKGYEKYPKFWCRDNLLSCLGSHIIDTTGSEAEVWHDRFSIQDNHTQRTITVTVENLVMADTGTYLCGVAR
Alligator mississippiensis Vs1352 trav AKHW01080125.1 13128 GSSAQSVRQTEGSLTVREGHPVFINCTYKXSGAPFLLWYRQVPGDAPRLLLTQYKDLEEEKEKGGRRFSADLDKSSSSFHLEKNASEASDSAVYYCALS
Alligator mississippiensis Vs1353 trav AKHW01080125.1 6713 AVRGDSIQSQDPEMSRGEGDAVTLRCSYSTSDQYPYLYWYRQYPNQAPQYILYRGARSSSSHSNTASFAQKRFSSQADDSTTVLNITALEPEDSAVYYCALWV
Alligator mississippiensis Vs1354 trav AKHW01080126.1 27445 AVRGDTVHPEKPLVTAAEGDTVTLRCTYTSSSIGYNDYLYWYRQFPNQTLQYILLRETKTDSGVHDNAPFAEERFSSQASASDTTLNITALEWTDTAVYHCALQ
Alligator mississippiensis Vs1355 trav AKHW01080126.1 22456 SSCGAQVSQSPEVLVTREGDRSTMTCTYSNTYQTFQWYRQAPSGEITHLLTVAADQNVTAGRITGERLESGTRSALRLVPHGLADSGRYLCAVG
Alligator mississippiensis Vs1356 trav AKHW01080126.1 20277 SCCSAQVSQSPAALVTREGDRAAMACTYSSAYQNFQWYRQAPSGEITHLLTVAANRNATEGRFTGESREDGKKSFLHLSQTQMGDSGLYFCAVD
Alligator mississippiensis Vs1357 trav AKHW01080126.1 18029 ATGRAQILQPPSAEAREGAPLNLTCAHSSISTNDNVFWYRQFPDRGLQFLVSGYKGTVSSSAPEGALHISADRRASALELRRAGLGDAAVYYCALS
Alligator mississippiensis Vs388 ighv AKHW01054323.1 1665 VQSTVELVQSGVVVNKPGETVKISCKTSGFTLNEYFMTWVQQAPRKGLVWVGRIYAVNGNTDYAETLQGRASITTNNSISTVYLRLSRLSPADTAMYYCVQ
Alligator mississippiensis Vs1459 trav AKHW01089916.1 14588 SLGTAQILQPGSAEALEGAPLNLTCEHSSINLADYIYWYRLFPNLGPQFIVFGSKGTVQVSSPEGALHISKDRKSSALALLAPGLGDAAVYYCAVS
Alligator mississippiensis Vs1591 igkv AKHW01107407.1 538 SSGQVXMTQTPESLSVVPGQTVTINCKASSSIGSYAHWYQKKPRQTPKLVIYNANNHPSGIPDRFSGSGSGTDFTLTISHVEADDAGDYYCSQXGYSAP
Alligator mississippiensis Vs411 ighv AKHW01057933.1 5914 AWSQVQLVESGGDVRKPGDSLRLSCKVSGFTFSSNYMHWARQAPGKGLDWVGGINSDGFTQWYSPAVQGRFTISRDNSQNMLYLQMSSLKPEDKALYYCTG
Alligator mississippiensis Vs1456 trav AKHW01089914.1 4413 AAAGDQVTQTEGAVSLSQGDPVSLNCTYDSSYSVFPFWYVQRPGGAPGLFLRDVGRQESDEGTRRGFEATHKKSAPKSFHLWKSAGEWSDSGTYYCAVS
Alligator mississippiensis Vs413 ighv AKHW01057936.1 153 VLSAVQLVESGPGVVKPAETLTLTCTVTGFSITSSGYEWHWIRQPPGKGLEWMGYITSSGGTSYNPSLQSRITISRDTSKNQFSLQLHSLTAADTATYYCAR
Alligator mississippiensis Vs665 ighv AKHW01094989.1 1587 VWSQVQLVESGGDVRKPGDSLRLSCKASGFTVSSYEMNWVHQAPGKGLEWVAFISTSSSPIYYADSVKGRFTISRDDSSSLLHLQMNSLRAEDTARYYCAR
Alligator mississippiensis Vs381 ighv AKHW01054315.1 2749 QLLVSGPSTVKVSEPLTLTCAVSGKLITTTGFRGHWYRQLQGKGPEWMGVIDGTGGTQYAPSLQNRTKISRDTSKNHFSLSLLSVTTADIAKYYCALG
Alligator mississippiensis Vs1294 trbv AKHW01072021.1 9612 VCTGVTVTQEKFVSIETGTNASLHCEHDDSSYITILWYQQQEAARGQLEFVALHVDRNEAEIESKFKKRFKLTRTNTLKASLEITGGTAEDSAVYFCAASK
Alligator mississippiensis Vs1451 ighv AKHW01089895.1 4468 AMSQVWLVESGPLVAKPGETLTLTCAVSGESITTXNRWGHWIRQPQGTGLKWMGYISFSGSTSYSPALQSRIAISRDTFKNQVFLQLHSLTTADTAMYYCTRG
