WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Dicentrarchus labrax CABK00000000.1 (CABK01) 22 3 0 1 5 13 0 0
Dicentrarchus labrax CBXY000000000.1 (CBXY01) 277 122 0 53 35 57 7 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Dicentrarchus labrax Vs41 trav CABK01033841.1 1165 NTLEDDITANRPEVFSSEGRSVTLSCSYSVKANNLQWYRQDPGSAPQFLLLITDTTEPSVVKAQPPNPRLTPKLNEERNQVDLEISSAAVTDSAVYYCALQ
Dicentrarchus labrax Vs40 trbv CABK01030199.1 304 LSLCKEVLQVPPAILGHLCDPATISCSHSISSYDTIVWYQQSMGDSELKLIGYVFYSSLTIENLFSNSFKLSGDGSKKAELHILKLRHPEDSGTYFCVA
Dicentrarchus labrax Vs27 ighv CABK01032074.1 215 AQGQSLTSSEPVVSRAGEPVTLSCKVEGLTLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNLVSLEVRSLKQEDSAVYYCARE
Dicentrarchus labrax Vs26 trbv CABK01026066.1 1388 ILPNESKDVHQTPADLLREINNKVKLTCKHTIKSYDTILWYQRSPGNPSLKLVGFTSYTSIQTVENSFQGSFKVSGDGEKEAFLHMLKLRHPENTGDYFCAASR
Dicentrarchus labrax Vs25 trbv CABK01025207.1 566 GSSLSDQVHQTPADIYNTPGQIAKIECFHTNPSFNQILWYKQTDGQLQFLGYLYNNNGNPETGVKVKIAGSANKDQTCTLTIEELQLNLSAVYFCAAR
Dicentrarchus labrax Vs23 trbv CABK01022076.1 1479 SSVGVKVHQPTLGFSREGDLAVTLQCEQDDEQYFYMYWYRQSSSGDMQLVSYSLSKGSARVEAPFNTTKFTMSRPTLLNSSLQIHSVKAADSAVYYCASSR
Dicentrarchus labrax Vs22 trbv CABK01022076.1 607 LTVVVLQSGNQISHSGVKVAMKCSMGQGLDMASYTMLWYRQNHRGAAMEFLVKEYDETVGHFQLSIDTSKNSFSLEITELFPNDSSTYYCAA
Dicentrarchus labrax Vs21 trbv CABK01021400.1 2483 LIGGSDVTQNETLWKYKGNSATIDCTHTKGPSYYYMYWYRQLPGETMKLIVFTSINSKDFGNFSTVKFSATKPDAASGTFTVNNLEPEDKGLYFCAVS
Dicentrarchus labrax Vs20 trbv CABK01021400.1 1564 GSSLSEQVYQTPADMYNTPGGKAKINCSHSIQSYNQILWYKQTDGQLQFLGYMYINNGNPENGVNVNIEGSANKDQTCTLTIEELQLNSSAVYFCAAS
Dicentrarchus labrax Vs0 trbv CABK01003495.1 22 VSPSVLITQWPQYISSLPNGSAEMHCYQNNTDYQYVYWYRQLRGRGFQLIVSVIASNANYEEGFKSGFQAVRSKEKQSSLTITNVQTKDEAVYLCAAS
Dicentrarchus labrax Vs1 trbv CABK01003495.1 1026 RAKSVTFQPSLPRIVKDKARVEITCSHNDNNLYVMLWYQQKERGLMSLIGFSYFGSEPNYEKQFKARFEITRKDIQTGSLIIQSVNLSDTAVYYCAAS
Dicentrarchus labrax Vs2 trbv CABK01003495.1 1643 RGRAKSVTFQPSPPKVVNEKTRVDFKCSHNDSDLNVMLWYQQTESGLMNLIGYSYINSEPDYEKQFKDQFEITRKDIQTGGLIIQSVNLSDSAVYYCAGS
Dicentrarchus labrax Vs5 trbv CABK01006647.1 1103 GSSLSDQVHQTPADIYNISGQIAKIECFHTNPSFNRVLWYKQTNGQLQFLGYMLANTGNPENGVKVKIEGGANKDQTCTLIIEELQLNSSAVYFCAAS
Dicentrarchus labrax Vs34 trav CABK01017642.1 2634 WISVSGSESQTVEVQPGEDVTLLCSDISTSPTQVDWFRVTNRAKPSCISSMYGSDKDASFCDGFQNGKFKMSSNVSTVFLQIKGVDLSDSGMYFCGLYI
Dicentrarchus labrax Vs13 ighv CABK01016822.1 56 AQGQSLTSSEAVVSRAGEPVTLSCKVEGLTLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNLVSLEVRSLKQEDSAVYYCARE
Dicentrarchus labrax Vs36 trbv CABK01022579.1 2678 EAKSVTLQHSQPKVVSVGGRAEIKCSNDDDRLHVMLWYQRRQNGPMGLMGYSYDVNRADYEEQFNDHIEIVRESKLSGALIIHSVNLSDSAVYFCATSAMIW
Dicentrarchus labrax Vs37 trbv CABK01022579.1 1518 FSCCLKIHQPPAAFSHEGDTSVTLQCEQDNEEYLYMYWYRHTGRGGMQLLTYSINKEIWTTEAPFNTSKYTMARPVVLSSALHIQHVEAADSAVYYCASRF
Dicentrarchus labrax Vs33 igkv CABK01015548.1 2293 LKIPASVHQSASETIQPGGSVTLNCTVHTGTCDGEHSVYWFKTSEESHPGLIYTHGGSNDQCEREPDTQTHTCVYNLPMQSLNLSHAGTYYCAVASC
Dicentrarchus labrax Vs19 trav CABK01018463.1 1480 WISVSGSESQTVEVQPGEDVTLLCSIISTSPTQTDWFRVTNITKPSCISSMYGSDREASFCDGFQNGKFKMSSNVSTVFLQIKRVNFSDSGLYFCGFYID
Dicentrarchus labrax Vs38 trav CABK01025865.1 776 CKGEDRVTQSPGDVIATEGETVTLGCTFETSYPNPTLFWYKQDGNNSPKFILSRIQRDEGDTAEKFKERFSSTLNSTLKSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax Vs12 trav CABK01016284.1 494 WISVSGSESQTVEVQPGEDVTLLCSNISTRPTQTDWFRVTNRAKPSCISSMYGSDSEASFCDGFQNGTFKMSSNVSTVFLQIKQVNFSDSGLYFCGFYIN
Dicentrarchus labrax Vs14 ighv CABK01016822.1 1995 VDGQTLTESEPMVKRPGESHTLTCTASGFSLGSYHMAWVRQAPGKGLEWIAWNDNGGSSKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V17 ighv CBXY010019225.1 7302 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSSYMAWVRQAPGKGLEWIAWIDSGSGSSKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V16 ighv CBXY010019225.1 6208 VNSIDLIQSDSVVVQPEQSFTITCQVSGYSLTDNTYATGWIRQCEGKSMQWILLRWGRGYFFQNSALKNKFLYNTNISNSSVTLTGQNVQPEDTAVYYCVRW
Dicentrarchus labrax V15 ighv CBXY010019127.1 1287 VKCEQLTQPASVTVQPGQRLNITCQVSYTAWIRQPAGKGLEWIGIRAGSTIYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCAGG
Dicentrarchus labrax V14 igkv CBXY010018729.1 2417 IVLTQTPAVHTVSTGQEVVLNCNIERDDGIAVRWYKQVPGGTPQYVVSFLGKDGSIIFGTGFSSTRFNSKASSNIDYQFIIKRAETGDSAVYYCLTWDSSANEEV
Dicentrarchus labrax V13 ighv CBXY010018575.1 24 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMNWVRQAPGKGLEWVAWVENDNNRKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V12 trav CBXY010016394.1 52960 GCVGIEVHQTPPALIQRPGDQVQLICTHQQTDSRVMLWYQQPPGQTDIKLIGLLNYKDVRMEKPYEQQFNISGDLSQNDAKNVSLMFMLTGAEDSAVYYCAARY
Dicentrarchus labrax V11 igkv CBXY010012279.1 531 SRGQVTVTQPGAVSSAVGGSVTISCRSSPAVHYDGSDYILAWYQQKERETPKLLIYWANRRASGIASRFSGSGSRTDFTLTISGVQAEDTAVYYCQSYHEINSQFV
Dicentrarchus labrax V10 trav CBXY010002116.1 9266 SSVGVKVHQPTLGFSREGDLAVTLQCEQDDEQYFYMYWYRQSSSGDMQLVSYSLSKGSARVEAPFNTTKFTMSRPTLLNSSLQIHSVKAADSAVYYCASSR
Dicentrarchus labrax V9 trav CBXY010002116.1 8400 VVLQSGNQISHSGVKVAMKCSMGQGLDMASYTMLWYRQNHRGAAMEFLVKEYDETVGHFQSSIDTSKNSFSLEITELFPNDSSTYYCAA
Dicentrarchus labrax V8 trav CBXY010002116.1 6574 ESVTFEQSSAQVVKDGTKEVTIDCSHDDSILQTMLWYQHKPGSGSMSLIGYSVLVGEPNYEVQFKDRFQIKSGMQKGSLIIPTVNLSDSAVYFCAASTQ
Dicentrarchus labrax V7 trav CBXY010002116.1 4104 RAKSVTFQQSPLQIVTKNTEVDFKCSHNDSSLTVMLWYQQTESGLMNLIGYVYSSDPTYEKQFEDRFKITKTGTQAGGLTIQSVNLSDSAVYYCAASTQ
Dicentrarchus labrax V6 trav CBXY010002115.1 3003 ESVTFEQSSAQVVKDGTKEVTIKCSHDDSNLQYMLWYQHKPGSGSMSLIGYSVLNGEPNYEVQFKDRFQIKSGTQKGSLIIPTANLSDSAVYFCAASTQ
Dicentrarchus labrax V5 trbv CBXY010002113.1 1608 SSLSEKVHQTPADMFSNQGEIAKIQCSHSIEGYDRILWYKQITDGQLQLLGYMNVNTGYPETGVNVKIDGNANKDQTCTLTTERLNSSAVYFCAAS
Dicentrarchus labrax V4 trdv CBXY010002112.1 2178 KSVTFQQSPPKIVNEKTRVDFKCSHDDNNLDVMLWYQQTESGLMNLIGYSYINNEPTYEKEFKDRFEITRKDIQTGALIIQSVNLSDMAVYYCAGSTQ
Dicentrarchus labrax V3 trbv CBXY010002112.1 537 VSPSVLITQWPQYISSLPNGSAEMHCYQNNTDYQYVYWYRQLRGRGFQLIVSAIASNANYEEGFKSGFQAVRSKEKQSSLTITNVQTKDEAVYLCAAS
