WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Giraffa camelopardalis tippelskirchi LVKQ00000000.1 (LVKQ01) 177 6 14 5 73 49 10 20
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Giraffa camelopardalis tippelskirchi V75 trav LVKQ01034869.1 4950 AHTQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Giraffa camelopardalis tippelskirchi V165 trbv LVKQ01073764.1 2827 VRAQTIHQWPSSRVQPAGSPLYLECTVKGTSSPNLYWYRQEAEGGFQLLFYSVGVNDVDPREFQNFKASRPQDGQFILSSNKLQLNNSGFYLCAWS
Giraffa camelopardalis tippelskirchi V214 trav LVKQ01101698.1 1290 DSRGQSVTQPDDPVLVSEGNSLELKCNYSYGATPYLFWYVQYPRQGPQLLLKYFSGNTMVQGIRGFVAEFKRSDFSFNLRKFSAHWNDSAEYFCALS
Giraffa camelopardalis tippelskirchi V215 trav LVKQ01101700.1 4598 GVRAVKVEQSPLVLNLQEGANCTLRCNFSATVKTLQWFQQNPGGSLISLFFIASGMKQNERLSSTVNSKERYSTLHITASKLEDSTTYLCAVE
Giraffa camelopardalis tippelskirchi V216 trav LVKQ01101700.1 10123 VSLGKEVEQSPSTLSVQEGNSCFITCTYTDVTSSYFPWYKQEPGKGPQLLIDVHSNKGKNEGQRLTVLLNKMAKHLSLHISATEVGDSAVYFCAAS
Giraffa camelopardalis tippelskirchi V217 trav LVKQ01101702.1 2003 SIIAQKVTQDPQPMLGQEKEAVTLDCKYNTSDSDYSLFWYKQPSSAAMIFLLRQDSRSKQNSTEGRYSLNFQKARKSITLVISASQLEDSAVYFCALRE
Giraffa camelopardalis tippelskirchi V218 trav LVKQ01101703.1 2193 QTHGNSVTQTDGQLTLSEETSVTINCSYSASGYPALFWYVQYRGEGPQLLLKATKVNEKGSRKGFEATYNAESTSFHLEKASVQESDSAVYYCALS
Giraffa camelopardalis tippelskirchi V219 trav LVKQ01101703.1 6994 VSLGNKVEQSPPTLSVQEGNSSFITCTYTDGNSEYFPWYKQEPGKGPQLLIAIRSNKDKEEDQRLTVFLNKTAKRLSLHIATTEPGDSAVYFCAAS
Giraffa camelopardalis tippelskirchi V250 trgv LVKQ01114930.1 7578 GHGLSKVDQAQISLSTQVKKSIDILCKIESTNFGLEAIHWYRLKLNQALEHLVYVTSTTTAARNQVAGKNKIEARKDAQKFTSTLTVNFVEKEDVGIYYCAGWS
Giraffa camelopardalis tippelskirchi V251 trgv LVKQ01114930.1 13473 GLGQLTLEQPEVSVTGTREKSVIMSCKVFSKDFNKDYIHWYRQKPDQGLEQLLYVSAEPALNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEAMYYCASWL
Giraffa camelopardalis tippelskirchi V252 trgv LVKQ01114930.1 17789 VPITERIISVTKKKGNTAFLECQIKTDKLKKNVYMHWYRQKPEQPLKRILYISSNENVVYEQGISEERYEARKWPSNSLVSLRIHQATEEDAGLYYCACWV
Giraffa camelopardalis tippelskirchi V253 trgv LVKQ01114930.1 20226 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD
Giraffa camelopardalis tippelskirchi V254 trgv LVKQ01114936.1 13148 TQVSSNMEEDKLSVMRATESSVVIDCDLTQNYIHWYKFQELTVPRRLLYYDVYYSKVVLDSGISEGKYHVYKGTGKGYTVVISNLQESDSGTYYCAVWE
Giraffa camelopardalis tippelskirchi V255 trgv LVKQ01114937.1 8644 TQVSSNTEGEKMSITKATGSGSSVEIICNLITQTLKYIHWYKYQEGTAPQRLLYYDISYSKVVLESGVSEGKYHVYKEKSYTFAISNLQESDSGMYYCAAWE
Giraffa camelopardalis tippelskirchi V309 trbv LVKQ01134615.1 41868 AWGIGVFQTPKYLLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFSYNNNVLTENEIVPSRFSPESPDKAHLSLHIDSLEPGDSAVYFCASS
Giraffa camelopardalis tippelskirchi V310 trbv LVKQ01134615.1 45912 VSADPGITQIPKYLVMGMTDKKSLKCEQHLGHNAMYWYKQSAQKPPELMFVHNYKKLTENESVPSRFWSECSDSSQCRLDLNALKPQDSAVYFCASSR
Giraffa camelopardalis tippelskirchi V311 trbv LVKQ01134616.1 697 LVDSEVIQTPKYLIKSRKQQVTLRCSPESGHRSVSWYQQALGQGPQFLIQYYRGQVSGKENMPDRFSAKQFSDFRSELNLSSLELTDSALYLCASSQ
Giraffa camelopardalis tippelskirchi V312 trbv LVKQ01134616.1 6403 AVHAGVTQDPRFQVVRTGQSATLKCTQDLGHDRMYWYRQDLGHGLRLIHYSNGPPTTEKGDVSDGYRVSRSSTKDFPLTLESANRSQTSVYFCASNY
Giraffa camelopardalis tippelskirchi V313 trbv LVKQ01134618.1 1639 AVHAGVTQDPRFQVMRTGQSSTLKCTQDMNHDYMYWYRQDLGRGLRLIYYSDGPPNTKKGDVPDGYRVSRSSTKDFPLTLESANRSQTSVYFCASNY
Giraffa camelopardalis tippelskirchi V314 trbv LVKQ01134618.1 5728 LVDSEVIQTPKYLIKSRKQQATLSCSPDSGHLSVYWYQQALGQGPQFLVQYYNEEVRGEAHLPNRFSGKQFSDSRSELNLSSLALTDSAVYLCASSQ
Giraffa camelopardalis tippelskirchi V315 trbv LVKQ01134619.1 5270 LVDSEVIQTPKYLIKSRKQQATLSCSPDSGHLSVYWYQQALGQGPQFLVQYYNEKVSGEAHLPDRFSGKQFSDSRSELNMSSLELTDSAVYLCASS
Giraffa camelopardalis tippelskirchi V340 trav LVKQ01153032.1 134 SSIAQKVSQDQLPVSVQEKEKVTLNCTYDTSAITYNLFWYKQHSGGVMTFLIHQDSDNKQNATEGRYSFNFQKASKFITLVISASQLEDSAVYFCALRE