Alligator mississippiensis Vs1296 trbv AKHW01072022.1 11619 VGSDKVEQPPFFTGVLGELPTLHCTLKDEAFPYMYWYRQRGSKELEALFYSATGSSVTNYTTEPMTAQRKENTWTLTLNSPSQTDSALYYCACSK
Alligator mississippiensis Vs121 iglv AKHW01019484.1 4435 SLAQYVLTQPPAASVSPGQTARLTCTGTSLGSYYVQWFQQKPGSAPLQLIYQSSKRPSGIPDRFSGAISGDTATLTITGVQAQDEADYYCQVWDSGSNQ
Alligator mississippiensis Vs123 iglv AKHW01019485.1 4100 SLAQYVLTQPPAASVSPGQTARLTCTGTSLGSYHVQWFQQKPGSAPLQLIYQNSKRPSGIPDRYSGAKSGDTATLTITGVQAQDEADYYCQVWDSGSKQ
Alligator mississippiensis Vs122 iglv AKHW01019485.1 1174 ARSQSLLTQPPAESVPPGHSEKLSCTMSSGTSISGYDVHRYWQKPGSPPQYLLRYKSSSDTYLDSWLPSHFSASKDTSSNTCYLTITGPLAEDEADYYCNV
Alligator mississippiensis Vs125 iglv AKHW01019487.1 225 SADSAPSVSVHPGNTVNLDCSIHSGSSSSGYRVYWYQQKPSSPPLYLLRHTSDSDKHRAHGLPARFSRSKDLSRHNCSLTILGVLTEDEADYYCGMWYNNA
Alligator mississippiensis Vs124 iglv AKHW01019486.1 12570 LFAQNVVTQPPSVSVSPGQTARLTCSGTGSYVHWYQQKPGSAPLRIIYDDTKRPSGISDRFSGSKSGNTATLTITGVQAQDEADYYCSMWVSSSSQ
Alligator mississippiensis Vs786 iglv AKHW01000342.1 1433 SLAQYVMTQSPSLFISPRETAKLTCTGRNIGSNYVQKPGSVPWLIIYSKSKTPCSIPDQIPGSTSGSTATLTVTGAQAQDKADYYCQAYDDDSNS
Alligator mississippiensis Vs385 ighv AKHW01054318.1 1263 VRAQIRLVASGGGINNAGGSASLSCKASGFTFEGYWMHWYRQAAGKGPEWVSTVSYGAGDTKRYAESVRGRFVIWKDNAQSLLHLEMNSLKPEDTAVYYCGS
Alligator mississippiensis Vs1228 trav AKHW01063858.1 996 AALGDLIQTVESQVSGAEGGTVTLLCSYESSADAVFLRWYRQFLSRQMEYILARGAKGVRGAQDNAEFALIRFSSQASDSSTELTLSALQLADSATYYCALE
Alligator mississippiensis Vs485 trav AKHW01071227.1 2954 AVRGDSIQPEETQVSAAEGNTVTLRCFYSTEKKDPFYLYWYRQYPNRTLQYILYKGIRSASSTRGTADFAEERFSSTTDDNSTVLNITALERADTAVYHCALQ
Alligator mississippiensis Vs1224 trav AKHW01063850.1 6592 ASEQLSQSPSALQGQEGQDVELRCDYSTAQDSFTLDWYQQQPGGXPAFLVGRYSFGSRRTVPSTPLRFSTELDAGGRASMLSIAGAQPADSALYLCALRG
Alligator mississippiensis Vs1225 ighv AKHW01063850.1 3647 AHTQMQLVASGPGTEEVAKPITLTCTASGVSVTSDYTWFWYRQAHGKRLEVIAWGYYSSSKWYPATASSFQGWATTSVETSKNQFFLQLKSLTVADTSTYYCCVG
Alligator mississippiensis Vs1226 trav AKHW01063853.1 2976 AALGDXIQTVQSQVSGEGGGAVTLRCSYESSAEYVDLLWYRQFLSGQLQYILLRGVNKRKGIQNTAGFAQERFLSPASDTSTELTISALQLADSAVYYCALS
Alligator mississippiensis Vs73 igkv AKHW01012854.1 6673 SSGDXLVTQTPESVVVSPGDTVTIKCKTSSSVSNWMHFYQQKPGQAPKLLVYKTSNRPSGIPNRFSGSGSGTDYTFTISQVEAGDAGDYYCQQSASTP
Alligator mississippiensis Vs1223 trdv AKHW01063850.1 9233 AAAGNSVTQVQPTVSAQAGQLVRLNCQFSTRYNSYAFTWYQQVPGKPPTFLLSRTKYDVEXKSRSVPARFSTELWTQTQTFTLSVEKAQPDDSATYLCXLE
Alligator mississippiensis Vs858 trav AKHW01009624.1 2310 LLRPPDVSEISQPESVAKGKGVTLSCRVAGHFPGELSVTWLRRGKGEATAVILRDSAECRVEPGTAVLARDGKSFQQETRLICWTSRDKGANYICRV