Dicentrarchus labrax V2 igkv CBXY010002017.1 886 CSGRVTVTQPPVKTFTPGSTVSISCKISEPVYICGGVDICIFWYQQKSGQPPKLLINHRSRRYSGTPARFSGSGSSSDFTLTISGVQTEDAAVYYCIS
Dicentrarchus labrax V1 igkv CBXY010002014.1 1742 CSGQVTVTQPPVVTSTPGSTVTISCKTNQAVVPYCGGDCMHWYQQKSGQPPKLLIQTVSTRYSGTPARFSGSGSSSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V0 trgv CBXY010002012.1 610 SSSQLTVSQPAVVTSSIEPTVTLTCQTNPKVKTWSDGTNRLHWYQQKSGQAPKLVMKNGKNPTSEFSSRFSGRADGENSNLTISGVQTADAAIYYCKRYDEINSAWV
Dicentrarchus labrax V55 trav CBXY010026521.1 557 ESVTFEQSSAHVVKDGTKEVTIDCSHDDSSLGVMLWYQHKPGSGSMSLIGYSVLNGEPNYEVQFKDRFQIKSGTQKGSLIIPTVNLSDSAVYFCAASTQ
Dicentrarchus labrax V54 ighv CBXY010025993.1 613 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYRTAWIRQPAGKGLEWIGIAGDGWSTYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V53 ighv CBXY010025919.1 899 VKCEQLTQPASMTVQPGQRLTITCQVSYSLSSYYTAWIRQPAGKGLEWIGSKYTGDSFYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V52 ighv CBXY010025704.1 3636 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSDYWMHWIRQAPGKGLEWVACTYDSSNIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V51 ighv CBXY010025704.1 1333 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYYTAWIRQPAGKGLEWIGIKYTGDSFYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V50 ighv CBXY010025704.1 215 AQGQSLTSSEPVVSRAGEPVTLSCKVEGLTLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNLVSLEVRSLKQEDSAVYYCARE
Dicentrarchus labrax V49 ighv CBXY010025617.1 16 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYFTAWIRQPAGKGLEWIGMVVVVSTAYYKDSLKNKFSITLDSSSNTVTLNGQNVQPEDSAVYYC
Dicentrarchus labrax V48 igkv CBXY010025066.1 3507 SSGQITLTQSPGSQSVVPGQTVSIRCTASSDISNSFLYWYLQKPGEVPNLLIYATSTRQSGVSSRFSGSGSGSDYTLTISGVQAEDSGVYYCQQ
Dicentrarchus labrax V47 igkv CBXY010025066.1 598 SRGQVTVTQPGAVSSAVGGSVSISCKHSQRVTVARNKTKDVLAWYQQKGVETPKLLIYLADQRATGTPSRFSGSGSQTDFTLTISGVQAEDAAIYYCKG
Dicentrarchus labrax V46 igkv CBXY010025065.1 531 SRGQVTVTQPGAVSSAVGGSVTISCRSSPAVHYDGSDYILAWYQQKERETPKLLIYWANRRASGIASRFSGSGSRTDFTLTISGVQAEDTAVYYCQSYHYINSQYV
Dicentrarchus labrax V45 igkv CBXY010025002.1 1003 QRGQVTVTQSGAVSSALGHSVTITCRTSQNVYTYGGNHYLAWYQQRDGETPKLLIYAASTRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQSFHVINSQYV
Dicentrarchus labrax V44 ighv CBXY010024948.1 2538 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMNWVRQTPGKGLEWIAFINTVSGSIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Dicentrarchus labrax V43 ighv CBXY010024948.1 157 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGIRAGSTIYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCAGG
Dicentrarchus labrax V42 igkv CBXY010024947.1 748 SSGEIILTQSPKAQSVVPGQTVSVRCKASSSAGTCLNWYLQKPGESPKLLIYYSTSRQSGVSGRFSGSGSGTDFTLTISGVQSEDAGDYYCQQCNSWP
Dicentrarchus labrax V41 ighv CBXY010024924.1 1373 IDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYWMHWIRQAPGKGLEWIALIYTDSSNKFYSQSVQGQFTISRDNSRQQVYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V40 ighv CBXY010024322.1 433 QSMESIPSSSVVKKPGETVSLSCRGSGFTFSCCVMSWIRQPAGKGLEWIGSGYSSASSNTYASSVRGRAEISRDDSNSMVYLRLSNLKPEDSAVYYCARD
Dicentrarchus labrax V39 igkv CBXY010024236.1 3558 IVLTQTPAVHTVSTGQEVVLNCNIERYDGNYVRWYKQVPGGTPQYVLRFRAGGSLSFGTGFSSDRFNSKASSNIDYQFIIKRAETGDSAVYYCQTWDDSDDAAV
Dicentrarchus labrax V38 ighv CBXY010024052.1 2932 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGRAGVGYTTHYKDSLKNKFSIDLDSSSKTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V37 igkv CBXY010024013.1 1218 QITLTQSPGSQSVVPGQTVSIRCKTSSSVGSNLHWYLQKPGEAPKLLIYLASNRQSGVSSRFSGSGSGSDYTLTISGVQAEDSGVYYCQQGYSFP
Dicentrarchus labrax V36 ighv CBXY010023984.1 968 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSSYMAWVRQAPGKGLEWIAYISTASTPIYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR
Dicentrarchus labrax V35 ighv CBXY010023803.1 4566 VDGQTLTESEPVVKRPGESHRLTCIASGFTFSSSYMAWVRQAPGKGLEWIAFIYTGSSYITYSQSVQGRFIISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Dicentrarchus labrax V34 ighv CBXY010023803.1 1181 VDGQTLTESEPVVKRPGESHRLTCTTSGLSFSSYWMAWIRQAPGKGLEWVATDGGGSSKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V33 ighv CBXY010023802.1 1690 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYWMHWVRQAPGKGLEWIATEAGSSGKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V32 ighv CBXY010023692.1 157 IDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYWMHWIRQAPGKGLEWIALIYTDSSNKFYSQSVQGQFTISRDNSRQQVYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V31 igkv CBXY010023475.1 4201 SSGQITLTQSPGSQSVVPGQTVSIRCKTSSSVGSNLHWYLQKPGEAPKLLIYLASNRQSGVSSRFSGSGSGSDYTLTISGVQAEDSGVYYCQQSYSFP
Dicentrarchus labrax V30 igkv CBXY010023475.1 2036 SRGQVTVTQPGAVSSAVGGSVSISCRSSHQVDEDCGSSDPCLSWYQKKNGQTPKLLLYLANQRESGIPTRFSGSGSGTDFTLTISGVQAEDAAVYYCMGG
Dicentrarchus labrax V28 trbv CBXY010023370.1 625 SSLNELVYQNPAHTFNKPEGAAKIECSHSIQNYNTILWYKKSKNRQLQLLGYMVGGSGYPETGVKVKIAGSANKDQNCTLTIEELQLNSSAVYFCAARLHSAT
Dicentrarchus labrax V27 ighv CBXY010022218.1 3179 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMNWVRQAPGKGLEWVAWVENDNNRKHYSQSVQGRFTISKDNSRQQVYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V26 ighv CBXY010022218.1 587 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKELEWIGMKFTGASYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCAR
Dicentrarchus labrax V25 igkv CBXY010022201.1 598 SRGQVTVTQPGAVSSAVGGSVSISCKHSQRVTVARNKTKDVLAWYQQKGVETPKLLIYLADQRATGTPSRFSGSGSQTDFTLTISGVQAEDAAIYYCKG
Dicentrarchus labrax V24 ighv CBXY010021761.1 2113 VWSEIKLDQTPSEVKRPGETVKMSCITSGYSMTSNAINWIRQRPGKALEWIGYINTNTNTPSYASSFQSRFSFTQDVPSSTQYLQINSLTAEDSAVYFCAR
Dicentrarchus labrax V23 igkv CBXY010021745.1 950 SDANPSVTQSPVSKSVGVGQTVSLSCTASTGVDDDLSWYLQKPGQPTKLLFYKISSRQSGTPSRFSSSGSEPEFTLTISGVQTEDAGDYYCMGAYYGPV
Dicentrarchus labrax V22 igkv CBXY010020943.1 1570 SSGEIILTQSPKAQSVVPGQTVSVRCKASSSVGNFLNWYLQKPGESPKLLIYHSSSRQSGVSGRFSGSGSGSDYTLTISGVQTEDAGDYYCQQCNSWP
Dicentrarchus labrax V21 ighv CBXY010020589.1 4758 VWSEIKLDQTPSEVKRPGETVKMSCITSGYSMTSYAIHWIRQRPGKALEWIGWINTNTNTPSYASSFQSRFSFTQDVPSSTQYLQINSLTAEDSAVYFCARR