Giraffa camelopardalis tippelskirchi V385 trdv LVKQ01178939.1 666 SGVAQKITQDQTGIIRQVGQSVTLNCQYETSWSSYYLFWYKQLPSGQMTYLISQYSERDNARKGRYSVNFQKADKSVSLIISSLQLEDSAKYFCALSE
Giraffa camelopardalis tippelskirchi V386 trav LVKQ01178942.1 4011 TVTDAKITQPSSMDCAEGEDVNLPCNHSTISGNDYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLIISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Giraffa camelopardalis tippelskirchi V387 trav LVKQ01178942.1 11627 GTGAQLVTQLDGHINVSEGNRLELRCNYSYGGSIYLFWYVQYPSQDLQFLLKYSSGPTRVKGIKGFEAEFKKDEKSFHLMKASAHWSDSAKYFCALY
Giraffa camelopardalis tippelskirchi V388 trdv LVKQ01178942.1 29080 SGVAQKVIQDQPDTFGQLGESVTLNCRYGTTWSYYYMFWYKLLPNGEMNYLIHQISSARNAKDGRYSVNFQKAHKSISLTISDLQLEDSAEYFCALCE
Giraffa camelopardalis tippelskirchi V389 trav LVKQ01178942.1 40251 VRGVDVEQSPPALTRQEGTSSTLWCNFSTLANSVQWYLQNPGGHLIHITSGTKQEGRLNATTVPKERRSSLHISSLQTTDSGTYFCAVQHSAPQ
Giraffa camelopardalis tippelskirchi V390 trdv LVKQ01178943.1 5127 SSVAQKVTQDQTAVSDQVGQTVTLNCQYELSWTTNYYYIFWYKQLPSGEMTFLISQYSGYGNARNGRYFVNFQKAYQLISLIISALQLEDSAKYFCALWE
Giraffa camelopardalis tippelskirchi V391 trav LVKQ01178943.1 14492 VNGQQIKHFPEFLLLQEGENFTTYCNFSSNFYNLQWYKQRPGGSPVLLMVLAKGGEVKTQQRLTVQFGESRQHSSLHLMAAQPSDVGTYFCAA
Giraffa camelopardalis tippelskirchi V392 trav LVKQ01178943.1 21058 IMVDAKITQFSSMDCAEGEDVNLPCNHSTINTLDYIHWYRQNPSQSPQYIIHGLRDTVNSSKAFLIIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Giraffa camelopardalis tippelskirchi V393 trav LVKQ01178943.1 26857 ESTEQLEQNPRFLRIQEGGNVTVHCNSSSTFTSFQWYRQKPEEGPVLLMTLTKPKEMKEQKRIKAQFGEARKDSSLLITAAQPGDAGTYFCAG
Giraffa camelopardalis tippelskirchi V394 trav LVKQ01178943.1 33259 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINNKERYSQLYIRDSQPGDSATYFCAVE
Giraffa camelopardalis tippelskirchi V395 trav LVKQ01178945.1 943 ILGDSKTTQPNSMEGTEEEPVHLPCNHSTISGSEYVYWYRQIPHQGPEYLIHGLNNNVTNKMAYLSITKDRKSSILVLPQVTLRDTAVYYCILT
Giraffa camelopardalis tippelskirchi V396 trav LVKQ01178945.1 9728 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINNKERYSQLYIRDSQHGDSATYFCAVE
Giraffa camelopardalis tippelskirchi V397 trdv LVKQ01178945.1 19838 SSMADKVTQAQTTVTAREGEAATIDCTYETSSRYTLYWYRQFPGGRMEFLIYQDDNKASASRDRYSVNFQRGKRFISLTVSSLYLADSAKYFCALWE
Giraffa camelopardalis tippelskirchi V406 trdv LVKQ01187693.1 6469 KGVLCNQVTQSPPEQRVASGSGVTLYCTFQTTYSDPDLYWYRIRPDGVFQFVLYRDNTRSNDADFARGRFAVQRSVSHKTFHLVISSVRPEDTATYYCALEL
Giraffa camelopardalis tippelskirchi V420 trbv LVKQ01196751.1 3858 AVHAGVTQDPRFQVVWTGQNASLKCTQDLDHDYMYWYRQDLGHGLRLIHYSSFTDTTYKGDVPNGYSISRPSTENFPLTLESANRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V421 trbv LVKQ01196751.1 8297 AVHAGVTQDPRFQVVRTGLSGTLKCTQDLSFSYVYWYRQDLGHGLRLTHYSVIPPATQKGNVPDGYSVSRPSTENFPLTLESASHSQTSVYFCASGY
Giraffa camelopardalis tippelskirchi V422 trbv LVKQ01196752.1 3090 AVHAGVTQDPRFQVVRTGQKATLKCTQDLDHDRMYWYRQDLGHGLRLIHYSDGPSTKEKGDVPEGYSVSRSNKEDFPLTLESTKRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V423 trbv LVKQ01196752.1 6510 LVDSGVTQIPKFLTKSRKQQVTLRCSPESGHRSVYWYQQAVGQGPQFLIQYYNEREYQKGNMSDRFSGKQFSDSRSELNLTSLELKDSAVYLCASSQ
Giraffa camelopardalis tippelskirchi V424 trbv LVKQ01196752.1 8172 AVHAGVTQDPRFQVVRTGQRATLKCAQALGHERMYWYRQDLGQGLRLIHYSAGARATEKGDVPEGYSVYRSNTENFPPTLESANRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V425 trbv LVKQ01196752.1 15555 AVHAGVTQDPRFQVVRTGQNATLKCTQDLGHDSMYWYRHDLGLGLRLLHYSTIAPSLQKGDIPEGYSVSRPNKENFPLTLEFANRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V426 trbv LVKQ01196752.1 21225 LGDSGVTQTPRYLIKSRKQQVTLRCSPESGDLYLSWYQQALGQGLHFLVQYYDEKVYQKENISDHFSGNMFSDSRSELSLTPLELTDSAVYLCASSQ
Giraffa camelopardalis tippelskirchi V427 trbv LVKQ01196752.1 22904 AVHAGVTQDPRFQVVRTGQSATLKCTQDLSFSYVYWYRQDLGHGLRLTHYSAGAPTTEKGDVPDGYSVSRPSTENFPLTLESASHSQTSVYFCASGY