Alligator mississippiensis Vs386 ighv AKHW01054319.1 18233 QLLASGPSTVKVSEPLTLTCAVSGKLITTTGFRGYWYQQFQGKGLKWMSLIDGAGTTRYAPSLQSRTKVSRDTSKNQFSLHLESPTIADTAVYYCALG
Alligator mississippiensis Vs1018 ighv AKHW01034704.1 385 KCSAAPKGXHHVLSAQSLAPPIPHPREATCSWHWIWQPPGEGLQWMGYISSAGSTNYASALQSRLSFSRDTSKNELYLRLSSPTAADTATYYCAR
Alligator mississippiensis Vs1453 trav AKHW01089910.1 1208 HTYAESVTQXEGTVNVVEGEAVFLNCTFETSGYPSLFWYVQFPGEAPSLLLTDTAGSEEEEERKRRRGFSANLERNVKSFHLKKLSSDRSDSAVYYCALS
Alligator mississippiensis Vs659 iglv AKHW01094054.1 8707 VWSQPVVTQEPAVSVSPGGTVTLSCSLSTGAITSSNHPGWYQQKPGSPPRLLIYDTMTRPSGLPTRFSGSISGQKAALTITRVQAEDEADYYCAVYVGSAPW
Alligator mississippiensis Vs658 iglv AKHW01094054.1 2445 VWSQPVVTQEPAVSVSPGGTVTLSCSMSTGAITTNNYPGWYQQKPGSPPQQLIYSTSSRPSGIPTRFXGSIPGQNAALTIPEAQAEDEADYYCILWYSSEW
Alligator mississippiensis Vs1581 ighv AKHW01105652.1 368 AWSQGQLVESGGAVRKPGDSLRLSCKASGFTFSSSYMNWVRQAPGKGLDWVARISSDGSSQWYSPAVKGRFTISRDNSQNMLYLQMSSLKPEDTALYYCAR
Alligator mississippiensis Vs80 iglv AKHW01013610.1 1134 ARSQSVLTQPPAESVSLENTVKLNCAVSSGTSISGYSVYWYQQKPGTPPRYLLYYKSNSDKHQGSGVPARFSGSKDTSSNTGYLTITRVLAEDEADYYCAV
Alligator mississippiensis Vs1626 iglv AKHW01112092.1 12270 SLAQYVVTQPPSVSVSPGQTARLXCSGNNIGSKSVHWYQQKPGTAPLLIIYGDSNRPSGIPDRFSGANSGNTATLTITGVQAQDEADYYCQVWDSSSSQ
Alligator mississippiensis Vs1627 iglv AKHW01112092.1 5263 SLAQYVVTQPSSVSVSLGQTAQLTCSGNNIGGKNVSWYKENPGSTPRLVIYGNNKRPSSMPDRFSGANSGDTXTLTITGVQAGDETDYYCVAWDSESSS
Alligator mississippiensis Vs1423 trav AKHW01087663.1 24970 LAQSDSVFQSRPEMAVSEGHTVSIPCNFTTISSNPYLFWYRQFPNQPPQHVLTVYKSAEVKNRFSGGKFSSVLFPENKTVPLTIEEVSVQESAVYYCALS
Alligator mississippiensis Vs1420 trav AKHW01087663.1 33488 GCSLEDSVSPLLADASGVERGAVTRDCTCETEKTYYYLHWYKQRSGDSLAFLLWQKSGGSHMNEAGVSFSVDFPRSQRSFLLSISALQLGDSATYFCAFSK
Alligator mississippiensis Vs395 iglv AKHW01055777.1 1709 CLAQTAPTQPPSVCISPGQTAMITCTGSSIGSTGANWYQQKPGTAPLLIMKYDNNRPSGISERLSGSMSGNTATLTITGVQAQDEADYYCXTYSGSNS
Alligator mississippiensis Vs657 iglv AKHW01094049.1 464 SSSQQLQPLKPSEQVSPGGTVTIACSLSSGAVGDGNYPQWVQQKPGHVPRLLMYSTSTRPSDVPARFSGSRSGNXMSLTITGAQPEDDADYYCSVWTGSA
Alligator mississippiensis Vs656 iglv AKHW01094047.1 1286 VWSQPVVTQEPAVSVSPGGTVTLSCSLSTGAITSSNYPGWYQQKPGSPPRLLIYNTNSRPSEIPTRFSGSISGQKAALTITGVQXEDEADYYCTVYASSSVR
Alligator mississippiensis Vs655 iglv AKHW01094046.1 8858 VWSQPVVTQEPEVSVSPGGTVTLSCSLSTGAITSRNYPGWFQQKPGSPPRQLIYLTSSRPSGIPTRFSGDISGQNNTLTIMAVQAEDEANYFCGVRAGSSDA
Alligator mississippiensis Vs654 iglv AKHW01094046.1 5708 QSSQSALTQAHPTLSVALGQTATLQCTLQGVEFISSSNPAWYQQRPESSPRLLIYKSRSRASGVPERFSADTTGNTALLTITGVQAEDEADYYCAV