Dicentrarchus labrax V20 ighv CBXY010020589.1 3572 VNSIDLIQSDSMVVQLGQSFTITCQVSGYSLTDNSYATGWIRQCEGKPMDWISHQWGGGDFYQNNALKNKFSYSRDTSARTVTLTGQNVQPEDTAVYYCARL
Dicentrarchus labrax V19 ighv CBXY010020589.1 740 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRVGSTTYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V93 ighv CBXY010034119.1 2699 VDGQTLTESEPVVKRPGESHILTCTASGFTFSDYWMNWIRQAPGKGLEWIAIIKYDSADIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V92 trav CBXY010033991.1 1327 QRDNVLQPKGDVTATEGEEVTLDCQYNSSSTTYYLFWYKQDGNNSPKFILSCYKGDEGDIADEFKKRFSSTLDSTSRSVPLKIQKLQLSDSAVYYCALQPTVTG
Dicentrarchus labrax V91 trbv CBXY010033901.1 399 SSLSDSVFQTPPFIIKRVGESVVSGIKCSHTITSYQVILWYKQDERKPLQFLGYLNVNFPYPEEDVKEKISFDGNGQKYSNLNISSVSLNDSGVYFCAASRHSASDS
Dicentrarchus labrax V90 trbv CBXY010033599.1 640 VSKTSVHQTPTAMIKDAGEDILMNCNHSNTDFNMIQWYKQSAGEYDMALIGYVQFTSAVVEDKFKDSYDVSGHGSSLAHLHIPKSRSENSAVYFCAASRAQC
Dicentrarchus labrax V89 igkv CBXY010033575.1 160 SRGQYTVTQSGAVSSALGGSVTITCRTNPKVYTWSSYHALAWYQQRDGETPKLLIDRATYRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V88 igkv CBXY010033486.1 6371 SSGEIILTQSPKAQSVVPGQTVSVRCKASSSVGNFLNWYLQKPGESPKLLIYHSSSRQSGVSGRFSGSGSGSDYTLTISGVQTEDAGDYYCQQCNSWP
Dicentrarchus labrax V87 igkv CBXY010033486.1 3531 SSGEIILTQSPKAQSVVPGQTVSIRCNVSPGVRLCFNWYLQKSGEVPKLLINCATSRQSGVSERFIGTGSSPWTDFTLTISGVQTEDAAVYYCQSAHDINSQYV
Dicentrarchus labrax V86 ighv CBXY010032976.1 747 VDGQTLTESEPVVKRPGESHILTCTASGFTFSDYWMNWIRQAPGKGLEWIAIIKYDSADIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V85 trbv CBXY010032866.1 1766 SSLSEKVHQTPADMYNTPGGKAKINCSHEIDTYNRILWYKQTDGQLHFLGYMLGDSGKPENGVKVKIAGSANKGQTCTLTIEELQLNSSAVYFCAAS
Dicentrarchus labrax V84 trbv CBXY010032739.1 2409 VCLGVEVHQTPPALLRRPGDKVQLVCSHGKTDYSLMYWYQKSPGDQTLKRIGHVYYSTIDLEESLKEHFNISGDLSGETAKNSSLFIVNLKAPEHSAVYYCAASY
Dicentrarchus labrax V83 trbv CBXY010032739.1 437 SSLSDQVHQTPADVYNKAGETAKIRCSHSIQDYTRIYWYKQSKNGQMQLLGYMNVNDGYPEDGVNVKMEGGALKDQTCTLIIEELQLNSSAVYFCAASSHSAT
Dicentrarchus labrax V82 igkv CBXY010032355.1 1269 SSGEIILTQSPKAQSVVPGQTVSVRCKASSSAGTCLNWYLQKPGESPKLLIYHSSSRQSGVSGRFSGSGSGTDFTLTISGVQTEDAGDYYCQQCSSFP
Dicentrarchus labrax V80 ighv CBXY010032112.1 1039 VDGQTLTESEPMVKRPGESHTLTCTASGFSLGSYHMAWVRQAPGKGLEWIAWNDNGGSSKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V79 trbv CBXY010031883.1 1102 SSLSDQVHQTPADIYNISGQIAKIECFHTNPSFNQILWYKKSKRQLELLGYMYVNDPYPETGVNVKIAGSANKDQTCTFTIEELQLNSSAVYFCAAR
Dicentrarchus labrax V78 trav CBXY010031337.1 503 NTLEDDITASRAEVFSSEGHSVTLSCSYSVKAENLQWYRQDPGSAPQYLLLITDTTEPSVLKAQPPNPRLTPKLNKERNRVDLEISSAAVTDSAVYYCALQ
Dicentrarchus labrax V77 igkv CBXY010030556.1 3531 KVLTQTPAVHTVSTGQEVVLNCNIERDENYYVRWYKQVPGGTPQYVLRFYHSSSSPSFGTGFSSDRFNSKASSNIDYQFIIKRAETGDSVVYYCETWDNSAKDYV
Dicentrarchus labrax V76 igkv CBXY010030556.1 349 IVLTQTPAVHTVSTGQEVVLNCNIERYDGNYVSWYKQVPGGTPQHVLRFHYSGSSLSFGTGFSSDRFNSKASSNIDYQFIIKRAETGDSAVYYCQTWDDSDDAAV
Dicentrarchus labrax V75 igkv CBXY010030555.1 925 IVLTQTPAVHTVSTGQEVVLNCNIERYDGYYVSWYKQVPGGAPQYVLRFHYSGSSPSFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCLTWDNSAKDYV
Dicentrarchus labrax V74 igkv CBXY010030249.1 2182 SSGQITLTQSPGSQSVVPGQTVSIRCKTSSSVSGWLHWYLHKPGEAPNLLIYTATTRQSGVSSRFSGSGSGSDYTLTISGVQAEDSGVYYCQQSNSFP
Dicentrarchus labrax V73 trav CBXY010030104.1 532 CKGEDSVTQPPGDVIATEGETVTLGCTFEASVSTTAYLFWYKQEVNDFPVYILRRDTFGTEDNAADFPKERFNAAINKPSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V72 ighv CBXY010029918.1 1179 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYNMYWIRQAPGKGLEWIAFISTGSGSIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V71 trbv CBXY010029525.1 1291 LSKTSVHQTPTAMIKDAGEDILMNCSHSNTDFNMIQWYKQSAGENDMALIGYVRFTSAVVEDKFKDSYNVSGHGSSLAHLHIPKSRSENSAVYFCAASRAQC
Dicentrarchus labrax V70 ighv CBXY010029334.1 2234 VNSIDLIQPDSMVVQPGQSFTITCQVSGYSLTDNNYATGWIRQCEGKPMDWIFHQWGGGSFYQNNALKNKFSYSRDTSARTVTLTGQNVQPEDTAVYYCVRR
Dicentrarchus labrax V69 ighv CBXY010028847.1 2693 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYGMHWVRQAPGKGLEWVAWIYTDSSGKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V68 trbv CBXY010028786.1 2267 SSLSEKVHQTPADMCTNQGEIAKINCSHEIDNYNRIFWYKQTDGQLQFLGYMYNNNGNPENGVNVNIEGDANKGQTCTLIIEELQLNSSAVYFCAAS
Dicentrarchus labrax V67 ighv CBXY010028292.1 4399 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSHWMHWVRQAPGKRLEWIAAADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V66 trav CBXY010028217.1 191 QRDNVLQPKGDVTATEGEEVTLDCQYNSSSSNDYLFWYKQDGNNSPKFILSRFKIGTGKTEDVFRERFSSTLDSTSRSVPLKIQKLQLSDSAVYYCALRPTVTG
Dicentrarchus labrax V65 trbv CBXY010028045.1 2087 LIDGSDVTQTPLLWKLKDQSATMNCSHNKDATYFQMYWYRQLPGEGMKQIVLTTTTPPHKYESGFSEDKFPAQKNDPQTGSLTVEKLLPEDSGVYFCAVS
Dicentrarchus labrax V64 trbv CBXY010028045.1 1130 SSLSDQVHQTPADIYNTPGQIAKIECSQTNPSFNQILWYKKSKNRQLQLLGYMVGGSGSPEKGVNVKIAGNANKDQNCTLTIEELQLNSSAVYFCAASSHSAT
Dicentrarchus labrax V63 ighv CBXY010027718.1 2056 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSHWMHWVRQAPGKRLEWIAAADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V62 ighv CBXY010027718.1 818 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYPMNWVRQAPGKGLEWIAFIHTGSSHIFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR
Dicentrarchus labrax V61 ighv CBXY010027027.1 746 VKCEQLTQPSSVTVQPGQRLTITCQVSYSLSSYGTHWIRQPAGKGLVWIGGACVGCTTYYKDSLKNKFSITLDSSSNTVTLNGQNVQPEDSAVYYCARD
Dicentrarchus labrax V60 trbv CBXY010026839.1 2841 LSKTSVHQTPTAMIKDAGEDILMNCNHSNTDFNMIQWYKQSAGENDMALIGYVRFTSAVVEDKFKDSYNVSGHGSSLAHLHIPKSRSENSAVYFCAASRAQC
Dicentrarchus labrax V59 trbv CBXY010026839.1 2097 CSLSTKVHQAPSSILGSPNGSPEISCNHSISSYNQILWYQQPMGDSDLKLIGYIYFDNPTIEDKFQKHFNITGHGSTNSQLHVQKLRDPEDSATYFCAAS
Dicentrarchus labrax V58 trbv CBXY010026839.1 507 LIDGSDVTQTPLLWKLKDQSATMNCSHNKDITYFQMYWYRQLPGEGMKQIVFTTTTPPHEYESGFSEDKFPAQKNNPQTGSLTVEKLLPEDSGVYFCAVS
Dicentrarchus labrax V57 trbv CBXY010026838.1 507 LIDGSDVTQTPLLWKVKDQSATMNCSHNKDATYFQMYWYRQLPGEGMKQIVFTTTTPPHKYESGFSEDKFPAQKNDPQTGSLTVKKLLPEDSGVYFCAVS