Giraffa camelopardalis tippelskirchi V428 trbv LVKQ01196752.1 26546 TVHAGVTQDPRFQVMRTGQKATLKCTQDLDHNYMYWYRQDLGHGLRLIHYSAGPSLKEKGDVPEGYSVYRSNKEDFPLTLESANRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V429 trbv LVKQ01196752.1 28519 LVDSGVTQIPKFLTKSRKQQVTLRCSPESGHRSVYWYQQAVAQGPQFLIQYYVGKDYQRGNMSDRFSGKQFSDSRSELNLTSLELKDSAVYLCAVSQ
Giraffa camelopardalis tippelskirchi V430 trbv LVKQ01196752.1 30177 AVHAGVTQDPRFQVVRTGQKATLKCTQDLGDDRMYWYRQDLGHRLRLIHYSAGAPTTEKGDVSEGYRVSRPNTENFPLTLESANRSQTSVYYCASSY
Giraffa camelopardalis tippelskirchi V431 trbv LVKQ01196753.1 3374 AVHAGVTQDPRFQVVRTGQNATLKCTQDLDHNYMYWYRQDLGLGLRLIHYSAGPSLKEKGDVPEGYSVSRSNKEDFPLTLESANRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V432 trbv LVKQ01196753.1 5896 PVDSGVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWYQQAVGQGPQFLIQYYNEKVYQKGNMSDRFSGKRFSNSGSELNLTSLELKDSAVYLCASSR
Giraffa camelopardalis tippelskirchi V433 trbv LVKQ01196753.1 7545 AVHAGVTQDPRFQVVRTGQSATLKCTQDLDHDHMYWIRQDLGHGLRLIHYSISPPTTEKGDVPEGYTVSRSNKQDFPLTLDSANRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V434 trbv LVKQ01196753.1 16342 LVHAGVTQDPRFQVVRTGQNATLKCTQDLGHNYMYWYRQDLGLGLRLIYYSTGSDSWEKGDVPEGYSVSRPNTKDFPLTLEFANRSQTSVYYCASSY
Giraffa camelopardalis tippelskirchi V435 trbv LVKQ01196753.1 18929 LMDSEVTQTPKYLIKSRKQQATLRCFPVSGHLSVYWYQQALGQGPQFLVQYYRQQVRGEAHLPDRFSGKQFSDFHSELNLSSLALTDSAVYLCASSR
Giraffa camelopardalis tippelskirchi V436 trbv LVKQ01196753.1 23972 AVHAGVTQDARFHVVRTGLSGTLKCTQDLSFSYMYWYQQDLGHRLRLIHYSVIPPATQKGNVPDGYSVSRPSTENFPLTLESASHSQTSVYFCASGY
Giraffa camelopardalis tippelskirchi V437 trbv LVKQ01196753.1 25761 LVDFEVTQTPKFLMKSRKQQVTLRCSPNSGHCFVYWYQQALGQGPKFFIQYYDGEVNEKGNIADRFSGQWFSDARSELSLSSLELMDSALYLCASSQ
Giraffa camelopardalis tippelskirchi V438 trbv LVKQ01196753.1 32392 AVHAGVTQDPRFQVVRTGQKATLKCTQDLGHSYMCWYRQDLGHGLRLIHYSNGPPSAEQGDVPEGYTVSRSKTEDFPLTLESANRSQTSVYFCASSY
Giraffa camelopardalis tippelskirchi V439 trbv LVKQ01196753.1 34895 LVDSEVIQTPKYLIKSRKQQVTLRCSPESGHRYVAWYQQTLGQGPQFLILYYDGNVRTKGSMPDRFSGEQFSDSRSQMNLSSLELADSAVYLCASRQ
Giraffa camelopardalis tippelskirchi V440 trbv LVKQ01196753.1 37232 AVHAGVTQDPRFQVVRTGQNASLKCTQDLNHDSMYWYRQDLGHGLRLIHYSSFTDTTYKGDVPDGYNVSRSSTENFPLTLESANRSQTSVYFCASNY
Giraffa camelopardalis tippelskirchi V441 trbv LVKQ01196753.1 40146 HTGAGVVSQSPRHRVTGRGQAVNLRCDPIPGHQALYWYRQTLGQGLEYLTYFQGKEEPDKLEMLKNWFSAERPESTFSSLKIQPTEPEDSAVYLCASSP
Giraffa camelopardalis tippelskirchi V442 trbv LVKQ01196754.1 7632 PLEAEVTQTPGHLIKTTGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETRQRDKGNFSNRFSAKQLHNFSSELNVNSLELTDSALYLCASSL
Giraffa camelopardalis tippelskirchi V443 trbv LVKQ01196755.1 11242 TTDANLGVTQTPRHEVTEKGQAVTLSCEPISGHTSLYWYRQTSVQGLELLIYFHNEAPIDESGMPKDRFSARMPNALFSTLKIHPTEPGDSATYLCASSK
Giraffa camelopardalis tippelskirchi V444 trbv LVKQ01196755.1 23478 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTLQRGLELLIYFNNQASVDDSGVPKERFLAKMLNASFSTLKIQPTEPGDSATYLCASS
Giraffa camelopardalis tippelskirchi V445 trbv LVKQ01196755.1 26244 DTSAAVAQSPSHRVIEKKQAVNLSCDPISGYDSLFWYYHAVGKEMKLLIYFIRESVQDNSGMPEGRFTAGRTEGMSSMLRVHSAELGDSGIYFCAS
Giraffa camelopardalis tippelskirchi V446 trbv LVKQ01196755.1 28541 HVGAMVIQNPRYLVTRMGKPVTLSCSQNLKHDTMYWYQQKPSQAPKLLLYYYDTQSTKEKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Giraffa camelopardalis tippelskirchi V447 trbv LVKQ01196755.1 33406 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAKCLSNSPCSLKIQPTEPQDSAMYFCASSD
Giraffa camelopardalis tippelskirchi V448 trbv LVKQ01196756.1 668 TVAGGVTQTPKYLLKEEGGAVTLECEQDFDYNSMYWYRQDPGLGLRRILFSPLVNDVQKEDIAKGYNASREKKPFFPLIMTSAQKNQTALYLCAASR
Giraffa camelopardalis tippelskirchi V449 trbv LVKQ01196756.1 4412 GSGLGALVSQHPRRALSKSGASVTIQCHAVDFQATTMFWYRQFPKRGLVLMATSNTGANATYEQGYNKDKLPISQPNLTFSSLMVTSVDPADSSLYFCGAS
Giraffa camelopardalis tippelskirchi V450 trbv LVKQ01196756.1 16857 SMDTEVTQSPSHLVKGKDQKAKMDCVPIKGHTLVYWYRKKLEAFEFLVHLWNGKITEDTAVFKQRFSAECPQNSPCSLEINSTEAADSALYFCASS