Alligator mississippiensis Vs235 ighv AKHW01036339.1 2357 AWSQVQLVESGGDVRKPGNSLRLSCKASGFTFSSYSMQWVRQAPGKGLDWVAEINSGGSSQWYSPAVQGRFTISRDNSQNMXYLXMXSLKPEDTALYYCAR
Alligator mississippiensis Vs234 ighv AKHW01036338.1 12437 VLPEIQLVESGGAIRKPGDSLRLSCKASGFTFSDTWMAWARQPPGKGLQWVGEIIGDSKTINYAPAVKGRFTISRDNTQNLLYLQMGSLSPADTARYYCAR
Alligator mississippiensis Vs236 ighv AKHW01036343.1 11970 VLSQIQMVQSGPGVLKPGETLTLTCAVTGESITTSSTYWEWILQSQSAGLKWMGQISFLGDTTYNSALQSRFSMSRDTAKNQFSLQLRSLTAADTATYYCAR
Alligator mississippiensis Vs231 ighv AKHW01036337.1 4734 AAFAVMLVETGPGVAKPGETLTLTCTVSEQSITASSTYWNWIRQAPSTGLEWMGVINYQGGTSYNSALQSLIAISRDTSKKQFSLQLRSLTAADTATYYCAR
Alligator mississippiensis Vs230 ighv AKHW01036337.1 1151 VLTEVQVVASGPGLVKPGDILTLTCSVSGVSITDSSYDWHWIRHPPGNVLEWMGRIYPNNGNTNYASSLQSRIMISAATSKNQFFLQLHSLTAADTAMYYCA
Alligator mississippiensis Vs233 ighv AKHW01036338.1 7043 TQXQVWLAEXGGGVQVPRGSLRLTCQTSGFKLISYWVEWFQLTPDMGLQWASEIRSAANNHTDYYSNTVKGWFTISRDDSSDLLYLQMNDLKAEDTALYYCT
Alligator mississippiensis Vs232 ighv AKHW01036337.1 11701 IXSHVTLKESGPGVVKPGETLTLTCTISVDTVTNNYWDWFRQAPGKELEWIGEIDQYSANWRKNYNPSFQSRTTLFADKSRNQFSLQLRSLTATDTAMYYCAR
Alligator mississippiensis Vs136 iglv AKHW01020568.1 4069 SLAQFVMTQSPSLSISPRETAKLTCTGRNIGSNYLQWYQQKPGSVPVLIIYSKSKRPCSIPDRISVSTSGSTATLTITAAQAQDKADYYCQAYNDDSSS
Alligator mississippiensis Vs1297 trbv AKHW01072022.1 1673 LLDARISQTESLVVKKGSSAKLQCEQTDGHNYMFWYRQDPGQGLQLVLYFYDKQERERGNIPARFKGDKSGTNVFHLNIDTVEPQDSAVYFCASSL
Alligator mississippiensis Vs1360 trav AKHW01080126.1 2745 AAARAEILQPGTREAPEGAPLNLTCSHGSVSNENIFWYRQFPNGGFQLLVSGYRGYVAVSAPEGALHISADRKSSALALRAAGLGDAAVYYCALS
Alligator mississippiensis Vs1335 igkv AKHW01077689.1 2892 SSADIVMTQTPESLVVPPGDTATIKCKASSSVTGSYVYVNWYQQKSGQAPKRLIYYASSRATGVSDRFSGSGSGTDFTLTISRVEAEDAGDYYCQQTY
Alligator mississippiensis Vs584 ighv AKHW01085714.1 24021 VLSQGQLVQAGPGVVKPGETLTLTCAVSGESITTTDTWWHWIRQSQVTGLEWVGHIFFDGSTSYKSALQSRISISRDTSENQFSLQLRSLMAADTATYYCVR
Alligator mississippiensis Vs644 trav AKHW01093426.1 460 AVRGDEIRPEEEQVSAAEGDAVTLRCFYTTTYSAGYNLYWYRQHRDRALQYILYKGTKENRRSSDIAEFAQQRFASQADDNSTVLIITALERADTAVYHCALRR
Alligator mississippiensis Vs645 trav AKHW01093427.1 788 AVRSDSVHPEKPLVTAAEGDTVTLRCNYKTSSSFSYYLYWYRQHLNQTLQYILRRGTKDYSAASDNAPFAEDRFSSQASDSATTLNISALELGDTAVYHCALQ
Alligator mississippiensis Vs435 ighv AKHW01062213.1 4595 VQSQLQLQESGPGVVKPGEPLSLTCTVTGGSITSSDYWAWVRQDPSKQLVFMGRWSGNTNYNPAFQSRITISVDSSNTKYYLKLSSLTAADTAMYYCAR
Alligator mississippiensis Vs434 ighv AKHW01062212.1 8987 ILSQVTLKESGPGVVKPGETLSMTCAVSGVSITDSSYAWSWIRQPPGKGLEWMGYIYPAGGSTSYNPSLQSRITMSGDSSKNQFSLQLRSLTASDTAMYYCAR
Alligator mississippiensis Vs1062 ighv AKHW01040397.1 17627 VYPQGSLVESGGGVQKPGETLSLTCTVTGVSLTSVGVHWFHQPKAKGLDWMGVIWSGGSTNYNSALKSRLSITRDTSSGKVQLQLSGLQPRDTAWYYCXR
Alligator mississippiensis Vs1063 ighv AKHW01040397.1 10344 ALSQFTLQQSSLELGRPGQTFTLTCAVSGDSITNNYWEWVRQAPGKELEWVGQIDQSSSNWXRYYGQSFQSRATLSADPSKNQFSLQLHSPTASDTATYYCSGY
Alligator mississippiensis Vs725 igkv AKHW01104437.1 8290 SSGDRVMTQTPESLAVFPGDTATIKCKCSSSLTSAGKEFLAWYQQKLGQAPKLIITFASTRQPGVPARFSGSGSGTDFTLTISSVEAEDAGDYFCQQNYG
Alligator mississippiensis Vs1061 ighv AKHW01040397.1 21871 AVSAVTLVQSGPGVVKPGQTLTLTCTVSGESLSSGSTWSWIRQPPGQGLQWIGRTYYSSSRWYTNYASSLRGRVTISADTSQKQFSLQLRSLTAADTAMYYCAG
Alligator mississippiensis Vs372 trgv AKHW01053167.1 86971 GSTEVLKQTQLSISRAASRTARIECHVAVSDFGRAYLHWYRQRPGAAPERILYFSLQVHVDRESDKGKFNVQKNLNKSICVLTINRISSSDIATYYCATWA
Alligator mississippiensis Vs1064 ighv AKHW01040399.1 4641 VLSQVTLKESVPVVVTPGQTLSLTCTVSRVSLTSSDMNWIRQAAVKRLEWVGAISSGGGIYYNSALRSCLSFSRDVSSSQVHLRLTGVQPADTARYYCVRE
Alligator mississippiensis Vs1065 ighv AKHW01040400.1 3624 VLAQAQLVESGPGVVKPGETLTLTCDVRGSYTTGYDWSWFRRPPSKGLEWLGLIHPTAGNTYYSLSLRSRITISADTARHQFSLQLRSLTAADTATYYCSIDK
Alligator mississippiensis Vs1439 trmv AKHW01087789.1 1361 TWSQVQLVESGGDVREPGDSLRLSCNASGFTFGDYWMSWVRQAPGKGLEWVATISYWAGSTIQYVNSVKGRFTISRDNPKNLLHLQMNSLKPEDTAMYYCTR
Alligator mississippiensis Vs243 ighv AKHW01037084.1 3462 IQSQWQLQESGPGVAKPGETLSLTCTVTGGSVTSSYYWLWIRQTPGKGLEWMGAWTGSTYYNPAFQNRITISVDSSSTKYYLRLSSLTAADTATYYCA
Alligator mississippiensis Vs244 igkv AKHW01037210.1 10093 SSGDIVMTQTPESLAVSPGDTVTINCKASSSTGNAFSWYQQKPGQAPKLLIYSGTSLAFGVPSRFSGRQIGRGYTDYALMISGVQSEDAGDYYCQQGTSF
Alligator mississippiensis Vs245 igkv AKHW01037210.1 15658 VCGDIALTQTPESLAVSAGDTVTIKCKASEYSGSSSMAWYQQKSGQAPKLLIYSVSSRPSGIPDRFSGSGSDTDFTLTISRVEAGDAGDYYCQQYYNT
Alligator mississippiensis Vs246 igkv AKHW01037212.1 28165 SNGDVVLTQTPESLTVSPQDTVTITCNAGSYTSSSIAWYQQKSGKSPKLLIYSTSSCASGISDRFSGARSGSDYTLTISRVEAGDAGDYYCQYHGNTP
Alligator mississippiensis Vs247 ighv AKHW01037256.1 888 VLSAVQLVESGPGVVKPAETLTLTCTVTGLPITTSGYVWSWILQTPGKGLEYMGYIYAYGSGGTYYNPSLKSRITFSMDTSKNQFSLQLRSLTAADTATYYCAR
Alligator mississippiensis Vs1431 trav AKHW01087664.1 19601 VRGTAQILQPPSAEALDGAPLNLTCDHSSITLGDFIHWYRKVPNRGPQFIVSGSKDTVQVSDPEGALHISKDRKSSRLALRAAGRGDAAGYYCAVS
Alligator mississippiensis Vs1430 trav AKHW01087663.1 554 VSLGDSIQPNDSEVSVEEDKNVTLSCSYHTSHTGSVYLHWYRRYPNRPLHYILSRGAKTAKSFSDIAEFAKERFSSQTNVSSTMLKITAVERADSAVYYCALYV
Alligator mississippiensis Vs1433 trav AKHW01087664.1 9814 TTQGNSIQSQESQESRGEGDSVTLHCSYSTSDEYVYLYWYRQYPNRALQYILYRGARSRSSATHTAGFAQKRFSSQADRTTTLLVISALELADTAVYYCALRL
Alligator mississippiensis Vs1432 trav AKHW01087664.1 12907 AALGDSIQPEEFQVSATQGVAVTLRCSYSTTYTSGYYLYWYRQHRDRALQYILYRGTKELSKYRGTAEFARERFSSQADDNSTALTITALEQTDTAVYHCALQY
Alligator mississippiensis Vs1435 trav AKHW01087665.1 10363 AALADAIQSAAAQVSAAEGGTVTLRCSYNTSYNAAYYLYWYRQYPNRTLQYLLYRGAKTAKSASSTADFARERFSSETDDTSTEMKIRVLEQTDTAVYHCALQ
Alligator mississippiensis Vs1434 trav AKHW01087665.1 13785 GSSLEDSVTQRQEDASGVQRGAVTLDCTYETEKTSYYLYWYKQSPGGSLVFLLWQSSGGSTRSAAGPRFTADLQKLQRSFSLSISDLQLSDSATYFCAFSX
Alligator mississippiensis Vs1437 trav AKHW01087669.1 473 AARGDSIRPEEAQVSAAEGGTVTLRCFYTTTYSAGYYLYWYRQXRDRALQYILYRGTKERSRERDTADFAEARFSSQTNDNSTVLNITSLELGDTAVYHCALRY
Alligator mississippiensis Vs1436 trav AKHW01087667.1 6369 AVRGDSVHPEKAHVTAAEGDTVTLRCNYKTSTSADYYLYWYRQHPNQTVQYILHRGTKDYSAVSVNAPFAEERFSSQASDSYTTLHISALEWTDTAVYHCALQ
Alligator mississippiensis Vs1519 trav AKHW01097750.1 2848 LGVQLHLYQPQRFLFVEVGGTAEIHCSSRKDLDGGANVRWYLRRAGEAPTHMKDCTNGKNVSKFACKHQRYSTTLEIRDIQRNESGIYYCARA
Alligator mississippiensis Vs54 ighv AKHW01010580.1 424 VSSQTQLTQSGTEVKKPEESVNLTCKTSGYSFTTYNVDWVRQVPGKGLEYIGGINTNTGGTSYAEAFEGRFTITRDTSISTVYLQMSSLKTDDTATYYCAR
Alligator mississippiensis Vs383 trdv AKHW01054317.1 625 ARSAVLVRQDALDKTVREGEEVTFSCSLEGEDMSNYWMYWYRKGEQGTLTWIFRQGGYYGDGFQGRFEGEVKSFENRFTLRLLQAARADRAVYYCATR
Alligator mississippiensis Vs53 trav AKHW01010541.1 621 AEXRAEILQPDSTDVVEXAPLNLTCSHPSVLSGAYIYWYRQFPNGGPKYIVHASKRTVHFSAPEGALHISADKKSSTLELRGAGLGDAAVYYCAVG
Alligator mississippiensis Vs340 iglv AKHW01050270.1 2458 SFSQITLTQPSSESVSLGNTIKLSCTLSVGGTFGAVYWYQQKGGNSPRYLLWYNTDSSKHQGSGVPSRFSGSKDTSNKIGYLTITSVQAEDEADYYCAAVSSGV
Alligator mississippiensis Vs491 trbv AKHW01072016.1 1003 HSDGRIIQKQSLALENGARAQLDCEQTDGHPRMFWYRQVQKQELVLLVYSLAQSDVQNSISTKEVTASRPETSLFHLTIPSVNLQDSAVYFCATSL
Alligator mississippiensis Vs646 trav AKHW01093427.1 11211 GSSLEDKVTQRQKDASGVERGAVTLDCTYETRESYYNLYWYKQSPGGSLVFLLWQYSEGAKESEAGPRFTADLQKLQRSFSLSISDLQLSDSATYFCAFSX
Alligator mississippiensis Vs489 trbv AKHW01072015.1 61825 VHSAAIIQQSQSMVERPGNPASLECSLEGQSNPNFYWYRQLPGRDIHLLAYSVGVGQVEDTGPKHFHANRTTDKKFMLSIKPLLANDTGVYYCAW
Alligator mississippiensis Vs647 trav AKHW01093428.1 47 AALADAIQSAAAQVSAEEGGTVTLRCSYNTXYNVXYYLYWYRRYPNRTLQYLLYRGXKTAKSASSTADFAXERFSSETDDTSTELKIITLELADSAVYHCALQE
Alligator mississippiensis Vs1520 trav AKHW01097753.1 8992 LGVQLHLHQPQRFLFVEVGRTAEIHCSSSKDLEGRQYVHWYVRRAGKAPRHIMVCGDTKNVNKYDCKYKSHSTTLEIRSIQRKESGIYYCAYKQ
Alligator mississippiensis Vs1480 ighv AKHW01092470.1 841 AWSQVQLVESGGDVKKPGDSLHLSCNASGFTLSSSYMNWVRQAPGKGLDWVAEISPDGSNQRYSPAVQGQFTISRDNSQNMLYLQMSSLKPEDTALYYCST
Alligator mississippiensis Vs1481 ighv AKHW01092471.1 854 VSSQIQLTQSRAEIKKPGEAVRLTCKASGYTFTSYGINWVRQAPGKGLEYIGRLNANSGATAYAEAFKGRLTITIDTSISTAYLQLSSLRTSDTAMYYCTR
Alligator mississippiensis Vs1482 ighv AKHW01092472.1 3451 AISAVTLVQSGPGVVKPGETLTLTCTVSGVSITDSSYEWNWIRQPAEKGLEWVVYIYPYTGTTYYNPSLQSRTTISADKSKNQVSLQLRSLTAADTATYYCAS
Alligator mississippiensis Vs382 trdv AKHW01054315.1 6833 VRSAVLLRQHPPDLAVREGEEVTFQCSMDGGSMASYDMYWYRKGEQGPLTWIYREGDHYGDGFQGRFEGEVKSSENRFTLRLLEAARADRAVYYCAAE
Alligator mississippiensis Vs589 ighv AKHW01085717.1 10116 AVSQVQLLESGPGVVKPGETLTLTCTVSGQAIATSNTWWHWIRQPPRKGMEWMGEISYSSSTKYNPSLQSQLTISRDTAKNQFSLQLPSLTAADTATYYCARS
Alligator mississippiensis Vs79 iglv AKHW01013608.1 2036 ARSQPALTQPPAESVSLGNTVKLSCTMSSGTSISGYSVYWYQQKPGTPPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNTGYLTIAGVLAEDEADYYCAV
Alligator mississippiensis Vs583 ighv AKHW01085714.1 15126 AWSQVQLVESGGGVQKPGGSLRLSCKASGFTFSDYYMEWVRQAPGKGLEWVAMIRNPSNGLTAEYNSAVKGRFTISRVESSSTVYLQMDSLRVEDTAQYYCAR
Alligator mississippiensis Vs582 ighv AKHW01085714.1 9922 IQSQSQLQESGPGVVKPGETLSLTCTITGGSVTSSYWWNWIRQASGKGLEWIGPWTGSTNYNPALQNRITISVDSSSTKYYLRLSSLIATDTAMYYCVGS
Alligator mississippiensis Vs581 ighv AKHW01085714.1 4949 VLSDVQLVESGPGVVKPAETLTLTCTVTGYSIGSNVYWSCIRQPPGKGLEWMGFIYGSGGSTYYNPSFQSRITISRDTSKSQFSLQLRSLTAADTATYYCAR
Alligator mississippiensis Vs587 ighv AKHW01085717.1 4239 GVSEVRLEQEGTELVKPTESASLTCIIYGAAIWDHAWSWVQQRPGKGLEWLGRIQGNGNVQYNPAFRNRISITRDNSNNRVYLQLNNMGAADTATYYCARDHK
Alligator mississippiensis Vs586 ighv AKHW01085716.1 9566 VQCQVHLVESGGDVRKPGXCLRLSCKASGFKFSSYHMYWVRHAPGKGLQWLAKITDDGKSTSYASVVKGRFTISRDNSQGLLNLQINSLSLEDTAWYYCTRE
Alligator mississippiensis Vs585 ighv AKHW01085714.1 29376 VLSQVTLKESGPGVVKPGETLSLTCTVSGFSLTSYGVGWVRQAAGEGLQWVGVIWYDGSTGYNSVLKSRLTITRDTSSSQVHLRLTGLQPADTARYYCAR
Alligator mississippiensis Vs737 ighv AKHW01106318.1 4894 TLGAVTLTQPGSASARPGDSITLTCDTSGFNVDYYHINWIQEAPGKGLVWMTGFRMGYDTYIANDFKGRVTPSTNDSTAKLQIARLTLADTATYYCARE
Alligator mississippiensis Vs500 iglv AKHW01073567.1 1318 SLSQFTLTQPPSESVSLGNTVKLSCTISSGKTLGGVAWYQQKNRNSPRYLLMFNTDSDKHQGSGVPSHFSGSKDTSNKIGYLTITNTQAEDEADYYCTAWTSE
Alligator mississippiensis Vs1457 trav AKHW01089914.1 2644 GAVRSDSVQPEEEQVSAAEGDEVTLRCFYTTTYSSGYYLYWYRQHRDRALQXILYKGAKENRRSSNTAEFARERFSSRTDDNSTVLIITALERADTAVYHCALQF
Alligator mississippiensis Vs1532 trav AKHW01099423.1 1687 LGAQFHLHQPQRFLFVDVNGVAEIHCFSREDLAGGANVLWYLRRAGEALKRMKDCGDDKNGHKFACKHQIRNTTLEIRNIQKKESGIYYCARA
Alligator mississippiensis Vs1293 trbv AKHW01072021.1 22025 LCTGVTVTQNKFVTIRNGANASLPCEHDGDANYNTILWYLQDGASGKELQLVVGHTDGGKPETEAKFKGKYILQPKTRTKASLYIISGTAEVSAVYFCAASR
Alligator mississippiensis Vs36 trbv AKHW01007548.1 2524 LCTGVTVTQKKFAAIRNEANVSLPCEHDGDANYDTIFWYRQDGAAGKELGLVARHIDRSEPEMEAKFKGKYHLQPKTRTKTSLYIISGTAEASAVYFCAASK
Alligator mississippiensis Vs1284 trbv AKHW01072019.1 59509 LCSGVTVTQKKKFIAIQNGTNAILPCEHNDNKYFTILWYRQKAGAGGELEFVARSVDESPAEIEEKFQRFFKLKRENTLKASLEISGRAGDSAVYFCAAR
Alligator mississippiensis Vs1292 trbv AKHW01072020.1 7144 LCSGVTVTQEKKFITIQNGNNAIFPCEHNDNNYITILWYQQKAGAGGELEFVARSVDNNPEEIEEKFKKFVKLKRENTLKASLEISGTAGDSAVYFCAAST
Alligator mississippiensis Vs1484 trdv AKHW01092708.1 4378 AARWAVAQVSQPPQLTALEGGQLHISCSHNITPHKRMYWXRQXPXGQGXLIXLGXGYDGTSSAGELTMEVHKTSRSSTLSRDSARLQDAGIYYCASE
Alligator mississippiensis Vs1417 trav AKHW01087663.1 46069 ALGTAQILQPHSAEVLDGAPLNLTCEHSSINPGDYIQWYRLFHNRGLQFIVSGFKDTAPVSTLEGTLHISKDRKSSALALLAPGLGDAAVYYCALS
Alligator mississippiensis Vs106 ighv AKHW01016937.1 377 IQPQVTFAXSGGDXKKPGDXLQLSCKGSGFTRQSFGDYWMXWYRHTPSNGLEWVATISYWAGDTKYYAASVKGRFTISRHNALNMLYLQMKNLQPGDSGYYYCFE
Alligator mississippiensis Vs1110 ighv AKHW01046855.1 3034 VQSQLQLQASGPGMVKPGETLSLTCTVTGGSVTSSFWWTWIRQAPGKGLEWMGWRSGGTYYNPALQNRITISVXSSXTKYYLQLSSLTAADTAMYYCARG
Alligator mississippiensis Vs367 trgv AKHW01053167.1 40236 GDAQVLKQSKSFITKGVHKTARIQCFVSGISLSSAYIHWYRQKPANAPEWILYLSSGEPVIDQGFKKEKLEVEKELTNSTCTLTVKQINKNDAATYYCAYWD
Alligator mississippiensis Vs97 iglv AKHW01015874.1 9931 YLAQYMPTQPPIVSVSPGQTAQITCTGNNVGGHNVHWYQQKPGSVPMLIIYDNSKRPSGIADRFFGSKSSNTATLTISGVQAQDEAYYYCQCYAGDSRT
Alligator mississippiensis Vs1415 trav AKHW01087663.1 55784 AVLGDWIRPQKSLVPGAEGSAVTFGCSYSSSYSGVILFWYRQYPGRAPQYVLARGAKGSKGYEHYAAFTRVRFSSQADDSSTVLRIAALERADTAVYYCALSE
Alligator mississippiensis Vs1123 iglv AKHW01048620.1 4277 SLAEHVLVQXPIVSVSPGQTAQITCSGEMLTKNYAHWYQHKPGSVPKLVMYKDTERPSDVPDRFSAASSGTTLTLTITGVQAEDEADYYCQSGES
Alligator mississippiensis Vs551 iglv AKHW01081260.1 508 AGAQFVLTQPPSVSASPGGTATITCARSSGSISDYYISWYQQKPGRAPVMVIYEDTERPSGIPSRFSGSIDESANTAMLTISGVQPDDEADYYCFSYDSSSSN
Alligator mississippiensis Vs484 trav AKHW01071227.1 1496 ALGTAQILQPRSAEALEGAPLNLTCEHSSITRGDYIHWYRQFPNRGPQFIVSGVKGTVQVSXPEGALHISGDKKSSLLALRAAGRGDAAVYYCAVS
Alligator mississippiensis Vs851 iglv AKHW01008550.1 3839 VWSQPVVTQEPVASVSPGGTVTLSCSLSTGAITTSNYPAWXQQKPGSPPRXLIYSTNSRSSGIPTRFSGSISGQKAALTLTGVQAEDEADYYCIVHTG
Alligator mississippiensis Vs1234 iglv AKHW01064774.1 1111 CLAQTAPTQPPSVSVSPGQTATLTCTGSSIGSNGAYWFQQKSGSAPLTVMYYDNNRPSGISDRFSGSKPGNTATLTITGVQAQDKADYYCSTYDSGSSS
Alligator mississippiensis Vs1487 ighv AKHW01093393.1 395 ARAQIRLVASGGGFRNAGGSASLSCKASGFTFGDYWMHWYRQAAGKGPEWISTISFWAGNTKRYAKSVEGRFTISRDNAQSLLLLQMRSLKTEDTAVYYCWR