Dicentrarchus labrax V131 ighv CBXY010021840.1 105 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMKFTGASYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCAR
Dicentrarchus labrax V130 ighv CBXY010021840.1 1292 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYNMYWVRQAPGKELEWIAFISSGSGSIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V129 trav CBXY010021312.1 3840 LGSMNIIKPDSTEEHVAEGRNINLTCKYDGVISNIQWYRQYQRSRPEFLLYITEGGLIHPMDSDFKAHINKTEKRVHLEIISAKVTDSAVYYCALQPTVTG
Dicentrarchus labrax V128 trav CBXY010021311.1 2008 NTLEDDITANRPEVFSSEGRSVTLSCSYSVKANNLQWYRQDPGSAPQFLLLITDTTEPSVVKAQPPNPRLTPKLNEERNQVDLEISSAAVTDSAVYYCALQ
Dicentrarchus labrax V127 ighv CBXY010021044.1 1041 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSHWMHWVRQAPGKRLEWIAAADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V126 igkv CBXY010020495.1 2718 SSGEIILTQSPKAQSVVPGQTVSIRCKASSSMGSYLHWYLQKPGESPKLLIRYATTRQSGVSNRFSGSGSGTDFTLTISTVQNEDAGVYYCLQSGYSFP
Dicentrarchus labrax V125 ighv CBXY010019701.1 596 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYWMNWVRQAPGKGLEWIAIIKYDSADIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V124 ighv CBXY010019701.1 1911 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSDYYTAWIRQPAGKGLEWIGGARVGYTTDYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V123 igkv CBXY010019546.1 543 SRGQYTVTQSGAVSSALGRSVTITCRTSHRVDDGEDLSWYQQRDGETPKLLIYTTNRRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCMGEFWVSGNLL
Dicentrarchus labrax V122 ighv CBXY010019508.1 89 VNSIDLIQSDSMVVQPGQSFTITCQVSGYSLTDSSYSTGWIRQCEGKPIDWISHMWGGGSLTQNNALKNKFSYSRDTSARTVTVTGQNVQPEDTAVYYCARQ
Dicentrarchus labrax V121 igkv CBXY010019407.1 196 SRGQVTVTQPGAVSSAVGGSVSISCKHSQRVTVARNKTKDVLAWYQQKGVETPKLLIYLADQRATGTPSRFSGSGSQTDFTLTISGVQAEDAAIYYCKG
Dicentrarchus labrax V120 trbv CBXY010019247.1 592 LIDGSDVTQTDILWKNESDSATIECSHTKGFQYYQMYWYRQLPGETMKLIVFTTTTPPHRYESGFSEDKFPAQKNDPQTGSLTVEKLLPEDSGVYFCAVS
Dicentrarchus labrax V119 trav CBXY010018540.1 417 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMNWIRQAPGKGLEWIATADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYHCARD
Dicentrarchus labrax V118 ighv CBXY010018539.1 209 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYRTHWIRQPAGKGLEWIGGACVGCTTYYKDSLKNKFSITLDSSSNTVTLNGQNVQPEDSAVYYCARD
Dicentrarchus labrax V117 trav CBXY010018471.1 1405 RVTQSPGDVIATEGETVTLGCTFETSYPNPTLFWYKQDGNNSPKFILSRIQRDEGDTAEKFKERFSSTLNSTLKSVPLKIQKLQLSDSAVYYCALQPTVTG
Dicentrarchus labrax V116 trav CBXY010018471.1 3179 SSEDLVKPFKDVMLALEGDTVTLSCKYSDSVDNLFWYQQKSSSPPQLLIMEYSEKIARLSLTHDKNSKEFHLQISSAAVTDSAVYYCAVR
Dicentrarchus labrax V115 ighv CBXY010018268.1 1730 VKCEQLTQPASVTVQPGQRLTITCQVSYPLGRYRTAWIRQPAGKGLEWIGIAGDGWSTYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V114 trbv CBXY010018106.1 3638 VDGQTLTESEPVVKRPGESHRLTCTASGLTFSSYYMHWIRQAPGKGLEWVAWIESGSGSSKLYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYFCARD
Dicentrarchus labrax V113 ighv CBXY010018106.1 5710 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYRTAWIRQPAGKGLEWIGRAAVGYTTYYKDSLKNKFSITLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V112 ighv CBXY010018106.1 6343 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYPMAWVRQAPGKGLEWIAWNDNGGSSKFYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V111 trbv CBXY010004917.1 116 LTDGSDVTQNETLWKYKGNSATIDCRHTKDAGYNQMYWYRQLPGETMKLIVFTSINSKDFGNFSTVKFSATKPDVASGTFTVNNLEPEDKGLYFCAVS
Dicentrarchus labrax V110 trbv CBXY010004916.1 32 RDVTQNDTLWKYKGNSATIDCRHTKDAEYFYMYWYRQLPGETMKLIVFTSISSKDFGNFSTEKFSATKPDAASGTFTVNNLEPEDKGMYFCAVS
Dicentrarchus labrax V109 ighv CBXY010002022.1 251 CSGRVTVTQPPVKTSTPGSTVTISCKTNQAVGKCSGIDCMFWYQQKSGQPPKPLIRHVSISHSGTPARFSGSGSSSDFTLTISGVQTEDAAVYYCESVHNGPV
Dicentrarchus labrax V108 igkv CBXY010002018.1 15174 CSGQVTVTQPPVKTSTPGSTVTISCKTNPPTYSNCNNVGECMFWYQQKSGQPPKLLIRHVSISHSGTPARFSGSGSSSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V107 ighv CBXY010037703.1 994 VDGQTLIESEPVVKRPGESHRLTCTASGFTFSSYYMHWIRQVPGKGLEWIAFIHTGSSHIYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR
Dicentrarchus labrax V106 igkv CBXY010037330.1 740 SSGWVALTQSPGTQSVVPGQTVSIRCKISTSISSNLHWYLQKPGEAPKLLIYSATTRHSGVSSRFSGSGSGSDFTLTISGVQAEDSGVYYCQQGAYTP
Dicentrarchus labrax V105 ighv CBXY010036598.1 191 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSDHSMHWVRQAPGKGLEWIAYIRYDSAEIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V104 ighv CBXY010036589.1 1692 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYYMNWIRQAPGKGLEWVALIYTDSSNTFYSQSVQGWFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V102 ighv CBXY010036394.1 1600 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYWMHWVRQAPGKGLEWVALIYTDSSGKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V101 ighv CBXY010036393.1 1912 VDGQTLTESEPVVKKPGESHRLTCTASGFTFSDYWMHWIRQAPGKGLEWVAGIYDSSNIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARQ
Dicentrarchus labrax V100 ighv CBXY010036393.1 914 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYYTHWIRQPAGKGLEWIGMKYTGDSYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V99 ighv CBXY010036282.1 600 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMNWVRQAPGKGLEWIAAMYDSSNIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V98 trav CBXY010036198.1 1731 RVTQPPGDVIATEGETVTLGCTFETSVSTNANLFWYKQEVNDFPKFILSRIQRDEGNTAEKFKERFSSAVNSTLRSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V97 ighv CBXY010035669.1 840 VDGQTLTESEPVVKMPGESHRLTCAASGFTFSSYHMNWVRQAPGKGLEWIAWVERDNDRKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V96 igkv CBXY010035597.1 1679 SVGQNVVVTQPAAKSVQPGQTVSIECKASRQVTQYSGSQYYLAWYHQKTGEAPKLLIYLTSSRQSGISSRFSGSGAGNGIDFTLTISGVQAEDTGVYYCQQTGSFP
Dicentrarchus labrax V95 igkv CBXY010034354.1 454 IVLTQTPAVHTVSTGQEVVLNCNIERYDRSYITWYKQVPGGTPQHVLRFHYSSSSISFGTGFSSDRFNSKASSNIDYQFIIKRAETGDSAVYYCDTWEYSAAAAV