Giraffa camelopardalis tippelskirchi V451 trbv LVKQ01196758.1 1402 SMDTEVIQSPSHLVKGKGQKAKMDCVPRKGHSYVYWYRKKLEETFEFLVYLQNEKIIEDTAMFKQRFSAECPQNSPCSLEIKSTEAADSALYFCASSQ
Giraffa camelopardalis tippelskirchi V452 trbv LVKQ01196758.1 7663 SMDTEVTQSPSHLVKGKDQKAKMDCIPRKGHINVYWYRKKLEEAFEFLVYLQKQDIVEDTEVFKQRFSAECPQNSPCSLEIKSTEAVDSALYFCASSQ
Giraffa camelopardalis tippelskirchi V453 trbv LVKQ01196758.1 14009 SMDTEVTQSPSHLIKGKDQKAKMDCVPRKGHSYVYWYRKKLEEAFEFLVYLRNQDIAEDTEVFKQRFSAECHKNSPCSLEINSTEAADSALYFCASS
Giraffa camelopardalis tippelskirchi V454 trbv LVKQ01196759.1 3142 SMDTGVTQTPRNRIANTGKSTVLECSQTKGHDFMYWYRQDPGRGLRLIYSSSYDISDINKGDISDGYNVSRKEKAKFFLYLEPATPNQTAIYFCASSI
Giraffa camelopardalis tippelskirchi V475 trav LVKQ01216586.1 1498 VSSQQNTVEQGPASLPVPEGANASLGCNYSDSASQYFAWYRQYPGKGLEFLLYVYTDNEEGKFTAQVSKANKHVSLHIRDSEPSDSATYLCAVR
Giraffa camelopardalis tippelskirchi V476 trav LVKQ01216586.1 12499 GTTAQTVTQPESHISVFKGDPVQVKCNYSYSGSPVLFWYVQYPRQRLQLLLKHISRESIQGFTADLNQAETSFHLKKPSAQEEDSAVYYCALG
Giraffa camelopardalis tippelskirchi V477 trav LVKQ01216586.1 17198 VSSQQGEQNLQTLSIQEGENVTMNCSYKSVSLTTLQWYRQDSRRGFVHLISIPSNERQKYSGRLHFTLDNSIKSSSLSITASQAEDTATYLCAP
Giraffa camelopardalis tippelskirchi V478 trav LVKQ01216586.1 24398 GASGDSVTQTEGLVTLPEKASLTLNCTYQSSYSVSLFWYVQYHTGLELELLLKSSSENQKVTSRGFEAISISSDSSFNLQKSSVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V479 trav LVKQ01216586.1 28673 GTNGDSVNQTEVPVTVSEGAHMTLNCTYQTADLAPYLFWYVQHLNKAPQLLLKGSTRDQRPKNKGFQAALVKSDSSFHLQKRAVQTSDSAVYYCALR
Giraffa camelopardalis tippelskirchi V488 trav LVKQ01224444.1 2135 QTHGNSVTQTDGQLTLSEETSVTINCSYSASGYPALFWYVQYRGEGPQLLLKATKVNEKGSRKGFEATYNAETTSFHLEKASVQELDSAVYYCALS
Giraffa camelopardalis tippelskirchi V489 trav LVKQ01224447.1 529 SSIAQKVNQDQPRKSVEEKENVTLDCTYDTRDTTYSLFWYKQHSSGLMTFLIRQDSDNKQNAIEGRYSLNFQKASKFIKLTISASQLEDSAVYFCALRE
Giraffa camelopardalis tippelskirchi V490 trav LVKQ01224448.1 2845 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATGYPTLFWYVQYPGEGPELLLKAMKPNEKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCVLS
Giraffa camelopardalis tippelskirchi V491 trav LVKQ01224449.1 1572 GVRGVKVEQSPSILKLQEGANSTLRCNFSAAVNSVQWFRQNPGGSLTRLFFIASGTKQNERLSSTVNSKEQYSTLHITASKLEDSATYLCAVE
Giraffa camelopardalis tippelskirchi V492 trav LVKQ01224449.1 5442 VGLGNEVEQSPSTLSVEEGNSFVITCTYTDTASEYFPWYKQEPGKGPQLLIAIRSNMGEKKDHRLTVLLNKTAKHLSLRIAAIQPGDSAVYFCAAS
Giraffa camelopardalis tippelskirchi V493 trav LVKQ01224454.1 4021 QTLGDSVTQLGGQVTLPEKAAVTINCTYSATGYPTLFWYVQYSREGPQLLLKATKDKKKGISKEFEATYRRKSKSFHLKKDSVQEPDLVVYYCALS
Giraffa camelopardalis tippelskirchi V503 trdv LVKQ01238502.1 961 SGVAQKVTQDQPDITTQVGQSVTLNCQYEVSWYRISYSIFWYKQLPSGQMTYLIRQYSENGNARDGRYSVNFQKADNSISLTISALQLEDTAKYFCA
Giraffa camelopardalis tippelskirchi V504 trav LVKQ01240206.1 350 QTLGDSVTQLGGQVTLPEKAAVTINCTYSATGYPTLFWYVQYSREGPQLLLKATKDKKKGISKEFEATYRRKSKSFHLKKDSVQEPDLVVYYCALS
Giraffa camelopardalis tippelskirchi V506 trav LVKQ01241616.1 104 TLSLAKTSQPIFIDSYEGQEVNISCNHTKIATNDYIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPTDRKFSTLSLPRASLRDTAVYYCIVR
Giraffa camelopardalis tippelskirchi V510 ighv LVKQ01245033.1 1733 VLSQVKLQESGPSLVKPSQTLSLTCTVSGLSLSSSAVGWVRQAPGKALEWVGATYGGGSTSYNPALKSRLSITSDTSKSQVSLSLSSVTTEDTAVYYCAK
Giraffa camelopardalis tippelskirchi V511 trdv LVKQ01245385.1 582 SGVAQTVTQDQPYITSQIGQSVILNCRYTLSWSGYTHYLFWYKQLPSGEMIFLLRQESSGPNARSDRYSVNFQKAQNSISLTISALQLEDSAKYFCAIRE
Giraffa camelopardalis tippelskirchi V512 trav LVKQ01245386.1 220 VNGQQISQIPQFLLLQEGENFTTYCNSSSILSSLQWYKQSPGGRPVLLMILSKVGEVKTQQRLTGRFGESRQHSSLHLAAAEPSDVGTYFCA
Giraffa camelopardalis tippelskirchi V513 trav LVKQ01245390.1 2733 TVIDAKTTQPNSMDCAEGENVNLPCNHSTIGGDEYIHWYRQNPNQSPQYIIHGLRGTVNNSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Giraffa camelopardalis tippelskirchi V516 trav LVKQ01252905.1 655 ETDGDSVNQTEGPVTVSEGAPMTLNCTYQATYSTVYPSWYVQYLNKAPQLLLQGLRAGKEEEKEGFLATSDKSDSSFHLQKRAVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V525 iglv LVKQ01283242.1 212 SWAQAVLTQPASVSGSPGQRVSITCSGSSSNIGYSSYNVGWYQQIPGSAPKTLIYGTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCASADSSSYN
Giraffa camelopardalis tippelskirchi V529 trav LVKQ01311242.1 1812 VRGVDVEQSPPVLSLQEGANSTLLCNFSTLSQSVNWYLQNPGGRLIHLVYVPSGTKQEGRLKATTVPTERRSSLHISSSQTTDSGTYFCVVQHSAPQ
Giraffa camelopardalis tippelskirchi V534 trav LVKQ01767191.1 1686 VSSKQEVSQSPEARNVREGDSLVLNCSYTDSALYFLQWFRQDPGKGLTSLLSIQANQKEQTSGRITVSLDKSSRHSALHIATSQHSDSTTYLCAV
Giraffa camelopardalis tippelskirchi V535 trav LVKQ01767974.1 686 GAGAQSVTQPDDHIIVSEGARLELKCNYSSSVSPYLFWYVQYPNQGLQFLLKYVSGDNLVSDIKGFEAEFRKNEKSFHLRKVPAHWKDSAKYFCALS
Giraffa camelopardalis tippelskirchi V539 trav LVKQ01770013.1 3360 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATGYPTLFWYVQYPGEGPELLLKAMKPNEKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCVLS
Giraffa camelopardalis tippelskirchi V545 trav LVKQ01767191.1 1686 VSSKQEVSQSPEARNVREGDSLVLNCSYTDSALYFLQWFRQDPGKGLTSLLSIQANQKEQTSGRITVSLDKSSRHSALHIATSQHSDSTTYLCAV
Giraffa camelopardalis tippelskirchi V546 trav LVKQ01767974.1 686 GAGAQSVTQPDDHIIVSEGARLELKCNYSSSVSPYLFWYVQYPNQGLQFLLKYVSGDNLVSDIKGFEAEFRKNEKSFHLRKVPAHWKDSAKYFCALS
Giraffa camelopardalis tippelskirchi V550 trav LVKQ01770013.1 3360 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATGYPTLFWYVQYPGEGPELLLKAMKPNEKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCVLS
Giraffa camelopardalis tippelskirchi V686 igkv LVKQ01058693.1 17982 ASGEAVFYQTPAYISVPLGERISITCRANQSISDYLSWYKQKPGQAPVILIYDADNRYNGVPERFTATQSDTEFVFTISQVEADDAAMYYCQQDYVFP
Giraffa camelopardalis tippelskirchi V687 igkv LVKQ01058694.1 56480 SNGAIVLTQTPSPLSVIPEEPASISCRASQSLKDSYGNSLLHWYVQKPGQSPQLLIYGASNRASGVSDRFTGSGSGADFTLKISRVEAKDTGVYYCQQSKETP
Giraffa camelopardalis tippelskirchi V688 igkv LVKQ01058694.1 45095 SSGDIVLTQTPLSLSVIPGETASISCKSTQSLKYSDGKTYLRWFQHKPGQSPQLLIYQISNRDTGVPDRFTGSGAETDFTLTISRVQAEDAGVYYCYQDSYNP
Giraffa camelopardalis tippelskirchi V689 igkv LVKQ01058694.1 30927 SSGDAVLTQTPLSLSVIPGETASISCKPSQSLVHSDGKTYLSWIQHKPGQSPQGLIYQVSNRYSEVPDRFTGSGSGTDFTLKISRVQAEDAGVYYCYQGTEDP
Giraffa camelopardalis tippelskirchi V690 igkv LVKQ01058694.1 24205 SSGDIVLTQTPLALSVVPGETASISCKSSQSLLYSDGKTYQYWFLQKPGQSPQLLIYQVSNRYTGVPDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGTENP
Giraffa camelopardalis tippelskirchi V709 trav LVKQ01066298.1 41327 SAGKGVEQPTELMAMEGASAQVNCTYQTSGFNGLFWYQQHYGGAPVFLSYNVLDGMERRGHFSSFLRRSDAHSYLLLKELHMKDFASYLCAVI
Giraffa camelopardalis tippelskirchi V719 trbv LVKQ01073772.1 27189 LKDAAVTQFPRRRILETEKEFTLQCSQKMNHYVMYWYRQDPGFGLRLIYYSTDLNTFKKGDVPEGYHVSRNELERFSLTLKSASPNHTSVYFCASAE
Giraffa camelopardalis tippelskirchi V720 trbv LVKQ01073772.1 2160 PVSGALLSQKPSRAIRQRGTSVTIECQVDSEPNFMYWYRQLPGQSLVLMATANQGSKATYNSGFTEDKFPISRPNLAFSTLTVSNVSSKDSSSYFCSSG
Giraffa camelopardalis tippelskirchi V803 trdv LVKQ01111195.1 25257 VMSAVVLVSEDQVKTVPVGKSVTLSCSMKGDSISKYYIFWYRKTPGNTMTFIHREGGAYGPGFEDNFRGKIDGSTNQAVLEILKASERDEGFYYCASD
Giraffa camelopardalis tippelskirchi V804 trdv LVKQ01111196.1 14165 VSLDVILESETKTLTVRLGEPATFRCNITGGNWKNYQMSWYKKNENNILTLVFRLSNNSTENARGHFKGKIDTLKNQYVLNIQKATIKDVGTYYCGSD
Giraffa camelopardalis tippelskirchi V805 trav LVKQ01111198.1 22937 PNDVESADVLTVHEKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKHAREGRYSVEFYKPNQMLKLTISALTLSDSAVYLCAVRE
Giraffa camelopardalis tippelskirchi V806 trav LVKQ01111199.1 54085 VSAQQLNQSPQSMYIQEGEDISMNCNSSRTLNLLLWYKQEAGEGPILLIKLLKGGELVRNGKLTAQFGGTRKDSLLNISASEPKHAGTYFCAG