Dicentrarchus labrax V169 ighv CBXY010026059.1 2173 VYGQTLTESEPVVKRPGESHRLTCTASGFTFSSYGMHWVRQAPGKGLEWVAWIYTDSSGKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDPAVYYCA
Dicentrarchus labrax V168 igkv CBXY010025957.1 194 SRGQVTVTQSGAVSSALGRSVSISCRSSQRVDEDCGSWGSDTCLSWYQQKAGETPKLLIYYTNERASGIPTRFSGSGSGTDFTLTISGVQAEDAAVYYCQSA
Dicentrarchus labrax V167 trbv CBXY010025922.1 3056 ASLSDSVFQTPPFIIKRVGESVVSGIKCSHTITSYDLILWYKQDESKTLQLLGYLNLNFPYPEDDVKGKISFDGNGQKYSNLNISSLSLNDSGVYFCAASRHSASDS
Dicentrarchus labrax V166 trav CBXY010025719.1 1419 LGSMNIIKPDSTEEHVAEGRNINLTCKYDGAIYNVQWYRQYQRSRPEFLLSITEGGSIHPTDSDFKAHINKTEKRVHLEIISAKVTDSAVYYCALR
Dicentrarchus labrax V165 igkv CBXY010025624.1 2155 QITLTQSPGSQSVVPGQTVSIRCKTSSSVSSYLSWYLQKPGEVPNLLIYTATNRQSGVSSRFSGSGSGSDYTLTISGVQAEDSGVYYCQQGASFP
Dicentrarchus labrax V164 trdv CBXY010025387.1 446 LTPLKKQESSLEDSTVTLSYTYYKAASCDDYFFWYRQYPGKPPEFLIFHLGTQNETTSRLSVTVSEDKTQMDLQISSAAVTDSALYYCAVR
Dicentrarchus labrax V163 trbv CBXY010025025.1 1088 LIDGSDVTQNETLWKYKGKSATIDCRHTKGATYRQMYWYRQLPGETMKQIVFTSTTNPNHDFGNFSTEKFSATKPDAASGTFTVNNLEPEDKGLYFCAVS
Dicentrarchus labrax V162 trbv CBXY010025022.1 1542 LIDGSDVTQKETLWKYKGDRATLDCRHTKDANYRQMYWYRQLPGETMKLIVFTSTTSKDFGNFSTVKFSATKPDAASGTFTVKNLEPEDKGLYFCAVS
Dicentrarchus labrax V161 trbv CBXY010025022.1 2659 ASKTNSVLQTPSFIIKRTGESVASGINCSHSITDYYVILWYKQQQGALKLLGYLYIAAVNLEEDVKGKISFDGNGQKYSSLTISNLTLNDSDVYFCAAS
Dicentrarchus labrax V160 trbv CBXY010025021.1 538 ASKTNSVLQTPSFIIKRTGESVARGINCSHSITYYDNILWYKQQQGALKLLGYLNGKFLNLEDSVKGKISFDGEGNKHSSFTISDLTLNDSGVYFCAAS
Dicentrarchus labrax V159 trbv CBXY010025021.1 1696 LIGGSDVTQNETLWKYKGNSATIDCTHTKGPSYYYMYWYRQLPGETMKLIVFTSINSKDFGNFSTVKFSATKPDAASGTFTVNNLEPEDKGLYFCAVS
Dicentrarchus labrax V158 trbv CBXY010025021.1 2618 SSLSEQVYQTPADMYNTPGRKAEINCSHSIQSYYRILWYKQSNRELQFLGYMDYNTGNPEKGVNVNIEGSANKDQTCTLTIEELQLNSSAVYFCAAS
Dicentrarchus labrax V157 trav CBXY010024979.1 7930 LIHTAEVPQQISLTVVELGGITTFQCPASENQSKFFHWYRQSVGYMVQTVAAVILGKITFSEPFTDSRFTVTKVDTHYFLTIRNVTKEDEATYFCQNGSPY
Dicentrarchus labrax V156 igkv CBXY010024912.1 1934 SSGEIILTQSPKAQSVVPGQTVSIRCKASSSMGSYLHWYLQKPGESPKLLIHYATTRQSGVSNRFSGSGSGTDFTLTISTVQIEDAGVYYCLQSGYSYP
Dicentrarchus labrax V155 ighv CBXY010024809.1 1957 VWSEIKLDQTPSEVKRPGETVKMSCVISGFDMTSYYIHWIRQRPGKALEWIGRMNAGSNSASYSSSFQSRFIMTEDVPSSTQYLEVNSLTAEDSAVYFCARR
Dicentrarchus labrax V154 ighv CBXY010024809.1 3424 VKCEQLTQPASMTVQPGQRLTITCQVSYSLSSYYTAWIRQPAGKGLEWIGSKYTGYSFYKDSLKNKFSIDLDSSSNTVTVNGQNVQPEDSAVYYCARQ
Dicentrarchus labrax V153 igkv CBXY010024720.1 368 SSGEIILTQSPKAQSVVPGQTVSIRCNVSPSTSYCFNWYLQKPGESPKLLITCGSTRQSGVSDRFSGSGSGSDYTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V152 ighv CBXY010024283.1 433 VKCEQLTQPASVTVQPGQSLTITCQVSYSLSSCRTHWIRQSAGKGLVWIASAHVGWSTYYKDSLKNRFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V151 ighv CBXY010024283.1 1712 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMNWVRQAPGKGLEWIAAMYDSSYIYHSQSFKGRFTVSRDNSRQQVYLQMNSLKTEDSAVYYCARG
Dicentrarchus labrax V150 ighv CBXY010024270.1 586 VCSQTLTESEPVVKRPGESHKLTCTYAGISDDDAHIGWIRQAEGKGLEWVAYISAPSGGTKAYSTSVQNRFTISRDNNVDQVYLQMNSLTTEDSAVYYCARE
Dicentrarchus labrax V149 ighv CBXY010024049.1 998 VDGQTLTESEPVVKRPGESHTLTCTYSGFSSHIHNAWIRQAAGKGLEWIAAIYSDSSGKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V148 ighv CBXY010024024.1 1037 VWSEIKLDQTLSEVKRPGEKVKMSCIISGYSMTSYNIHWIRQRPGKALEWIGRMNTGSNSAIYGSSFQSRFIMTEDVPSSTQYLEVNSLTAEDSAVYFCARR
Dicentrarchus labrax V147 ighv CBXY010024024.1 4190 VNSIDLIQPDSMVVQPGQSLTITCQVSGYSLTDGNYATGWIRQCEGKPMDWISHQWGGSSGSFYQNNALKNKFSYSRDTPARTVTLTGQNVQPEDTAVYYCARQ
Dicentrarchus labrax V146 ighv CBXY010024023.1 274 LNGQALESIPSTSVLKKPQEALSLSCRGTGFDFSQSGMHWIRQPAGKALEWMGLIYYDASQTMYASSVQGRIEITRDNSNSMVYLRLSNLKPEDSAVYYCAG
Dicentrarchus labrax V145 ighv CBXY010024023.1 1426 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYRTAWIRQPAGKGLEWIGIAGDGWSTYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V144 igkv CBXY010023656.1 186 SSGQITLTQSPGTQSVVPGQTVSIRCKTSSSVSSYLHWYLQKPGEAPNLLIYSATTRQSGVSSRFSGSGSGSDFTLTISGVQAEDSGVYYCQQSYSFP
Dicentrarchus labrax V143 igkv CBXY010023655.1 523 SRGQVTVTQSGAVSSALGRSVTITCRTSPNVYFGGTYHYLAWYQQRDGEAPKLLIKYANQRLSGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V142 trav CBXY010023293.1 8164 SSEELVNPIEDEVLALEGETVILSCKYSGSVSVVYWYQQKSSSSPQLFIMEFSDKPGLLLKHYKDKNKFHLEISSAAVTDSAVYYCALQ
Dicentrarchus labrax V140 trgv CBXY010022841.1 570 GCLGLEVRQSTSDLIKQPGDKVQIFCSHDRTDYRMMLWYQRSPGDTAMKLIGYLYFKDVKMEEKYEVDFNITGDLGGNTAKNGSLIVKRVGPNHSAVYYCAARE
Dicentrarchus labrax V139 igkv CBXY010022689.1 1157 SRGQVTVTQSGAVSSALGGSVTITCKTSQDVSYNGHHILAWYQKKDGGTPKMLIYGARYQPSGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V138 trbv CBXY010022575.1 756 LIDGSDVTQNETLWKYKGDNATIDCRQTKGAGYNQMYWYRQLPGEAIKQIVYTVWGNTDHDFGNFSTEKFSATKPDFASGKFTVNNLEPKDKGLYFCAVS
Dicentrarchus labrax V137 ighv CBXY010022087.1 1789 VDGQTLTESEPVVKRPGESHRLTCTASGFNFAGYWMAWIRQAPGKGLEWIAAADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V136 ighv CBXY010022086.1 616 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYRMAWIRQASGKGLEWIAYISTSSSPISYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARR
Dicentrarchus labrax V135 ighv CBXY010022086.1 1956 VKCEQLTQPASVTVQPGQRLNITCQVSYTAWIRQPAGKGLEWIGMERVGYTAYYKDSLKNKFSITLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V134 ighv CBXY010021946.1 1028 VDGQTLTESEPVVKRPGESHRLTCTASGFNFAGYWMAWVRQAPGKGLEWVSRIDSGSGSSKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V133 ighv CBXY010021946.1 3192 AQGQSLTSSEPVVSRAGEPVTLSCKVEGLTLAWLHWIRQKPRKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNLVSLEVRSLKQEDSAVYYCARE
Dicentrarchus labrax V207 igkv CBXY010031277.1 825 SSGEIILTQSPKAQSVVPGQTVSIRCKASSSMGSYLHWYLQKPGESPKLLIRYATTRQSGVSNRFSGSGSGTDFTLTISTVQNEDAGVYYCLQSGYSFP
Dicentrarchus labrax V206 trav CBXY010031246.1 1664 RVTQPPEDVIATEGETVTLGCTFETSVSTTAYLFWYKQEVNDFPVYILHRDTYGTEDNAADFPKERFNAAINKPSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V205 igkv CBXY010031162.1 540 SRGQVTVTQSGAVSSALGRSVTITCRTSQNVHVWSNNHLLAWYQQRDGETPKLLIYFASTRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V204 igkv CBXY010031000.1 1500 QITLTQSPGSQSVVPGQTVSIRCKISTSVSSSLHWYLHKPGEAPKLLIRYATTRQSGVSSRFSGSGSGSDFTLTISGVQAEDSGVYYCQQSYSL
Dicentrarchus labrax V203 ighv CBXY010030731.1 1331 LNCQALESIPSTSVLKKPQEALSLSCRGTGFDFSQSGMHWIRQPAGKALEWMGVIYYDASKTTYASSVQGRIEITRDNSNSMVYLRLSNLKPEDSAVYYCAR
Dicentrarchus labrax V202 ighv CBXY010030674.1 3027 TEGQTLTESEPVVKRPGESHRLTCTYSGFSGHYTNAWLRQAAGKGLEWIALINYDNSYIYYSKSFRGRFTVSRDNSRQQVYLQMNSLKTEDSAVYYCA
Dicentrarchus labrax V201 ighv CBXY010030348.1 1244 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMAWVRQAPGKGLEWIAYIGTSSSPIYYSQSVQGRFTISRDDSSSKLYLQMSSLKTEDTAVYYCARE
Dicentrarchus labrax V200 ighv CBXY010030319.1 1135 VKCEQLTQPASVTVQPGQRLTITCQVSYTAWIRQPAGKGLEWIGMEAVGYTSYYKDSLKNKFSITLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V199 trbv CBXY010030223.1 366 CSLSTKVHQAPSSILGSPNGSPAISCNHSISSYDLILWYQQPMGDSDLKLIGYIYYDNPTIEDKFQQHFNITGHGSTNSQLHVQKLREPEDSATYFCAAS
Dicentrarchus labrax V198 trbv CBXY010030223.1 1956 LIDGSDVTQTPLLWKLKDQSATMNCSHNKDATYFQMYWYRQLPGEGMKQIVFTTTTPPHKYESGFSEDKFPAQKNDPQTGSLTVKKLLPEDSGVYFCAVS
Dicentrarchus labrax V197 igkv CBXY010030114.1 194 SRGQVTVTQPGAVSSAVGGSVSISCRSSQRVDEDCGSWGSDTCLSWYQQKAGETPKLLIYYTNERASGIPTRFSGSGSGTDFTLTISGVQAEDAAVYYCQSA
Dicentrarchus labrax V196 trav CBXY010029757.1 2847 RVIQPPGDVIATEGETVTLGCTFESIDPGPTLFWYKQDGNNSPKFILSRIQRDEGNTADKFKKRFSSTVNSTSKSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V195 ighv CBXY010029679.1 1502 AQGQSLTSSEAVVSRAGEPVTLSCKVEGLTLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNLVSLEVRSLKQEDSAVYYCARE
Dicentrarchus labrax V194 ighv CBXY010029678.1 2327 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYRTHWIRQPAGKGLEWIASAHVGYTTYYKDSLKNKFSISIDSSSNTVTLNGQNMQPEDSAVYYCARE
Dicentrarchus labrax V193 ighv CBXY010029678.1 3447 AQGQSLTSSEAVVSRAGEPVTLSCKVEGLTLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNLVSLEVRSLKQEDSAVYYCARE
Dicentrarchus labrax V192 igkv CBXY010029647.1 428 SRGQVTVTQSGAVSSALGGSVSITCRTSQNVYSSDRLSWYQQRDGETPKLLIYYASTRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V191 ighv CBXY010029527.1 3926 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYYMHWVRQAPGKGLEWIATVDTGSYIYYSQSVQGRFTISRDNNRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V190 ighv CBXY010029527.1 5097 VWSEIKLDQTPSEVKRPGETVKMSCITSGYSMTSYAIHWIRQRPGKALEWIGWINTNTNTPSYASSFQSRFSFTQDVPSSTQYLQINSLTAEDSAVYFCARE
Dicentrarchus labrax V189 ighv CBXY010029449.1 274 LNGQALESIPSTSVLKKPQEALSLSCRGTGFDFSQSGMHWIRQPAGKALEWMGLIYYDASQTMYASSVQGRIEITRDNSNSMVYLRLSNLKPEDSAVYYCAG
Dicentrarchus labrax V188 ighv CBXY010029449.1 1397 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYRTAWIRQPAGKGLEWIGMKYTGDSFYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V187 ighv CBXY010029349.1 398 TISPVGDKVSGREGESVTLKCRFESSHDDPNLHWYRHSDLQAPQFILWKGAKTQEYIPNKRYESETTSSSTELTIRKLTLADTALYYCALE
Dicentrarchus labrax V186 trav CBXY010029215.1 3754 SSEDLVKPFKDVMLALEGDTVTLSCKYSDSVSNVFWYQQKSSSPPQLLIMEYSEKIARLSLTHDKNSKEFHLEISSAAVTDSAVYYCAVR
Dicentrarchus labrax V185 ighv CBXY010029058.1 877 VCSQTLTESEPVVKSPGESHKLTCTYAGISDSSADIGWIRQAEEKGLEWVAFISAPSGATKAYSTSVQNRFTISRDNNVDQVYLQMNSLTTEDSAVYYCARE
Dicentrarchus labrax V184 ighv CBXY010028036.1 1061 VDGQTLTESEPAVKRPGESHRLTCTASGFTLSSYYMAWVRQAPGKGLEWIAAADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V183 ighv CBXY010027971.1 2120 TEGQTLTESEPVVKRPGESHRLTCTYSGFGSHYWNAWIRQAAGKGLEWVATISDSSGSIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V182 igkv CBXY010027790.1 2495 SRGQVTVTQPGAVSSAVGGSVTISCKHSQRVTVGRNKTKDVLAWYQQKGVETPKLLIYYADQQATGTPTRFSGSGSKTDFTLTISGVQAEDAAVYYCQG
Dicentrarchus labrax V181 trav CBXY010027407.1 1915 CKGEDSVTQPPGDVIATEGETVSLGCTFESSYSVTLFWYKQDGNDSPKYMLKCFSDSSENAAQFKKDRFNATIKNKSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V180 trav CBXY010027407.1 4870 RVTQPPGDVIATEGETVTLGCTFETSDSFPYLFWYKQDGIDSPKFMLKRFSDSSENAAQFKKDRFNATIKNKSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V179 trbv CBXY010026880.1 350 LIDGSDVTQTPLLWKLKDQSATMNCSHNKDATFYQMYWYRQLPGEGMKQIVYTTTIPPFQYESGFSEDKFPAQKNNPQTGSLTVEKLLPEDSGVYFCAVS
Dicentrarchus labrax V178 trbv CBXY010026880.1 1090 LTDGSDVTQNETLWKFKGDSATIDCRHTKGVGYNYMYWFRQLPGETMKLIVFTSLGSDNYDFGNFSKEKFSATKPDVASGTFTVNNLEPEDKGLYFCAVS
Dicentrarchus labrax V177 trbv CBXY010026880.1 2532 ASKTNSVLQTPPFIIKRAGELVSSGINCSHKTNHEMILWYKQEGQGALKLLGNLYATTVNLEDDVKGKISFDGDGRKQSSLTISNLTLNDTGVYFCAAR
Dicentrarchus labrax V176 igkv CBXY010026600.1 1004 CSGQVTVTQPPVKTFTPGSTVTISCKTNQAVYTYSDGDQAMFWYQQKSGQPPKLLITFVSTSESGTPARFSGSGSSSDFTLTISGVQAEDAAVYYCQSYHEISDDDV
Dicentrarchus labrax V175 igkv CBXY010026600.1 4050 CSGQVTVTQPPVKTSTPGSTVTISCKTNPPTHSNCDNLGQCMFWFQQKSGQPPKLLIRHVSISHSGTPARFSGSGSSSDFTLTISGVQTEDAAVYYCESVHNGPV
Dicentrarchus labrax V174 ighv CBXY010026476.1 1243 VHSQTLTESEPVVKKPGESHTLTCTASGFTFNSYYMAWIRKAPGKGLEWIATISNGGSSKLYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V173 ighv CBXY010026426.1 1378 TISPVGDKVSGRRGESVTLKCRYETTERNILLYWYRHSELQAPQFILWKGARSWSGEKYIPDNRYESETTDSSTELTIRKLTLADTALYYCALE
Dicentrarchus labrax V172 trbv CBXY010026411.1 1139 LIDGSDVTQNETLWKFKGDNATIDCRQTKGATFYYMYWYRQLPGETIKQIVFTSSINTDHDFGNFSTVKFSATKPDAASGTFTVKNLEPEDKGLYFCAVS
Dicentrarchus labrax V171 trbv CBXY010026411.1 3315 ASLSDSVFQTPPFIIKRVGESVVSGIKCSHTITSYQVILWYKQDESKTLQFLGYLNVNYLNPEDNVKGKISFDGEGNKQSSLTISNLTLNDSGVYFCAAR
Dicentrarchus labrax V245 ighv CBXY010035424.1 20 VDGQTLTESEPVVKRPGESHRLTCTASGFTLGSYHMAWVRQAPGKGLEWIALIYTDSSGKYYSQLVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V244 ighv CBXY010035424.1 1141 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSDYWMGWVRQAPGKGLEWIAIIRYDSSSIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V243 igkv CBXY010035418.1 426 SRGQYTVTQSGAVSSALGRSVTITCRTSQNVYVWSNNHLLAWYQQRDGETPKLLIYFASTRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQSFHFINSQHV
Dicentrarchus labrax V242 trgv CBXY010034696.1 1538 LVAMAAELRQDDLTLTRRVGQTVSFSCGGTDQCGTYVFWYQKKDTETFTRILRIDRRDGQVYSGYNHPQKDDFSSVNKENGWELQIQTVKLSHSATYYCACWKYA
Dicentrarchus labrax V241 ighv CBXY010034472.1 425 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSAPTAWIRQPAGKGLEWIGMAAVGYTTYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V240 igkv CBXY010034198.1 2019 CSGQVTVTQPPVKTFTPGSTVTISCKTNQAVGSCGAGECMFWYQQKSGQSPKLLIRHVSIRHSGTPARFSGSGSSSDFTLTISGVQTEDAAVYYCQSAHSGPV
Dicentrarchus labrax V239 trgv CBXY010034100.1 1219 ELSQDHLTLTRRVGQTVSFSCGGTGQCYLDYVGWYQKKDTETFTRILYFNKNTCYIQTRYNHPQKDDFSAVNKENGCELQIKTVKVSHSATYYCACWKEV
Dicentrarchus labrax V238 trbv CBXY010034089.1 82 SSLSDQVHQTPADIYNTPGQIAKIECFHTNPSFNQILWYKQTDGQLQFLGYLYLNDGYPENGVKVKIEGGALKDQTCTLIIEELQLNSSAVYFCAAS
Dicentrarchus labrax V237 trbv CBXY010034089.1 872 SSLNELVYQNPAHTFNKPEGAAKIECSHSIQNYNTILWYKKSKNRQLQLLGYMVGGSGFPETGVKVKIAGSANKDQNCTLTIEELQLNSSAVYFCAAR
Dicentrarchus labrax V236 trbv CBXY010033857.1 340 ASLSDSVFQTPPFIIKRVGESVVSGIKCSHTIASYQVILWYKQDESKTLQFLGYLNLNYPYPEEDVKGKISFDGNGQKYSNLNISSLSLNDSGVYFCAASRHSASDS
Dicentrarchus labrax V235 trbv CBXY010033857.1 1529 SSLSEKVHQTPADMYNTPGGKAKINCSHEIDTYNLILWYKQTDGQLQFLGYMLGNSGKPENGVKVKIAGDANKGQTCTLTIEELQLNSSAVYFCAAS
Dicentrarchus labrax V234 ighv CBXY010033708.1 401 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSDHSMHWVRQAPGKGLEWIAYIRYDSAEIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V233 ighv CBXY010033708.1 2868 VDGQTLTESEPVVKRPGESHRLACTTSGFTFSSYHMAWIRQAPGKGLEWVAWIENDNDRKFYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARQ
Dicentrarchus labrax V232 ighv CBXY010033634.1 1013 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSHWMHWVRQAPGKGLEWIAAADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V230 ighv CBXY010033417.1 2522 VDGQTLTESEPVVKRPGESHRLTCTASGFTLSSYWMNWVRQAPGKGLEWVATNGGSSYIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V229 ighv CBXY010033417.1 4485 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYWMNWVRQAPGKGLEWIAAIYDSSHIHYSQSVQGRFTVSRDNSRQQVCLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V228 ighv CBXY010033416.1 244 CTGQSMESIPSSSVVKKPGETVSLSCRGSGFTFNCCVMRWIRQPAGKGLEWIGSGFSDASRNTYASSVRGRAEISRDDSNSMVYLRLSNLKREDSAVYYCARD
Dicentrarchus labrax V227 ighv CBXY010033416.1 2046 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSHWMHWVRQAPGKGLEWIAWNDDAGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V226 ighv CBXY010033108.1 43 TEGQTLTESEPVVKRPGESHRLTCTYSGFGGHYDNAWIRQAAGKELEWIAFISSGSGSIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V225 ighv CBXY010033108.1 1746 CTGQSMESIPSSSVVKKPGETVSLSCRGSGFTFNCCTMHWIRQPAGKGLEWIGRGFSDASRNTYASSVRGRAEISRDDSNSMVYLRLSNLKPEDSAVYYCA
Dicentrarchus labrax V224 trbv CBXY010033082.1 67 SSLSNSVFQTPPFIIKRVGESVVSGIKCSHTITSYDLILWYKQDESKTLQFLRYLNLNFPYPEEDVKGKISFDGNGQKYSNLNISSLSLNDSGVYFCAARRHSASDS
Dicentrarchus labrax V223 trbv CBXY010033082.1 1412 SSLSGQVYQTPADMYNTPGGTAEINCSHSIQSYDRILWYKQTDGQLQFLGYMYIDKGNPENGVNVKIEGGADTGQTCTLTIEELQLNSSAVYFCAAS
Dicentrarchus labrax V222 trbv CBXY010033082.1 2202 SSLSEQVYQTPADMYNTPGGTAEINCSHSIQSYDRILWYKQTDGQLQFLGYMYINNGNPENGVKVKIKGNANKGQTCTLTIEELQLNSSAVYFCAAS
Dicentrarchus labrax V221 trbv CBXY010033082.1 2998 SSLSEKVHQTPADMFSNQGEIAKIQCSHSIEGYDRILWYKQITDGQLQLLGYMNVNTGYPETGVNVKIDGNANKDQTCTLTTERLNSSAVYFCAAS
Dicentrarchus labrax V220 ighv CBXY010032752.1 1377 VWSEIKLDQSPSEVKRPGETVKMSCIISGYSMTSGYFDWIRQRPGKALEWIGNMNSGSNSPTYSSSFQSRFIMTEDVSSSTQYLEVNSLTAEDSAVYFCARR
Dicentrarchus labrax V219 igkv CBXY010032543.1 5402 QVTVTQSGAVSSALGGSVTITCRTSQKVYGGSYLHWYQQRDGEAPKLLIKYANQRLSGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYHEINSQRV
Dicentrarchus labrax V218 ighv CBXY010032384.1 2714 CTGQSMESIPSSSVVKKPGETVCLSCRGSGFIFSCCTMHWIRQPAGKGLEWIGSGYSSASSNTYTSSVRGRAEITRDNSNSMVYLRLSNLKPEDSAVYYCA
Dicentrarchus labrax V217 trav CBXY010032365.1 7859 QRDNVLQPKGDVTATEGEEVTLDCQYNSSSTTYYLFWYKQDGNNSPKFILMRYKGDEGNIADEFKKRFSSTLDSTSRSVPLKIQKLQLSDSAVYYCALQPTVTG
Dicentrarchus labrax V216 ighv CBXY010032165.1 3214 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGIRAGSTIYYKDSLKNKFSIDLDSSNNTVTLNGQNVQPEDSAVYYCAGG
Dicentrarchus labrax V215 trav CBXY010032049.1 5387 HLSVVIQSAAVQQDTGVIFASVGDNVTLHCSYDSQVAMHFSWYQQTLGGGPELLSSVYKHNLPSKVFPWMEKNPRISVERKKGINHLHISDVHLSDSATYFCGS
Dicentrarchus labrax V214 ighv CBXY010031944.1 1429 VNSIDLIQPDSMVVQPGQSLTITCQVSGYSLTDNSYATGWIRQCEGKPMDWIFHQWGGGSLTQNNALKNKFSYSRDTSARTVTLTGQNVQPEDTAVYYCVRR
Dicentrarchus labrax V213 ighv CBXY010031866.1 802 IKTVKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSRAGSTTYYKDSLKNKFSITIDSSSNTVTLNGQNVQPEDSAVYYCARE
Dicentrarchus labrax V212 ighv CBXY010031866.1 2885 TEGQTLTESEPVVKRPGESHRLTCTYSGFGGHYWNAWITQAAGKGLEWVSTISDSSSTYYSQSVQGWFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V211 trav CBXY010031697.1 2741 QRDNVLQPKGDVTATEGEEVTLDCQYNSSSSNDYLFWYKQDGNNSPKFILSRFKVGTAKTEDVFKERFSSTLDSNSRSVPLKIQKLQLSDSAVYYCALQPTVTG
Dicentrarchus labrax V210 ighv CBXY010031697.1 3988 TISPVEDKVSGREGESVTLKCRYQTTSDDPDLHWYRHSDLQAPQFILWEGALTGEYIPDKRYESKTTGSSTDLTIRKLTLADTALYYCAL
Dicentrarchus labrax V209 trav CBXY010031671.1 2264 NTLEDDITASRAEVFSSDGHSVTLSCSYSVKAENLQWYRQDPGSAPQFLLLITDTTEPSVVKAQPPNPRLTPKLNKERNRVDLEISSAAVTDSAVYYCALR
Dicentrarchus labrax V275 trav CBXY010037464.1 635 LGSMNIIKPDSTEEHVAEGRNINLTCKYDGAISNIQWYRQYQRSRPEFLLSITEGGSIHPTDSDFKAHINKNEKRVHLEIISAKVTDSAVYYCALR
Dicentrarchus labrax V274 ighv CBXY010037304.1 127 VNSIDLIQPDSMVVQPGQSFTITCQVSGYSLTDNSYATGWIRQCEGKPMDWIWHRWGGGDFYQNNALKNKFLYKTHISTSSVTLTGQNVQPEDTAVYYCVRQ
Dicentrarchus labrax V273 trgv CBXY010037291.1 6040 ELSQDHLTLTRRVGETVSFSCGGTDQCDLDYVFWYQKKDTETFRVILDIGRSSGNIDKSYNHPQKDDFSAVNKENGWELQIKTVKLSHSATYYCACWKYA
Dicentrarchus labrax V272 trbv CBXY010037248.1 468 LIDGSDVTQTDILWKNESDSATIDCRHTKTIDYSQMYWYRQLPGEGMKQIVFTTTTPPHKYESGFSEDKFPAQKNDPQTGSLTVEKLLPEDSGVYFCAVS
Dicentrarchus labrax V271 trbv CBXY010037248.1 1499 ASKTKSVLQTPSFIIKRTGESVARGINCSHSITYYDNILWYKQQQEALKLLGYLNLKILNLEEDVKGKISFDGEGNKHSSLTISDLTLNDSGVYFCAAS
Dicentrarchus labrax V270 trbv CBXY010036970.1 638 LTDGSDVTQNETLWKFKGDNATIDCRHTKGVGYNDMYWYRQLPGETMKQTVFTSLGMDNHYFGNFSKEKFSATKPDGASGTFTVNNLKPEDKGLYFCAVSKHSDT
Dicentrarchus labrax V269 trbv CBXY010036970.1 1741 SSLSDQVHQTPADIYNISGQIAKIECFHTNPSFNRVLWYKQTNGQLQFLGYMLANTGNPENGVKVKIEGGANKDQTCTLIIVELQLNSSAVYFCAAS
Dicentrarchus labrax V268 trbv CBXY010036970.1 2579 SSLSDKVHQTPADVYNKTGETAKIRCSHSIQDYNQIYWYKQTKNGQMQLLGYMNVNDGYPEDGVNVKMEGSALKDQTCTLIIEELQLNSSAVYFCAAS
Dicentrarchus labrax V267 igkv CBXY010036939.1 7602 SSGQITLTQSPGTQSVVPGQTVSIRCTASSYASNYLHWYLQKPGEAPKLLIYYASTRQSGVSDRFSGSGSSPWTEFILTISGVQAEDSGVYYCQQSYDTP
Dicentrarchus labrax V266 ighv CBXY010036902.1 1411 VWSEIKLDQTPSEVKRPGETVKMSCIISGYSMTSYNIHWIRQRPGKALEWIGWMNTGRNSPTYSSSFQSRFIMTEDVSSSTQYLEVNSLTAEDSAVYFCARR
Dicentrarchus labrax V265 ighv CBXY010036902.1 2886 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGYYTAWIRQPAGKGLEWIGMRNTGASYYKDSLKNKFSIDLDSSSKTVTVNGQNVQPEDSAVYYCARQ
Dicentrarchus labrax V264 ighv CBXY010036902.1 4482 VDGQTLTESEPVVKRPGESHKLTCTASGFTFSSYHMAWIRQAPGKGLEWIAWIENDNDRKFYSQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARE
Dicentrarchus labrax V263 ighv CBXY010036901.1 283 VYGQTLTESEPVVKRPGESHRLTCTASGFTFSSYGMHWVRQAPGKGLEWVAWIYTDSGGKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARQ
Dicentrarchus labrax V262 ighv CBXY010036901.1 1976 LNGQALESIPSTSVLKKPQEALSLSCRGTGFDFSQSGMHWIRQPAGKALEWMGLIYYDASQTMYASSVQGRIEITRDNSNSMVYLRLSNLKPEDSAVYYCAG
Dicentrarchus labrax V261 ighv CBXY010036830.1 410 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSHWMAWVRQAPGKGLEWIAAANTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V260 igkv CBXY010036797.1 552 SRGQVTVTQSGAVSSALGGSVTITCRTSQNVYTWSSYHALAWYQQRDGETPKLLIYYASSRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V259 igkv CBXY010036724.1 170 SRGQVTVTQSGAVSSALGRSVTITCRTSQNIYNSNSLAWYQQRDGETPKLLIYYASTRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Dicentrarchus labrax V258 trbv CBXY010036461.1 422 LIDGSDVTQNETLWKNKGESATIDCRHTKGAAYFYMYWYRQLPGETMKLIVFTSISSKDFGNFSTEKFSATKPDAASGTFTVNNLEPEDKGLYFCAVS
Dicentrarchus labrax V257 ighv CBXY010036280.1 2618 VNSIDLIQSDSMVVQPGQSLTITCQVSGYSLTDTTYATGWIRQCEGKSMQWILLRWGRGYFFQNNALKNKFLYNTHISNSSVTLTGQNVQPEDTAVYYCVRY
Dicentrarchus labrax V256 trbv CBXY010036275.1 924 SSLSGQVYQTPADMYNTPGGKAEINCSHSIQSYDRILWYKQTDGQLRLLGYMDYNTGYPESGVKVNIEGSANKGQTCTLTIEELQLNSSAVYFCAAS
Dicentrarchus labrax V255 trbv CBXY010036275.1 1738 SSLSEKVHQTPADMFSNQGEIAKIQCSHSIEGYDRILWYKQITDGQLQLLGYMVANTGYPETGVNVKIDGNANKDQTCTLTTERLNSSAVYFCAAS
Dicentrarchus labrax V254 trav CBXY010036157.1 580 QRDNVLQPKGDVTATEGEEVTLDCQYNSSSTTYYLFWYKQDGNNSPKFILMRYKGDEGNIADEFKKRFSSTLDSTSRSVPLKIQKLQLSDSAVYYCALQPTVTG
Dicentrarchus labrax V253 trbv CBXY010036049.1 1687 GFSLGVQIHQSPSAVIRNTGDNVQLVCTHGQSDYRVMLWYQQSPGDKALKLIGYGYTQFKNDSVEELFRKHFKLAGDLSGNNKNGSLSIINLKALEHSAVYFCAASK
Dicentrarchus labrax V252 trgv CBXY010036049.1 2514 GCLGLEVRQSTSDLIKQPGDKVQIFCSHDKTDYRTMLWYQRSPGDTAMKLIGYLNYKNVKMEEPYNVDFNITGDLGGNTAKNGSLIVNFLRPSHSAVYYCAARE
Dicentrarchus labrax V251 trbv CBXY010036049.1 3292 VCLGVEVHQTPPALLRRPGDKVQLVCSHGKTDYSLMYWYQKSPGDQTLKRIGHVYYSTIELEESLKEHFNISGDLSGGTAKNGSLFIVNLKAPEHSAVYYCAASY
Dicentrarchus labrax V250 trav CBXY010036049.1 4006 HCQDVSQYPEISRSNVCNSAEMNCSHKKYISHNQMYWYRQRPGETMTLIVYTVVGGKPDYGGGPQTKYSIKEKTESGALTVKDLQPEDSGVYFCAVS
Dicentrarchus labrax V249 trbv CBXY010036049.1 4926 SSLSEKVHQTPADMFTNQGETAKIYCSHEIDNYNRILWYKQITDGQLQLLGYMNVNTGYPETGVNVKIDGNANKDQTCTLTTERLNSSAVYFCAAS
Dicentrarchus labrax V248 ighv CBXY010035662.1 141 TISPVGDKVSGREGESVTLKCRYETTDSNIVLHWYRHSDLQAPQFILWKGAKGITTEYIPDKRYESGTTPTSTDLTIRKLTLADTALYYCALE
Dicentrarchus labrax V247 trav CBXY010035662.1 2547 EDRVTQPPEHVIATEGETVTLGCTYETSYSGPTLFWYKQDENNSPKFILLRNKGDEGNTADKFKERFSASLNSTSKSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V276 ighv CBXY010037569.1 1857 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYEMNWVRQAPGKGLEWIAYISSGSGSIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V246 ighv CBXY010035425.1 208 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYYMNWIRQAPGKGLEWIAFIYTDNSSKFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARY
Dicentrarchus labrax V231 trdv CBXY010033417.1 372 SLDLSKSTVLLLQYNLIICYKTFSFLPGVKCEQLTQPASVMNWVRQAPGKGLEWVATNGGSSYIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Dicentrarchus labrax V208 trav CBXY010031417.1 915 RVTQPPEDVIATEGETVALGCTFETSVSTTAYLFWYKQDGNNSPKFILSRIQRDEGTTAEKFKERFSSTLNSTLKSVPLKIQKLQLSDSAVYYCALQ
Dicentrarchus labrax V170 igkv CBXY010026247.1 2862 SRGQVTVTQSGAVSSALGRSVTITCRTSQNVHVWSNNHLLSWYQQRDGETPKLLIYYASTRASGIPGRFTGSGSNSDFTLTISGVQTEDAAVYYCQSFHVINSQHV
Dicentrarchus labrax V141 trgv CBXY010022842.1 497 CCLGLEVRQSTSDLIKQPGDKVQIFCSHDKTDYRMMLWYQRSPGDTAMKLIGYLNFKDVKMEEKYEVDFNITGDLGGNTAKNGSLIVKRVGPNHSAVYYCAASK
Dicentrarchus labrax V132 trbv CBXY010021887.1 1622 SSLNELVYQNPAHTFNKPEGAAKIECSHSIQNYNTILWYKKSKNRQLQLLGYMMGGSGSPEKGVNVKIAGSANKDQNCTLTIEELQLNSSAVYFCAASLHSAT
Dicentrarchus labrax V103 ighv CBXY010036395.1 504 IDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYWMHWIRQAPGKGLEWIAAIYDSRNIHYSQSIQGRFTISRDNSRQQVYLQMSSLKTEDSAVYYCARE
Dicentrarchus labrax V94 ighv CBXY010034283.1 4176 VWSEIKLDQTPSEVKRPGETVKMSCIISGFDMTSFYMHWIRQRPGKALEWIGRMDTGTNSASYASSFQSRFIMTEDVSSSTQYLEVNSLTAEDSAVYFCARR
Dicentrarchus labrax V81 ighv CBXY010032112.1 2539 VDGQTLTESEPVVKRPGESHRLTCTTSGFTLSSYWMAWVRQAPGKGLEWIAAADTGSGTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Dicentrarchus labrax V56 ighv CBXY010026718.1 693 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTVWIRQPAGKGLEWIGSKYTGDSFYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDSAVYYCARD
Dicentrarchus labrax V29 trbv CBXY010023370.1 4284 SSLSDQVHQTPADIYNISGQIAKIECFHTNPSFNQILWYKKSKRQLELLGYMYVNDPYPETGVNVKIAGSANKDQTCTFTIEELQLNSSAVYFCAAR
Dicentrarchus labrax V18 trav CBXY010019489.1 1338 ESVTFEQSSAQVVKDGTKEVTIDCSHDDSSLGAMLWYQHKPGSGSMSLIGYSVLNGEPNYEVHFKDRFQIKSGMQKGSLIIPTANLSDSAVYFCAASTQ