Giraffa camelopardalis tippelskirchi V807 trav LVKQ01111199.1 29655 PSVAQTVTQPRPEESVQEADTVTLNCTYSTSESDYYLFWYKQPPGGEIVFIIRQNANTKQNATNGRYSGNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Giraffa camelopardalis tippelskirchi V808 trav LVKQ01111199.1 25594 PSVAQTVTQPRPEESVQEADTVTLNCTYSTSESDYDLFWYKQPPRGEMVFIIRQNANAKQNATNGRYSGNFQKETKAFSLRISDSQLEDAAMYFCAYSG
Giraffa camelopardalis tippelskirchi V809 trav LVKQ01111199.1 13628 LNAELKVEQSPPSLIILEGQAGINCNHSVTTSDTLLWYRRDQGKSLESLFLLMLNGAVKKKGGLTASLDTTARRSPLHITASQPGLSATYFCAVD
Giraffa camelopardalis tippelskirchi V810 trav LVKQ01111200.1 305 ILGDSKTTQPNSMQGTEEEPVHLPCNHSTISGPEYIHWYRQIPHQGPEYLIHGLNNNVTNKMASVSIAKDRKSSILVLPQVTLKDTAVYYCILR
Giraffa camelopardalis tippelskirchi V873 iglv LVKQ01143341.1 23356 SVLSYELTQPTSESVALRQTATITCSGDLLDKKYTSWYQQKPGQSPVQVIYKDSERRSGIPDRFSGSSSGKTATLTISGAQTEDEADYYCQSADSSDN
Giraffa camelopardalis tippelskirchi V874 iglv LVKQ01143341.1 16491 SVLSYELTQPTSLSVALGQTAMITCLGDQLDQQYTQWYQQKPDQTPKLVIYKDSKLRSGIPDRFSGSSSGKTAILTISGVRAEDEADYHCQSLDSGSDN
Giraffa camelopardalis tippelskirchi V875 iglv LVKQ01143341.1 10518 RVVTSQLTQPPAVSASLGQTASITCQGDDIGSYFAHWYQQKPGQAPVLVIYESSERPSGIPDRFSGSSSGNTATLTISGAQAEDEADYYCQSADSSDN
Giraffa camelopardalis tippelskirchi V876 iglv LVKQ01143351.1 4375 SWAQAVLTQPSSVSGSLGQRVTISCTRSSTNIGILGVSWYQQLPGSAPKTLIYDSNKQPLGVPNRFSGSRSGNTGTLTITSLQAEDEADYYCASADFSLK
Giraffa camelopardalis tippelskirchi V882 trdv LVKQ01145828.1 1398 SGVAQTVTQDQPYITSQIGQSVILNCRYTVSWSGYTYYLFWYKQLPSGEMIFLLRQESSGPNARSDRYSVNFQKAQNSISLTISALQLEDSAKYFCAVRE
Giraffa camelopardalis tippelskirchi V883 trav LVKQ01145830.1 2144 GAGAQSVTQPDDHIIVSEGARLELKCNYSSSVSPYLFWYVQYPNQGLQFLLKYVSGDNLVSDIKGFEAEFRKNEKSFHLRKVPAHWKDSAKYFCALS
Giraffa camelopardalis tippelskirchi V884 trav LVKQ01145831.1 19299 GTNGDSVNQTEGPVTVSEGARVTLNCTYQTTYSNSYLFWYVQHLNKAPQLLLNSLTKNKEEEHEGFQATLVKSDSSFHLQKRAVQTSDSAVYYCALR
Giraffa camelopardalis tippelskirchi V885 trav LVKQ01145831.1 17085 SIVAQKVTQNQSEIPALEKEDVTLNCAYEAKSFSYYLLWYKQPPSGEMIFLIHKESYNELNTTKGQYFLNFQKATSSISLTITDLQLGDSAVYFCALR
Giraffa camelopardalis tippelskirchi V886 trav LVKQ01145831.1 8396 VSGQDQVEQSPQTLKIQEGKSLSLNCSYTVSNFRGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATLLKKGSSLHIEASKAEDSATYLCAVE
Giraffa camelopardalis tippelskirchi V887 trav LVKQ01145831.1 2297 VSSKQEVSQSPEARNVREGDSLVLNCSYTDSALYFLQWFRQDPGKGLTSLLSIQANQKEQTSGRITVSLDKSSRHSALHIATSQHSDSTTYLCAV
Giraffa camelopardalis tippelskirchi V888 trav LVKQ01145837.1 393 GTDGDSVKQTEAPVTVSEGARMTLNCTYQTAAPVPYLFWYVQHHNKAPQLLLKGSNGDPRPKKEGFHAALVKDDSSFHLQKQAVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V905 trav LVKQ01155143.1 2476 GTNGDSVNQTEGPVTVSEGARMTLNCTYQTTYTTPYLFWYVQHLNKAPQLLLKGSMGDPRPKKEGFQAALVKSDSSFHLQKQAVQTSDSAVYYCALC
Giraffa camelopardalis tippelskirchi V906 trav LVKQ01155146.1 6662 GTNGDSVNQTEGPVTVSEGAHMTLNCTYQATYSTVYLFWYIQHLKKAPQLLLKGSIGDLRPKKEGFQAALVKSDSSFHLQKQAVQTSDSAVYYCALR
Giraffa camelopardalis tippelskirchi V968 trav LVKQ01190269.1 368 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPALLMILSKSGEVKMQQRLTGRFGESKQHSSLHLAAAQLSDVGTYFCA
Giraffa camelopardalis tippelskirchi V969 trav LVKQ01190274.1 7040 TVFDAKSIQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYIIHGFRDTVNSSMAFLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Giraffa camelopardalis tippelskirchi V970 trav LVKQ01190274.1 671 VSSLLTVEQHPGLLPVQERESTNFTCSFPSSSFYALHWYRWEPAKSPKNLFVLSVNGDEKKQGRMRVTLNTKEGYSSMYIRGSQPEDSATYLCA
Giraffa camelopardalis tippelskirchi V971 trav LVKQ01190276.1 4045 VQGLEVEQSPPALSLLEGASHMLSCNFSASVTNVQWYLQNPSGRLIHISSGTKQDGRLNATTVLKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Giraffa camelopardalis tippelskirchi V972 trav LVKQ01191863.1 306 GLRAQSVTQPEDQIPVVEGDPVTVKCTYSVSGSPYLFWYVQHRNQGLQFLLKYITGNNLVKGDYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVS
Giraffa camelopardalis tippelskirchi V989 iglv LVKQ01203805.1 7457 SWAQAVLTQPASVSGSPGQRVSITCSGSSSNIGYSSYYVGWYQQIPGSAPKTLIYGGTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCYSGDSSNYN
Giraffa camelopardalis tippelskirchi V990 iglv LVKQ01203807.1 2892 SWAQAVLTQPASVSGSPGQRVSITCSGSSSNIGYSSYNPGWYQQIPGSAPKTLIYGGTRRASGVPDRFSGSKSGNTATLTISSLQAEDEADYYCAAYDSSSYN
Giraffa camelopardalis tippelskirchi V991 iglv LVKQ01203808.1 3192 TWAQAVLTQPSSVSGSPGQRVSITCSGSSRDVGRSNVGWYQQIPGSAPRTLIYDGTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAGYDSSSYY
Giraffa camelopardalis tippelskirchi V1005 ighv LVKQ01218312.1 1610 VLSQVKLQESGPSLVKPSQTLSLTCTFSGFSLSSYAVGWVRQAPGKALEWVGAIDGDGDTCYNSALKSRLSITKDTSKSQVSLSLSSVTTEDTAVYYCAR
Giraffa camelopardalis tippelskirchi V1006 ighv LVKQ01218314.1 8422 VLSQVKLQESGPSLVKPSQTLSLTCTVSGFSLSSYSVDWIRQAPGKALEWVGEMGYGGSTYYNPALKSRLSITKDTSKSQVSLSVSSVTTADTAVYYCAR
Giraffa camelopardalis tippelskirchi V1007 ighv LVKQ01218314.1 3426 VLSQVKLEMWGSETVTPQQTLTLTCAVYGFSISTDGYAWTWIRQPPGKGLEWMGSIWYDGSTKYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTGVYYCAR
Giraffa camelopardalis tippelskirchi V1009 ighv LVKQ01218322.1 585 VLSQVKLQESGPSLVKPSQTLSLTCTVSGFSLSSYAVHWVRQAPGKALEWVGGTGSSGSTCYNPALKSRLSITKDTSKSQVSLSLSSVTTEDTAVYYCAK
Giraffa camelopardalis tippelskirchi V1011 trdv LVKQ01220156.1 8486 SGVAQSVTQDQPDITSEVGKTVTLNCRYETSWDMFYYYIFWYKQLPSGQMTYLIRQYSDDGNTRDGRYSVNFQKTHKSISLTISVLELEDSAKYFCLLLD
Giraffa camelopardalis tippelskirchi V1012 trdv LVKQ01220157.1 16668 SGVAQSVTQDQPDITSQVRNVVILNCRYETTWMVYTYWIFWYKQLPSGLMTYFIRQYSEDGNERDGHYSVNFQKAQKFISLTISSLKMEHSGKYFCALWE
Giraffa camelopardalis tippelskirchi V1021 iglv LVKQ01226358.1 10512 TWAQAVLTQPSSLSGSPGQSVSITCSGSSSDIGSSNSYVAWYQQIPGSAPKTLIYGTTSRASGVPDRFSGSKSGNTATLTISSLQAEDEADYYCSSGDSSSYN
Giraffa camelopardalis tippelskirchi V1022 ighv LVKQ01226539.1 3483 VLSQVKLQESGPSLVKPSQTLSLTCTVSGFSLSSYAVQWVRQAPGKALEWVGATYGGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTTADTAVYYCAR
Giraffa camelopardalis tippelskirchi V1027 trav LVKQ01231485.1 5988 SSIAQKVSQDQLPVSVQEKEKVTLNCTYDTSAITYNLFWYKQHSGGAMTFLIHQDSDNKQNATEGRYSFNFQKASKFITLVISASQLEDSAVYFCALRE
Giraffa camelopardalis tippelskirchi V1034 iglv LVKQ01241561.1 6741 SWAQAVLTQPASVSGSPGQRVSITCSGGSSNVGYGNYVGWYKLVPGSAPKTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCASYDSSSYN
Giraffa camelopardalis tippelskirchi V1035 trav LVKQ01242683.1 1794 GTNGDSVNQTEVPVTVSEGAHMTLNCTYQTADLAPYLFWYVQHLNKAPQLLLKGSTRDQRPKNKGFQAALVKSDSSFHLQKRAMQTSDSAVYYCALR
Giraffa camelopardalis tippelskirchi V1040 trav LVKQ01248755.1 11489 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIDTLDYIHWYRQNPNQSPQYIIHGLRDTVNNSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Giraffa camelopardalis tippelskirchi V1041 trav LVKQ01248755.1 8163 VRGVDVEQSPPALSLQEGASYTLLCNFSTSPQSVNWYLQNPGGRLIQLFYIPSGTKQEGRLKATTVPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Giraffa camelopardalis tippelskirchi V1042 trav LVKQ01248755.1 6954 QVKKSPQSLTVWEAEISILNCSFEKGAFDYFLWYWQYPGKGPAFLIAVLGMMKDGSSTVSLNKSAKQLSLHIATSQPGDSATYICAASAWYSP
Giraffa camelopardalis tippelskirchi V1043 trdv LVKQ01248755.1 408 SGVAQKVTQDQTGIIRQVGQSVTLNCWYETSWSTYYLVWYKQLPSGQMTYLIQQYSEGRNARHGRYSVNFQKADKSISLIISSLQLEDSAKYFCALRV
Giraffa camelopardalis tippelskirchi V1044 trdv LVKQ01248756.1 5512 SGVAQKVTQDQSGIIRQVGQSVTLNCRYETSWSSYYLVWYKQLPSGQMTYLIHQYSDDDSARNGRYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Giraffa camelopardalis tippelskirchi V1047 trav LVKQ01250737.1 8291 GTNGDSVNQTEGPVTVSEGARMTLNCTYQTTYTNPYLFWYVQHLTKAPQLLLKGLTAGKEVEHQGFRATPVKSDSSFHLQKWAVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V1048 trav LVKQ01250737.1 2571 GTNGDSVNQTEGPVTVSEGAHMTLNCIYQTADSAPYLFWYVQHLNKAPQLLLKGSIGDPRPKKEGFQAALVKSDSSFHLQKQAVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V1049 trav LVKQ01251493.1 875 GTNGDSVNQTEGPVTVSEGAHMTLNCTYQATYSTDYLFWYVQHLNKAPQLLLKGSMGDPRPKKEGFQAALVKSDSSFHLQKQAVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V1050 iglv LVKQ01252004.1 666 SWAQAGLTQLSSVSGSLGQSVSITCSGSSTNIGGYSRSVDWYQQIPGSAPKTIIHGTTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCSCYQSGNN
Giraffa camelopardalis tippelskirchi V1052 iglv LVKQ01254077.1 6963 SWAQAVLTQPASVSGSPGQRVSITCSGGSSNIGYSSYYVGWYQQIPGSAPKTLIYGGTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCYSGDSSNYN
Giraffa camelopardalis tippelskirchi V1054 trdv LVKQ01256357.1 4311 SGVAQKVTQDQPDITTQVGQSVTLNCQYEVSWYRISYSIFWYKQLPSGQMTYLIRQYSENGNARDGRYSVNFQKADNSISLTISALQLEDTAKYFCA
Giraffa camelopardalis tippelskirchi V1060 trdv LVKQ01265498.1 1734 SGVAQKVTQDQPDISSQVGESATMNCQYETSWSRYNIFWYKLLASGEMIYLIGQSSYSPNARDGRYSINFQRSRKAISLIISALKLEDSAKYFCALWE
Giraffa camelopardalis tippelskirchi V1062 trav LVKQ01268793.1 1401 VSLGNKVEQSPPTLSVQEGNSSFITCTYTDGNSNYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVFLNKTAKRLSLHIAAAESGDSAVYFCAAS
Giraffa camelopardalis tippelskirchi V1070 trbv LVKQ01709389.1 357 AVHAGVTQDPRFQVMRTGQSSTLKCTQDMNHDYMYWYRQDLGRGLRLIYYSDGPPNTKKGDVPDGYRVSRSSTKDFPLTLESANRSQTSVYFCASNY
Giraffa camelopardalis tippelskirchi V1071 trbv LVKQ01740589.1 571 FMDADVYQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYRVNTTEKGERSSRSTVSRISKESFPLTLETASSSQTSSYFCASSD
Giraffa camelopardalis tippelskirchi V1072 trdv LVKQ01745144.1 710 SGVAQTVTQDQPYITSQIGQSVILNCRYTVSWSGYTYYLFWYKQLPSGEMIFLLRQESSGPNARSDRYSVNFQKAQNSISLTISALQLEDSAKYFCAVRE
Giraffa camelopardalis tippelskirchi V1073 iglv LVKQ01748784.1 424 TWAQAVLTQPSSLSGSPGQSVSITCSGSSSDIGSSNSYVAWYQQIPGSAPKTLIYGTTSRASGVPDRFSGSKSGNTATLTISSLQAEDEADYYCSSGDSSSYN
Giraffa camelopardalis tippelskirchi V1075 trav LVKQ01752994.1 490 GTDGDSVKQTEAQVTVTEGARMTLNCTYQTTYSTPYLFWYIQHLNKAPQLLLQGLTADKEVENQGFRATPVKSESSFHLLKPAVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V1076 trgv LVKQ01753181.1 647 IQQELRLGQRSVMVGHAGGSMTVSCRVTRSVDYVHWFRQLEGQAPERLLYVALSKRDVQWDSVLKGDKVNAARGGDGKSCTMSLMKLAKSDEGLYYCAAWEL
Giraffa camelopardalis tippelskirchi V1077 trdv LVKQ01758114.1 971 SSVAQRVTQDQPDISSQVGEVVTLSCRHKTTLSSYNIFWYKQLPSREMIYLIRQGSSSQNARHGRYSINFQRSHKSISLTISDLQLEDSAKYFCALWE
Giraffa camelopardalis tippelskirchi V1079 trav LVKQ01764929.1 1500 SIIAQKVTQDPQPMLVQEKEAATLDCKYDTSDSRYSLFWYKQSSNGGMILLIRQDSYNQQNATEGRYSLNFQRARKSITLVISTSQLEDSAVYFCALSE
Giraffa camelopardalis tippelskirchi V1084 trgv LVKQ01769078.1 2355 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD
Giraffa camelopardalis tippelskirchi V1087 trbv LVKQ01709389.1 357 AVHAGVTQDPRFQVMRTGQSSTLKCTQDMNHDYMYWYRQDLGRGLRLIYYSDGPPNTKKGDVPDGYRVSRSSTKDFPLTLESANRSQTSVYFCASNY
Giraffa camelopardalis tippelskirchi V1088 trbv LVKQ01740589.1 571 FMDADVYQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYRVNTTEKGERSSRSTVSRISKESFPLTLETASSSQTSSYFCASSD
Giraffa camelopardalis tippelskirchi V1089 trdv LVKQ01745144.1 710 SGVAQTVTQDQPYITSQIGQSVILNCRYTVSWSGYTYYLFWYKQLPSGEMIFLLRQESSGPNARSDRYSVNFQKAQNSISLTISALQLEDSAKYFCAVRE
Giraffa camelopardalis tippelskirchi V1090 iglv LVKQ01748784.1 424 TWAQAVLTQPSSLSGSPGQSVSITCSGSSSDIGSSNSYVAWYQQIPGSAPKTLIYGTTSRASGVPDRFSGSKSGNTATLTISSLQAEDEADYYCSSGDSSSYN
Giraffa camelopardalis tippelskirchi V1092 trav LVKQ01752994.1 490 GTDGDSVKQTEAQVTVTEGARMTLNCTYQTTYSTPYLFWYIQHLNKAPQLLLQGLTADKEVENQGFRATPVKSESSFHLLKPAVQTSDSAVYYCALS
Giraffa camelopardalis tippelskirchi V1093 trgv LVKQ01753181.1 647 IQQELRLGQRSVMVGHAGGSMTVSCRVTRSVDYVHWFRQLEGQAPERLLYVALSKRDVQWDSVLKGDKVNAARGGDGKSCTMSLMKLAKSDEGLYYCAAWEL
Giraffa camelopardalis tippelskirchi V1094 trdv LVKQ01758114.1 971 SSVAQRVTQDQPDISSQVGEVVTLSCRHKTTLSSYNIFWYKQLPSREMIYLIRQGSSSQNARHGRYSINFQRSHKSISLTISDLQLEDSAKYFCALWE
Giraffa camelopardalis tippelskirchi V1096 trav LVKQ01764929.1 1500 SIIAQKVTQDPQPMLVQEKEAATLDCKYDTSDSRYSLFWYKQSSNGGMILLIRQDSYNQQNATEGRYSLNFQRARKSITLVISTSQLEDSAVYFCALSE
Giraffa camelopardalis tippelskirchi V1101 trgv LVKQ01769078.1 2355 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD