WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Procavia capensis ABRQ00000000.1 (ABRQ01) 139 21 1 51 39 18 2 7
Procavia capensis ABRQ00000000.2 (ABRQ02) 269 61 2 105 56 30 4 11
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Procavia capensis V112 trav ABRQ01197546.1 2203 VCQGENVEQYPSTLSVLEGSSSVINCTYSDSGSVYFPWYKQEPGKGPQLITDIRSNVGHNQGKGLVVLLDKKARHLSLHISAAQPGDSAIYFCAAR
Procavia capensis V113 trdv ABRQ01197546.1 7839 FSTAQKVTQIQPAVMVREKGAVTLYCAYDTSDSRFSLSWYKQTSSGAMTFLIRQDSYNKENETEGRYFLNFQAAAKSINLVISDLLLADSAVYFCVLRE
Procavia capensis V114 trav ABRQ01197548.1 3214 GASGDSVIQTEGQVTVSERTALTINCTYTATGYPTLFWYIQHRGEGLQLLLKVTKVNEKGRNNGFEATYNKETSSFHLEKASVEESDSAVYYCALS
Procavia capensis V138 igkv ABRQ01237472.1 332 ASGDIVMTQSPASLAASPGETVTLKCKSSQGISSYLNWYQQKTGQAPKLLIYNANSRASGVPNRFSGSGSGTDFTLTISSFQAEDAAVYYCQTFARSA
Procavia capensis V139 igkv ABRQ01237475.1 490 VSGDIVMSQSPASLAASPGERVTINCKASQSIGTSVQWYQQKPGQAPKLLIYWASSRASGVPDRFSGSGSGTDFTLTISSFQAEDSAVYYCQQGYSYP
Procavia capensis V140 igkv ABRQ01237477.1 1872 ANGDIVMTQSPASAAASLGQTVTINCKSSESVGSYLYWFQQKPGQAPKLLIYGVSNRDSGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCLQAY
Procavia capensis V157 igkv ABRQ01271201.1 1503 ARCDIQMTQSPPSLSASLGDTVTITCRASQSISSWLAWYQQKPGKSPKLLIYKASTLQSGVPTRFKGSGSGTDFTLTISSLETEDFATYYCQQHSSSP
Procavia capensis V168 igkv ABRQ01281307.1 4589 ASGNIVMTQSPASLAASPGETVTLKCKSSQGISSYLNWYQQKPGQAPKLLIYGASNRASGVPDRFSGSGSGTDYTLTISSFQAEDAGVYYCQCGYYSA
Procavia capensis V170 ighv ABRQ01283606.1 426 VLSQMQLQESGPGLVKPSQTLSLTCSVSGQSITSIGYGWSWIRQPPGKGLEWLGYGVHIGSWNTAYNPSIQSRISITADSSKNQFLLELRSVTAEDTAMYYCAR
Procavia capensis V171 ighv ABRQ01283609.1 6242 VLSQVQLQESGPGLVKPSQTLSLTCSVSGQSISSEDYLWSWIRQPPGKGLEWLGAGAHIGSWNAAYNPSIQSRISITADLSKNQLLLELRSVTAEDTATYYCAR
Procavia capensis V176 ighv ABRQ01299561.1 6175 VLSQVTLQESGPRLLKPSQTLSLTCSVIGGSVTSNSHWNWIRQRPGKGLEWMGHWSGSTSYNSVFQGRVSITTGTANNQFSLQLSSVTTEDTATYYCARGEKKK
Procavia capensis V177 trav ABRQ01302300.1 1051 ESTQQLEQSPQFLSIQEGKSFTTYCNSSSTFNTFYWYRQRPGQGPVFLLMLTRSGDVKQQKRLMAQFGDARKDSSLHITVTQPEDAGLYLCAG
Procavia capensis V178 trav ABRQ01302302.1 1120 VRAEMKVEQSPQVLIIREGRNASLLCNFSESTTNVQWFQQNSGEHLKFLFYIASGVKQKGRLEFTVNTKERYSHLYIKDSQLGDSATYFCAAE
Procavia capensis V179 trav ABRQ01302306.1 23 KDKEGQQVKQSPPSLMIQEGKNSILNCDYTNNLFDYFVWYKKSPAKGPELLISIRSVMDRNENERFTVFLNISAKHLSLHIASSQPGDSATYFCAARTQCSA
Procavia capensis V185 trdv ABRQ01308892.1 8189 SSMSQKVTHSQWGISRQEGQSVELDCSYEISYAYYGLLWYKRLPRGEMISLISQFFGEESTAPQDRYSIRFQKAAKTIKLIISTAQLEDSATYFCSFR
Procavia capensis V189 trav ABRQ01316412.1 7150 GVSSKDIVEQSPPSLNVQEGSSTNFTCTFPSSSFYALHWYCWEPAKSPKVLFVLLSDGDELDKGHVRATLNTKKGYSYLYIKGSQLEDSATYLCAF
Procavia capensis V201 igkv ABRQ01330535.1 3954 ASGDIVMTQSPASVAASPGETVTINCKSSQSVSSYLNWYQQKPGQAPKLLIYYANRRESGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQYNSDP
Procavia capensis V212 ighv ABRQ01358578.1 537 VLSQVQLQESGPGLLKPSQTLSLTCTVSGFSLTGSDMHWVRQAPEDGLEWVGVIWASGNTKYNPALASRLSITRDTSKSQVYLKLGSLTSEDTAMYYCAR
Procavia capensis V215 igkv ABRQ01368088.1 3774 VSGDIVMTQSPASLAASPGETVTINCKSSESLLRGSYNRLAWYQQKPGQAPKLLIYDASDRISGVSNRFSGSGSGTGYTLTINRAEIEDGAIYYCQQHKSIP
Procavia capensis V222 trdv ABRQ01380381.1 159 SSMSQRVMQSQPAVSTQQGRTVELDCSYETTFSYYSLLWYKRLPTGKMIFLISQHSSEKSTTPQDRYSIKFQKSTKTIKLIISTAQLEDSAAYFCCLR
Procavia capensis V223 trav ABRQ01380387.1 1219 TTGDAKTTQPNSMWTTEGKPVNLPCDHSGISTNEYIYWYRQIPNQGPEYVIYGIKTNVTNAMASLVIPTDRKSSTLILPHVTPRDAAVYYCIVGE
Procavia capensis V224 trav ABRQ01381496.1 1464 EIGAQSVTQPDALVSVSEGHSLELRCSYSYSGTPYLYWCVQHPNEGLQFLLKYLRGDTLVKGISGFEAEFSRSESSFTLRKHSAHWKDSAEYFCALD
Procavia capensis V226 igkv ABRQ01385096.1 1845 ASGDIVMTQSPASLAASPGQTVTIKCTSSQSLTSGSYNYLSWYQQKPGQAPKLLIYGASNRESGIPNRFSGSGSGTDFTLTISSFQAEDAADYYCQQSYSTP
Procavia capensis V227 igkv ABRQ01387207.1 3704 ASGDIVMTQSPASLAVSPGEKATIRCKASQDIGSDLAWYQQKPGQAPKLLIYDASNQASGVADRFQGSGSGADYTLTVSSFQAEDVANYFCMQEY
Procavia capensis V233 trbv ABRQ01393162.1 512 QMDAGVTQTPRYKVTKMGNEETLGCEPISGHNALFWYKQSSVVGLELLTYLQNQAVVEQVDAFKNRFSAKMPNKSFSTLKIERLEWSDSAMYLCASSP
Procavia capensis V236 trav ABRQ01398936.1 4749 DSRAQSVTQSDGPFSVSEGASLELGCNYSYGATPSLFWYRQYPSQGLQLLLKYISGNSLVKGANGFEAEFSRSKSSFNLRKHSAHWKDSAEYFCAVG
Procavia capensis V248 igkv ABRQ01414635.1 1274 VRGDIVMTQSPASLAASPGETVTINCKSSQGISSNLDWFQQKPGQAPKLLIYRASSRESGVPDRFSGSGSGTDFTFTISSFQAEDTATYYCMQNNNYP
Procavia capensis V251 iglv ABRQ01420411.1 2743 SVASYELTQAPSVSVALGQKATITCSGDNIGNKYTHWYQQKPGQAPVLIIYRDSERPSGIPDRFSGSSSGSTATLTISRLQAKDEADYYCHVWDSNT
Procavia capensis V252 trdv ABRQ01420507.1 2123 SIMAQKVTQSPSATSRHEGAAVTLDCLYKTSATSYFIFWYKQLPSGEIFFLIRQLSSEKNAMLGRYFINFQKKDKSISLIISTLQLEDSAVYFCALWE
Procavia capensis V260 igkv ABRQ01447014.1 1363 ASGDIVMTQSPTSLAASPGQTVTINCKSSQSVSDDVDWYQQKPGQAPKLLIYEASNRMSGVPDRFSGRGSGTDFTFSISSFQVEDAALYYCMQSNTDN
Procavia capensis V262 ighv ABRQ01452272.1 2251 VLSQVQLQESGLGLVKPSQTLSLTCSASGGSISNYVWSWIRQPPGKGLEWLGRGYYSSSTWKTNYGSSVQSQISITADSSKNQFYLKLSSMTTEDTATYYCAR
Procavia capensis V263 ighv ABRQ01452273.1 3071 VLSQVQLQESGPGLVRPSQTLSLTCSVSGESISSGYAYSWIREPPGKGLEWLGTHYYYDNSWNTAYSPSIQSRISITADSSKNQLLLELRSVTTEDTATYYCGI
Procavia capensis V264 igkv ABRQ01453019.1 97 ASGDIVMTQSPASLAASPGERVTLKCKSSQGVSSYLHWYQQKPGQAPKLLIYYATSRASGVPERFSGSGSGTDYTLTISSFQAEDAALYYCQQTY
Procavia capensis V268 trbv ABRQ01458897.1 5094 HAGPGVSQRPSHKVTAKGQEVTLRCDPISGHLSLYWYRQNPEKNMEFLVYFYNEKISEKSETFKDRFSAERPNGSLSTLEIQHVEPGDSAVYFCASSK
Procavia capensis V269 ighv ABRQ01459354.1 380 AQCEAQLVESGGDLRKPGGSLRLSCVASESTFSSYWMHWIRQAPGKGLEWVGNINPDSSSKNYAPSVKGRFTISRDNARNSLYLQMDKLKTEDTATYYCT
Procavia capensis V270 trbv ABRQ01460689.1 6774 HTDAGVTQSPRHKITSTGGNVTLRCIQDLNHLYMYWYRQDPGMGLQSIYFSINEGDISTGNARKGYSISRSKIKHFFLTLQSAARSQTAVYFCAGRD
Procavia capensis V275 trav ABRQ01463950.1 8694 LPSQQKGVEQSSGSLSIPEGDTASLNCTYEDSGSQYFLWYRQYSGKGPEFLISMYSKGDKKEGKFTAYLNKDSKHFSLLITDTQPSDSATYFCAV
Procavia capensis V280 trav ABRQ01474717.1 293 SMGQGIQQPTELTVMEGDFVQVNCMYQTSGFNGLCWYQQSDGREPTFLYSNVLGGFEKRARSSSFLSRSSMCSYLLLRELHTKDSACYICAAR
Procavia capensis V287 igkv ABRQ01487270.1 468 ASGDIVMTQSPASLAASPGETVTISCKSSQSLVYSSYNCLAWYQQKPGQAPKLLIYLASNRASGVPDRFSGSGSETDFTLTISSLQVEDATVYYCQQYSNYP
Procavia capensis V290 ighv ABRQ01496897.1 471 VLSQVQLQESGPGLVRPSQTLSLTCSVSGESISSGYAYSWIREPPGKGLEWLGTHYYYDNSWNTAYSPSIQSRISITADSSKNQLSLELRSVTTEDTATYYCGI
Procavia capensis V292 igkv ABRQ01502026.1 2170 ASGDILMTQSPTSLAVSPGNTVTINCKSSQSVFYSSNKKDYLSWYQQKQGQGPKLLIHWASTRASGVPDRFSGSGSGTDFTLTISSFQTEDAAVYYCQQYY
Procavia capensis V295 trav ABRQ01507105.1 607 SSGEDQEEQSPPALILQEGEDSSLNCSYPVSRFSGVQWYKQDPGKGPELLFILYSAGDDKEKERLRGMLSTKGSSLHITASNLEDSATYLCAV
Procavia capensis V296 trav ABRQ01508022.1 2701 ETRAQTVTQADGQISVSDGAPLQLRCNYSYYTVPNLFWYVQYPNKGPRFLLKYISGDTLVKGIKGFQAEFKKNETSFHLRKLSVHWTDSAEYFCAVS
Procavia capensis V300 trbv ABRQ01515710.1 1764 HTDAGVTQSPRHKITSTGGNVTLRCLQDLNHLYMYWYRQDPGMGLQSIYFSINEGDISTGNARKGYSISRSKIKHFFLTLQSAARSQTAVYFCAGRD
Procavia capensis V304 trav ABRQ01524374.1 1278 GRRAQTVTQPVDHLFVFEGAPVQVKCNYSYSGSPVLFWYIQYPKEGLQLLLRHISGNSIKGFRGDLDKDKMTFHLKKQSAQEEDSAMYYCAVS
Procavia capensis V306 igkv ABRQ01525536.1 887 TSGDIVMTQSPASLAASAGETVTIKCKSSQGISSYLAWYQQKPGQAPKLLIYAASSRTSGVPNRFTGRGSGTDFTLTISSFQAEDAGVYYCQQHYNIP
Procavia capensis V310 trav ABRQ01534549.1 326 VSSDKVIQNPPSLVIQEGSSVNLSCNYEVTYFESLLWYKQKEKAPTLLVKLFSNEIEKKSGRFCSTLNNKEHFSILHVTALQPRDSATYLCATA
Procavia capensis V315 trav ABRQ01547260.1 390 GTSGDSVTQTEGPVTFTEEATMILNCTYETIDPSPYLFWYVQYPNDGLQLLKRSTESEKMDNKGFQANHVKSSKSFLLRKSSIQMSDSAVYYCVLN
Procavia capensis V331 igkv ABRQ01592869.1 474 VSGDIVMTQSPASLAATPGQTVTINCKSSESVFDSDDDTNYLSWYQQKQGQAPKLLIYAASNRESGVPDRFSGSGSETDFTLTISSFQAEDAAVYYCMQGYSSP
Procavia capensis V335 trbv ABRQ01601334.1 1127 STDTEVTQTPRQLVRARNQTAKMDCVPKTGHDYVYWYRQKLGEELKFLIYFDNDQAGDASRMPDKRFIAQCPKNSPCSMEIQSTEPKDSAVYFCANRD
Procavia capensis V337 ighv ABRQ01602924.1 1718 AVSQITLKESGPGLIKPGQTLSLTCTFSGFSLSTRYNGVGWIRQPPGKPLEWLTDIWWDDDKYYNPTLKTRLTISKDTSKNQVFLTMTSMDPADTATYYCAHR
Procavia capensis V343 trav ABRQ01613724.1 1089 VDSQVEQNPEILHIQEGENATMNCSYKSSINNLQWYRQDLGRSLVLLFRILSNEREKHNGNLGATLDTFSKSSSLFITSSQAADSASYFCAVD
Procavia capensis V345 igkv ABRQ01617535.1 984 ASGDVVVTQSPASLALSLGETATISCKVSQNIYSTLAWYQQKPGQAPKLLIYEASSRVSGVPDRFSGSGSGTDYTLTISSFQADDAAVYYCQQHY
Procavia capensis V346 trav ABRQ01619120.1 1597 ITGDAKTTQPNSVDSTEGKRVNLPCNHSSISTNEYVYWYRQILNQSPEYVIHGLKGNVTEEVAILVIPTDRKSSTLILPHVTLRDAAVYYCMVR
Procavia capensis V347 trav ABRQ01624624.1 1090 VRGAQVEQSPSVLSLQEGDSDTLRCSFSFSPTAVQWFRQNPEGRLITLFYVASGTKQDGRLNATTVIAQRHSSLYISSSQTTDSALYFCAARHSAPS
Procavia capensis V351 trav ABRQ01628876.1 899 RTKGDSVTQTEGLVTRPEGTRVILNCTYQSSYPNLFLFWYVQYPSKAPELLLKSSTESKGAENEGFQANLVKSENSFHLQRHSLRISDSALYYCAMR
Procavia capensis V356 trdv ABRQ01638310.1 932 SSMSQKVIQSQLEASGQEGQAIELDCSYEVKFSYYRLFWYKRLPSRVMVFLISQGANKKPAIPQDRYSITFKKIAKTIKLITPTAQLEDSAQYFCGLWA
Procavia capensis V359 trav ABRQ01650033.1 1335 MKGAEVEQSPPVLNLQEGDSYTLRCNFSFSPNNVQWFRQNPGESLTTLFYIPSGTKQDGRLSATTVIRERHSSLYISSSQTTDSAIYFCAVSHSAPP
Procavia capensis V360 trav ABRQ01653901.1 1335 SSTAQTVTQSPQQMSVQEAESVTLDCIYDTSDTDYYLFWYKQPPSGEMIFVIRQEAFKQQNATDKRFSVNFQKAAKSFSLTISNSQLGDTAVYFCVYSS
Procavia capensis V364 trav ABRQ01670819.1 875 VLSQQNGVKQSAGSLSIIEGDIASLNCTYEDRNSQYFFWYRQYSGKGPEFLISVYSKEHKKEGRLTAQLNKDGQYVSLLITDSRHSDSAMYFCAV
Procavia capensis V365 ighv ABRQ01676669.1 569 VLSQITLQESGPGLVKPSQTLSLTCSVSGGSVTSSYWWNWIRQRPGKGLEWMGYWTGSTRYNPVFQGRITITADTAKNQFSLSLSSVTTEDTATYYCAR
Procavia capensis V367 trav ABRQ01686332.1 764 ESAGQLKQSPWFLSVQEGENFTTYCNSSSVFTTFVWYRQKPGEGPVFLLRLTKSGDLKQKRITAQFGQARKDSSLRIADAQAEDAGLYLCAGAQYSQ
Procavia capensis V368 trav ABRQ01687756.1 665 VSSKQEVQQSPPALSAQEGDNLAVSCNYTDSAILFLQWYRQDLGKGLTLLLSIQANQGEQMNGRLKVSLDKSSRRSVLNISSSQTCDSTTYLCAA
Procavia capensis V370 trdv ABRQ01700133.1 956 SSMAQKVTQDQPTASVAEKEAVTLACIYETQDINYALFWYKQPPSGEMIFLMHHVSYDKQNATKGRYSLNFQKEARFISLTITVLQPRDSAVYFCALQD
Procavia capensis V371 igkv ABRQ01701464.1 1657 TSGDIVMTQSPGSLAASLGETVTLKCKSSQGIGSYSNWYQQKPGQALKLLIYYATSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQ
Procavia capensis V372 igkv ABRQ01701604.1 981 TSGQIVLTQSPASRAFTPGETVTINCKASSSVSTNYLHWYQQKPGAPPKLLVYSTSSQASGVPVQFSGRGSGTDYSLTISNTRNEDAAIYYCQQSNSYP
Procavia capensis V375 igkv ABRQ01711562.1 1723 ASEDIVMTQSPASLAVSPGEKVSMSCKASENIYGRLVWYQQKPGQACKLLIYSTSNRASGVPNRFQGSGSVTDYTLTISSFQTEDAALYYCQQGRSIP
Procavia capensis V376 trav ABRQ01716751.1 854 SSEEDRVEQSPPALILQEGGGSSLKCSYSVSSSNGLHWYKQDPGKGPEFLFTLYSVGDDMEKETLRGTLSKTESFLHITASKLEDSATYLCAM
Procavia capensis V378 ighv ABRQ01719127.1 962 ICTQVQLEQSGAELKKPGQSLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGEIDPSDSYTSYSPSFQGQITISVDNSISTAYLQWQSLKATDTATYYCAR
Procavia capensis V380 igkv ABRQ01723566.1 206 ANGDIVLTQSPASLAVSPGETVTINCKASQSVISYLAWHQQKPGQAPKLLIYYASNRESGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQHGYGTP
Procavia capensis V382 ighv ABRQ01728721.1 745 ILSQVQLQESGPGVVKPSQTLSLTCDVSGFSLSSYHMSWVRQAPGEGLEWIGIITGGGSTYYNSALKSRLSITKDNSKSQVYFKLSSVSSEDTAMYYCAR
Procavia capensis V385 trgv ABRQ01738180.1 1392 GDTEMRISQDQLTFTRRLGKTAHIGCKVSGGPLENIVVHWYQQKEGEPLQRILYGSTKNYKQDKPNSRMEIDDKENRVSHLMINNVIKEDEATYYCACWD
Procavia capensis V388 trav ABRQ01749882.1 912 GTNGDSVIQTEGPVTLYEGAGHVFLNCTYQISYTTSLFLFWYVQYLDKAPELLLKSSTESKGTENRGFQANLVKSENSFHLQKHSLQMSDTALYYCAMR
Procavia capensis V393 trav ABRQ01768536.1 1087 GSNGNTVIQTQGQVILSKGDLLTVNCSYTSSGYLALFWYVQYPSGGLQLLLKAAKANDKGSKNGFEAMYNAETSSFHLEKASAQESDSAVYYCALN
Procavia capensis V395 trav ABRQ01770222.1 470 VNSQIEQNPEVLQVQEGENATMNCSYKSNLNNLQWYRQASGRGLAPLIVIYSNEREKQNRNLRVTLDASTKRSSLFITSSQTADIATYFCAVY
Procavia capensis V400 igkv ABRQ01775191.1 444 VSGDIVMTQSPASLAVSLGGTVTINCKSSQSLYNSNNKKNWLVWHQQKPRQAPRLLIYQASNRASGVPDRFSGSGSGTDFTLTISSFQAEDVANYFCMQVYDTP
Procavia capensis V404 trav ABRQ01812972.1 650 SSGEDQVEQSPPALILQEGEDSNLTCSYSVSSFRGLQWYKQDPGKSPKLLFFLFSVGDDKEKERLRGILSTKESSLYITASELEDSATYLCAV
Procavia capensis V408 trav ABRQ01823754.1 445 GIRAQSVTQPDVLVSVSEGHSLELRCNYSYSGTPYLYWYVQHPNKGLQFLLKYLSGDPLVKGISGFEAEFSRSESSFTLRKHSAHWNDSAEYFCALD
Procavia capensis V411 trav ABRQ01829163.1 199 MGRGEKVEQSPSLLSVQEGKSSFFNCTYTDSASDYFFWYKQQPGKGLQFLIYTFSSVDKKQERRLTVLLNKKEKHFSLHIADLYPGDSATYFCAAR
Procavia capensis V489 ighv ABRQ01133948.1 6202 VLSQVQLQESGPGLVKPSQTLSLTCSVSGQSISSYVWSWIRQPPGKGLEWLGHGYYSGSTWNTNYGSSVQSRISITADSSKNQFYLKLSSTTSEDTAVYYCAR
Procavia capensis V531 trgv ABRQ01199753.1 1474 GDTKMTISQDQLSFTRTQGRTVHISCKLSGIPLENIFVHWYQHKEAEPLRRILYSSTRNFKQDKPNPRMETNMKENGVFYLIINNVIKEDEATYYCACWD
Procavia capensis V561 igkv ABRQ01254446.1 13244 ATGDIVMTQSPASLAASPGQTVTINCKSSQSLVSSSYSYLNWYQQKPGQAPKMLIYGASYRASGIPNRFSGSGSGTDFTLTISSFQAEDAAVYYCQQSY
Procavia capensis V562 igkv ABRQ01254446.1 5252 VHGDIVMTQSPASVAASPGETVTINCKSSQGVGNYLHWYQQKPGQAPKLLIYYANRRESGVPDRFSGSGSGTDFTLTISSFQAEDAASYYCQQGSSYP
Procavia capensis V573 trbv ABRQ01277146.1 5588 HVDAQVTQTPRYKITRTGRKATLLCSQSRNDNYTCWYRRDPGLGLRLIHYSSLVSITSEGDIPVGYNVSRSHLEHFPLTLESAAPSQTAVYFCASSQ
Procavia capensis V574 trbv ABRQ01277147.1 1485 CMLGVLVSQHPSRAICKNGTSLTIQCLPTGSQASTVLWYRQLPGQSFTLIATSNQGSDATYEQGFVKVKFPISHPNLTFSTLTVTSAQVEDSSLYFCGVS
Procavia capensis V581 igkv ABRQ01290719.1 635 ASGDIVMTQSPASLAASLGKTVTLKCKSSQGVSSYLAWYQQKPGQAPKLLIYDASNRESGVPDRFSGSGSGTDYTLTISSFQAEDAGDYYCQQYDNTP
Procavia capensis V583 trbv ABRQ01292148.1 771 TIDAGVTQSPRYKITRTGGNTTLQCTQDANHYSMYWYRQDPGLGLRLIHYSDSVGDTMNGDIPDGYNVSRPSREHFLLTLGLDPSQTAVYFCAISF
Procavia capensis V587 igkv ABRQ01303209.1 6310 GSGDIVLTQSPAFLAASVGETIAITCKSSQSLAYNSYQVLAWYQKKPGEAPALLIYDAVSRPSGVSSRFSGSGSGTDFTLTISSLKTEDVADYYCNQYRSMP
Procavia capensis V599 igkv ABRQ01342151.1 1774 TRADIVLKQSPAFLSVTPGDSVAITCKASQNIDDDIHWYQQKPGEAPKLIVKYATTLMSGVPSRFSGSGYDIDFTLKISNTQSEDAAYYFCQQDDSLP
Procavia capensis V600 igkv ABRQ01342152.1 1980 ASGQIVLTQSPGSWAFSPGETVTINCNAGSSVGTSYLHWYQQKPGAPPKLLVCKTSNVASGVPARFRDSGSGTDYSLTISNNREEDAAFYYCE
Procavia capensis V613 trbv ABRQ01387079.1 1107 FGAQTIRQWPEVEVQQAGSPLSLQCTVRGTSNPNLYWYRQATGGPLQLLFTSVSVGDVQAETQEHLSATRPQDGQFTLRAEKLQPRHSGMYLCAWS
Procavia capensis V615 trav ABRQ01388517.1 702 EIRAQSVTQPDVPVSVFEGDSLELKCSYSYSGSLYLYWYVQYPNKGLQFLLKYLSGDNLVKGISGFEAEFRKNESSFNLRKHSAHWKDSAEYFCAVQ
Procavia capensis V617 trav ABRQ01390509.1 10923 MGKGEKLEQSPSLLSVQEEESSFFSCTYTDSASSYFLWYKQELGKGPQLLILILENVDKKQEQRLTVQLNKEEKRFSLHIADTHPGDSATYFCATR
Procavia capensis V618 trbv ABRQ01392487.1 2605 QMDAGVTQSPRHKITRTGENVTLRCAQDMKHDYMYWYRQDFRRGLQLIYYSYGVNDNYKGDIPDGYQVSRLQTEEFFLLLGSASPLQTAVYFCASRD
Procavia capensis V625 igkv ABRQ01403595.1 1907 ASGDIMMTQSPASLAASPGETVTINCKSSQSLVYGSYNLLFWYQQKPGQAPKLLIYAASNRASGVLDRFSGSGSETDFTLTISSFQAEDAAVYYCQQDY
Procavia capensis V626 igkv ABRQ01403597.1 2719 ANGDIVLTQSPASLAASPGERVTINCKSSQSLTAGSYNLLSWYQQKPGQAPKLLIYDASSRASGVLDRFSGSGSRTDFTLTISSLQAEDAAVYYCQHSYGTP
Procavia capensis V629 ighv ABRQ01417596.1 1718 VHCEEKLVESGGDLRKPGGSLKLSCVASGFTFSSYGMHWIRQYPGKGLEWVAVIWYDGSKKYYADSVKGRFTISRDNSKNTLYLQMDNLRTEDTGVYYCAS
Procavia capensis V630 trbv ABRQ01418333.1 1476 FMGAQIIQTPRYLIRRTGEKALLECIQHNQHDRMFWYRQDPALGLQLVHYSYGVGVTQKGDIPAGYSVARKTTESFILILGSASLNQSSVYLCASNN
Procavia capensis V631 trbv ABRQ01418336.1 2350 PACADVSQTPRHHVTGTGKKITLECSQTMGYDNMYWYRQDPGKEPQLIHYSYGVNSEEKGELSSRWTTSRKTKEHFPLTLESASLTESAQYLCAASQ
Procavia capensis V639 ighv ABRQ01429278.1 3393 AISQVTLQESGPGLIKPSETLSLTCTISGFSLSTSGVRVGWIRQPSGKTLEWLAYIKWDGNKYYNPSLQSRLTISKDNSKNEVILKMTNMDPMDTATYYCAHL
Procavia capensis V645 igkv ABRQ01441998.1 2226 VHGDIVMTQSPASLAATPGQTVTINCKSSQSVFNSNIKKDNLAWYQQKPGQPPKLLVYHATSRASGVPDRFIGSGSGTAFTLTISSFQPEDAALYYCQQYR
Procavia capensis V648 trbv ABRQ01447323.1 2344 SAFGALVSQKPSRDICEREASVTIQCQIDSELTNIFWYRLHPGQGLILIATANVGSEATYENKFTRDKFPISRPNFTFSTLTVSKGSPEDSGFYLCSTG
Procavia capensis V653 igkv ABRQ01463040.1 5060 VSGDIVVTQSPASLTASLGGIVTINCKSSQSLYNSNNKKNWLAWYQQKPGQAPKLLIYQASSRASGVPDRFSGSGSETDFTLTISNFQADDAAVYYCQQYYSYP
Procavia capensis V657 trav ABRQ01466401.1 3775 SSGEDQVQQSPQALILQEGEDSSLKCSYSVSNFRGLQWYTQDPGKGPELLFLLYSVGDDKQKERLRSTLSKTESSLYITASKLEDSATYLCAV
Procavia capensis V661 ighv ABRQ01474272.1 309 VLSQVQLQESGPELVKPSQTVSLTCTVSGFSLTDRGVHWVRQTPGKGLEWIGAIWSGGSTNYNPTLASRVSITRDTSKSQTYFKMNSVTSKDTATYYCAK
Procavia capensis V664 igkv ABRQ01484574.1 9546 ASGDVVVTQSPASLAVSPGQTATISCKASENIYSNLAWYQQKPGQAPKLLIYDANSRASEVPDRFSGSGSGTDYTLTISSFQAEDAAVYYCQQYSDYP
Procavia capensis V665 igkv ABRQ01484574.1 2933 ASADLVMTQSPASLALPLGETATISCKASENIYSSLAWYQQKPGQPPKLLIYDASSRESGVPDRFKGSGSGTDYTLTISGLQAEDTADYYCQGYASYA
Procavia capensis V669 trbv ABRQ01493887.1 4274 ITDSGISQTPKYLLRKEGQEVTLKCEQSFNHDSMYWYRQASGQGLKLVYYSLIVDDVREGEAAAGYRASREKKEHFPLVMKWARRNQTAVYLCASSV
Procavia capensis V670 trbv ABRQ01493887.1 2252 LTLGVLISQHPSRAICKSNYSVTIQCHSAGIQAMTVLWYRQLPGQSFTLIGISNQGSRATYEQGISDTKFPISHPNLTFSSLTVTRAQAEDSSLYFCAVS
Procavia capensis V672 igkv ABRQ01499699.1 1841 SSGQIVMTQSPASRAFSPGETVTINCEASTSISTNRLHWYQQKPGAPPKLLVYRTSTLASGVPSRFSGSGSGTDYSLTISNIREEDAAIYYCEQTNSNP
Procavia capensis V674 igkv ABRQ01502054.1 2809 ISEDIMLTQSPTYRTFTPGDTITVSCKANSSVSANYLHWYQQKQGAPIKLLIYGTSYLDSGVPDQFSGSGYGTDYSLTISNIRNEDAAVYYCQQWSSEP
Procavia capensis V675 ighv ABRQ01504328.1 1795 ALSQVTLRESGLGLITPGQTLSLTCTFSGFSLSTSGIGVGWIRQPSGKPLEWLTVVWWTDSKNYNPSLKSRLTISKDTSKNQVFLTMTSVGPEDTAMYYCAR
Procavia capensis V676 ighv ABRQ01504682.1 2973 VLSQVQLQESGPGLVKPSQTLSLTCSVSGESLSSGYAYSWIRQPPGKGLEWLGYGYYSGSKWKTNYGSSIQSRISITADSSKNQLFLELRSMTAEDTATYYCAR
Procavia capensis V680 trbv ABRQ01514125.1 1886 STDTEVTQTPRQLVRARNQTAKMDCVPKTGHNYVCWYHQKLGEELKFLINFNYDQAVDASGMPDKRFVAQCPQNSPCSMEIKSTEPKDSAVYFCASSE
Procavia capensis V684 igkv ABRQ01524887.1 2833 ATGDIVMTQSPASLAASPGQTVTINCKSSQSLVYNSYKWLAWYQHKPGQAPTLLIYRATGRASGVPDRFSGSGSETDFTLTISSFQAEDAALYYCHQTRSTP
Procavia capensis V688 igkv ABRQ01530835.1 1291 ASGDIVLTQSPASLAVSPGEKVTINCKASQSISNSLHWYQQKPGQAPKLLIYGASNRASGVPDRFSGSRSGTDFTLTISSFQVEDAGDYYCHQSY
Procavia capensis V691 igkv ABRQ01539021.1 3923 ASGDIVMTQSPAALAASPGQTVTIKCKSSQSLVSGSSNYLAWYQQKEGQAPKLLINWASNRASGVPGRFSGSGSGTDFTLTVSSFQAEDAAVYYCQQSNSSP
Procavia capensis V696 igkv ABRQ01542780.1 5507 VSGDIVMTQSPASLAASPGETVTINCKSSESLLYNSYNRLAWYQQKPGQAPKRLIYDASYRASGVPDRFSGSGSGTGYTLTISRVETEDRAIYYCQQYK
Procavia capensis V699 trav ABRQ01550520.1 940 MSQGENVEQRPSTLSVLEGSSSVINCTYSDSASSYFPWYKQEPGKGPRLIIDIRSNVGQNQDKGLVVLLDKKAKHFSLHIPAAQPGDSAVYFCAAS
Procavia capensis V700 igkv ABRQ01550745.1 1888 ASGNIVMTQSPASLAASPGETVTLKCKSSQGISSYLNWYQQKPGQAPKLLIYGASNRASGVPDRFSGSGSGTDYTLTISSFQAEDAGVYYCQCGYYSA
Procavia capensis V701 igkv ABRQ01550747.1 731 ASGDIVMTQSTASLAASLGETVTIKCKSSQSVSNYLAWHQQKPGQAPKRLIYAASTRASGVPDRFSGSGSGTDFTLTISSFQAEDAASYYCQQYNSYP
Procavia capensis V708 ighv ABRQ01571788.1 2985 GHCQIQLVQSGPELKKPGDSMKISCKASGYTFTSYCMNWVRQRPGQGLEWMAYMCPSSGSTGYAQKFQGRATMTRDTSISTAYLELSRLSSEDTAVYYCAR
Procavia capensis V712 trbv ABRQ01579511.1 1666 HMDAGVTQSPEHKITRTRENVTLGCTQDTNYNNMYWYRQDPGLGLRLVYYSFGINDNWKGDIPDGYNVSRSDTQHFLLTLGSAAVSQTAVYYCANSE
Procavia capensis V714 igkv ABRQ01586213.1 2611 ASGDIVMTQSPASLAASPREMVTISCKASQSVSSYLQWYQQKPGQAPKLLIYSASNRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCFQYNSSP
Procavia capensis V718 igkv ABRQ01589518.1 3151 ANGDIVLTQSPASLAVSPGETVTINCKASQSVINYLAWHQQKPGQAPKPLIYGASNRASGVPDQFSGSGSGTDFTLTISSFQAEDAAVYYCQHGYGTP
Procavia capensis V720 igkv ABRQ01592618.1 1186 TNGDIVMTQTPASLAASPGETVTINCKSSQSVSDYLHWYQQKPGQAPKMLIYGASYRASGIPNRFSGSGSGTDFTLTINSFQAEDAAVYYCEQTY
Procavia capensis V721 trav ABRQ01597886.1 2521 HAKTQSVTQPDHPVSVSEGVSLELGCNYSYDRTPSLFWYRQYPRQGLQLLLKYISGDSLVKGISGFMAEFRKTENSFHLRKSFVHWSDSAEYFCVLS
Procavia capensis V724 igkv ABRQ01606082.1 1174 ASGDTVMTQSPASLAASPGETVTIKCKASQSLESYSYNWLSWHQQKPGQAPKTLIYRASNRASGVPNRFSGSGSGSDFTLTISSFQAEDAAVYYCQQYRYTP
Procavia capensis V725 trdv ABRQ01610262.1 2084 FSKSQSVTQFPPEIFAQAGEFVTLNCKYSVYDPTPVLAWFGRNPSGRIFYLISQSTTHPRTTRNGRFSLNLEKATNTIILTISAVKPGDSGEYFCAIKT
Procavia capensis V726 ighv ABRQ01613346.1 1978 VLSQVQLKESGPEIVKPSETLTLTCTVSGFSLSYYAVSWVRQAPGKGLEWVGAIFSGGSTYYASSLKSRVSITRDTSKNQVYLTMSCVKPEDMAVYYCAR
Procavia capensis V733 igkv ABRQ01630620.1 1083 ASGDIMMTQSPASLAASLGETVTINCKSSESLLYGSYNRLAWYQQKPGQAPKRLIYHASTRVSGVPNRFTGSGSGTDYTLTISKVEAEDGAAYYCHQGRSAP
Procavia capensis V738 igkv ABRQ01640540.1 1718 TSGDIVMTQTPASLAASLGGTVTINCKSSQSLYHSFVEEHLLNWYQQKPGQAPKLLIYWATNRASGVPNRFSGRGSGTDFTLTISGLKTEDVADYYCQQST
Procavia capensis V742 trav ABRQ01649992.1 410 VLSQQNGVKQSAGSLSIIEGDIASLNCTYEDRNSQYFFWYRQYSGKGPEFLISVYSKEHKKEGRLTAQLNKDGQYVSLLITDSRHSDSAMYFCAV
Procavia capensis V744 igkv ABRQ01658102.1 1071 TNGQIVLTQSPASRAFSPGETVTINCKASSSISTSYLHWYQQKPGASPKLLVYSTSTLASGVPSRFSGSGSGTDYSLTISNIREEDAATYFCHQRSSPP
Procavia capensis V751 igkv ABRQ01674503.1 462 ASGDIVMTQSPASLAASPGESVTIKCKSSQGISSYLAWYQQKPGQSPKLLIYDANSRASGIPDRFSGSGSGTDYTLKISCFQAEDAAIYYCQQHY
Procavia capensis V754 trav ABRQ01684828.1 2074 VSSKQEVQQSPPALSAQEGDNLDLNCSYTDSAIYSLHWYRQELGKGLTLLLSIQTNQKEQTNGRLKVTLDKSSRHSALYIASSQTVDSTTYLCAV
Procavia capensis V756 trbv ABRQ01694895.1 824 SMGTTVSQTPGQLVKAREQTAKMKCVPKQGHAAVYWYRQQLGEELQFLIYFNNKQVVDDSGMPKERFSAQCLQNSPCSLEIQPTEPGDSAVYFCASSL
Procavia capensis V760 ighv ABRQ01703044.1 1577 VKAKDHIVQWGEGTLVSSQKLSLACATYTRSVSQYAVSWIRFRQGKGLEWIAIIWPSGNTNYNPTLQSRLKISRDTGKNQVFLELNNVTTEDTGTYYCAQ
Procavia capensis V771 igkv ABRQ01737636.1 1438 ASGDIVMTQSPASLAASLGEKVTINCKSSQSVSSYLAWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQYYSYS
Procavia capensis V128 trgv ABRQ02052190.1 23576 GDTEMRISQDQLTFTRRLGKTAHIGCKLSGGPLENIVVHWYQQKEGEPLQRILYGSTKNYKQDKPNSRMEIDDKENGVSHLMINNVIKEDEATYYCACWD
Procavia capensis V136 iglv ABRQ02055154.1 3285 CGPQPVLHQLPSVSSSLGTKVTLACTMSKNYKVGIYDVNWYQQRPGQPPRFLLRFHSPSNKKQGPEIPPRFSGSRDVASNTWLLSISELQAEDEAVYYCAVGPP
Procavia capensis V235 trbv ABRQ02095483.1 14375 TIDAGVTQSPRYKITRTGGNTTLQCTQDANHYSMYWYRQDPGLGLRLIHYSDSVGDTMNGDIPDGYNVSRPSREHFLLTLGLDPSQTAVYFCAISF
Procavia capensis V236 trbv ABRQ02095484.1 9461 HTDAGVTQSPRHKITSTGGNVTLRCIQDLNHLYMYWYRQDPGMGLQSIYFSINEGDISTGNARKGYSISRSKIKHFFLTLQSAARSQTAVYFCAGRD
Procavia capensis V237 trbv ABRQ02095485.1 3063 HTDAGVTQSPRHKITTTGGNVTLRCLQDLNHRYMYWYRQDPGLGLQLIHFSVDEGDTSTGDALEGYSSSRSQTEHFFLMLQSAAHSQTSVYFCASRD
Procavia capensis V238 trbv ABRQ02095490.1 179 HMDAGVTQSPEHKITRTRENVTLRCTQDTNYNNMYWYRQDPGLGLRLVYYSFGINDNWKGDIPDGYNVSRSDTQHFLLTLGSAAVSQTAVYYCANSE
Procavia capensis V239 trbv ABRQ02095490.1 27206 QMDAGVTQSPRHKITRTGENVTLRCAQDMKHDYMYWYRQDFRRGLQLIYYSYGVNDNYKGDIPDGYQVSRLQTEEFFLLLGSASPLQTAVYFCASRD
Procavia capensis V240 trbv ABRQ02095493.1 7247 AGHVDAGITQTPRHQISRRGGNVTLQCTQCDNHSYMCWHRQDPALGLRLIYYSAGAGATSKGDVLDGYNVSRSNTEHFTLMLESATTSQTAVYFCASSF
Procavia capensis V242 trbv ABRQ02095493.1 31141 RMGATVTQSPKYQVTMVGKLVNLSCFQNLNHNDMYWYQQKGSQAPKLLFYYINMDLNKETDTSDNFQASRPSTSSCGLHIRSPVVGDSATYLCASSR
Procavia capensis V243 trbv ABRQ02095493.1 34759 QMDAGVTQTPRYKVTKMGNEETLGCEPISGHNALFWYKQSSVVGLELLTYLQNQAVVEQVDAFKNRFSAKMPNKSFSTLKIERLEWSDSAMYLCASSP
Procavia capensis V244 trbv ABRQ02095493.1 46265 PVSAMVNQSPKYQVTRVGNLVTLNCSQNLNHEIMYWYQQKQNQPPKLLFYYYDTQFNNETDTSNNFQPIRPDTSSFGLGIRSPGVGDSAMYLCASS
Procavia capensis V245 trbv ABRQ02095493.1 52804 SFGDEVIQTPRHLLKGKGQKVKMDCDPIKGHSFVYWYQHISAKEFKFLISFQNKNIFDGSEMPKDRFLAKCPQDSACRLEIQPAEPQDSAVYFCASSL
Procavia capensis V246 trbv ABRQ02095493.1 58075 ITDSGISQTPKYLLRKEGQEVTLKCEQSFNHDSMYWYRQAPGQGLKLVYYSRIVDDVQEGEAAAGYRASRKKKEHFPLVMKWARRNQTAVYLCASSV
Procavia capensis V247 trbv ABRQ02095493.1 60106 LTLGVLISQHPSRAICKSNYSVTIQCHSAGIQAMTVLWYRQLPGQSFTLIGISNQGSRATYEQGISDTKFPISHPNLTFSSLTVTQAQAEDSSLYFCAVS
Procavia capensis V248 trbv ABRQ02095500.1 1882 HTGAVVTQTPKYEVTRLGELVSLSCSQNLNHDAMYWYQQKQNQAPKLLFYYYDMSFNNETDTDNFQPRRPNTSFLGLVLRSPGMGDSAVYLCASSK
Procavia capensis V249 trbv ABRQ02095501.1 6098 HVDAQVTQTPRYKITRTGRKATLLCSQSRNDNYTCWYRRDPGLGLRLIHYSSLVSITSEGDIPVGYNVSRSHLEHFPLTLESAAPSQTAVYFCASSQ
Procavia capensis V250 trbv ABRQ02095503.1 5055 PVGAMVTQSPKYQVTRVGKLVNLSCSQNLNHDAMYWYQQKQNQAPKLLFHYYYTDFNNETDTSDNFQPSRPNTSFCGLGIRSPGMGDSATYLCASSR
Procavia capensis V251 trbv ABRQ02095505.1 8762 CMDTEVTQTPGQLVKARKQSAKMECAPQIGHIYVSWYRQKLGEELEFMICFQSIDAVDESGMPSDGFSAQSPPNLSCSMQIGSTEPSDSAVYFCSSEE
Procavia capensis V252 trbv ABRQ02095505.1 14163 SMGTTVSQTPGQLVKAREQTAKMKCVPKQGHAAVYWYRQQLGEELQFLIYFNNKQVVDDSGMPKERFSAQCLQNSPCSLEIQPTEPGDSAVYFCASSL
Procavia capensis V253 trbv ABRQ02095506.1 3151 STDTEVTQTPGQLVKARKQRAKMECAPKKGHVYVFWYRQKLGEELKFMIHFQSEDTVDKSGMPDDRFSAQCPQNEPCSMQIKSTEVNDSAVYFCASSE
Procavia capensis V254 trbv ABRQ02095509.1 6015 FMDTGVTQAPRQLVKERKQTAKMDCIPKKEHTRVYWYHQKLGEELKLLIYFQSEKPIDESGMPNERFSAHCPTNSPCSMEIQSMEPGDSAVYYCASGL
Procavia capensis V255 trbv ABRQ02095515.1 637 STDTEVTQTPRQLVRARNQTAKMDCVPKTGHDYVYWYRQKLGEELKFLIYFDNDQAGDASRMPDKRFIAQCPKNSPCSMEIQSTEPKDSAVYFCANRD
Procavia capensis V256 trbv ABRQ02095524.1 1960 STDTEVTQTPGQLVTARNQTAKMDCVPKTGHNHVYWYRHKLGEELRFLIHFQNDEDLDKSGMPKERFSARCPKNSHCTVEIQPTEPEDSAVYFCASSE
Procavia capensis V257 trbv ABRQ02095526.1 3647 SMATDVTQTPRNRITQTEKTVVLECSQTKGHEVMYWYRQDPGLGLRLIYYSVDVNNIEKGEASNGYSASRREKAKFSLSLEASNPNQTALYFCATSD
Procavia capensis V258 trbv ABRQ02095528.1 26 PACADVSQTPRHHVTGTGKKITLECSQTMGYDNMYWYRQDPGKEPQLIHYSYGVNSEEKGELSSRWTTSRKTKEHFPLTLESASLTESAQYLCAASQ
Procavia capensis V259 trbv ABRQ02095531.1 4268 FMGAQIIQTPRYLIRRTGEKALLECIQHNQHDRMFWYRQDPALGLQLVHYSYGVGVTQKGDIPAGYSVARKTTESFILILGSASLNQSSVYLCASNN
Procavia capensis V260 trbv ABRQ02095531.1 13962 SVSSVLVSQKPSRGIFQRGTSVTIQCQVDTQVASNFWYYQPPGQGLTLIATANQGSDATYESGFTKDKFPISRPDLTFSNLTVKNSSPEDSGIYFCSV
Procavia capensis V261 trbv ABRQ02095534.1 6438 SAFGALVSQKPSRDICEREASVTIQCQIDSELTNIFWYRLHPGQGLILIATANVGSEATYENKFTRDKFPISRPNFTFSTLTVSKGSPEDSGFYLCSTG
Procavia capensis V264 trbv ABRQ02097619.1 16170 HAGPGVSQRPSHKVTAKGQEVTLRCDPISGHLSLYWYRQNPEKNMEFLVYFYNEKISEKSETFKDRFSAERPNGSLSTLEIQHVEPGDSAVYFCASSK
Procavia capensis V290 igkv ABRQ02108722.1 348 SSGQIVMTQSPASRAFSPGETVTINCEASTSISTNRLHWYQQKPGAPPKLLVYRTSTLASGVPSRFSGSGSGTDYSLTISNIREEDAAIYYCEQTNSNP
Procavia capensis V333 ighv ABRQ02130997.1 35434 ITAESGPGLAKPSQTLSLTCTVSGFSLSSYAVSWLRQAPAKGLDWVGLITCGGSACYNLALKSQASINRDTSKSQVYLELRSVSPDDTGVYYCAR
Procavia capensis V334 ighv ABRQ02131000.1 6380 GHCQIQLVQSGPELKKPGDSMKISCKASGYTFTSYNMHWVRQCPGQGLEWMGYINPSSGGTGYAQKFQGRVIVTRDTSTSTAYLELSCLSSEDTAVYYCA
Procavia capensis V442 ighv ABRQ02182593.1 8559 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSLSDYAVSWVRQAPGKGLEWIGAIWRDGSTSYNSALKSRLSITKDNSKSQVYFKLSSVSSEDTAVYYCAR
Procavia capensis V443 ighv ABRQ02182599.1 14969 VLSQVTLKESGPGLVKPTQTLSLTCTVSGFSLSTSGVRVSWIRQPPGKALEWLARIDWDDDKYYSSSLKSRLTISKDNSKNQVFLTMKNMDPVDTAIYYCARR
Procavia capensis V444 ighv ABRQ02182600.1 22330 VCAQLQLVQSGAEVKKPGQSLRISCRVSGISSTSFWLSWVRQMPGKGLEWMGMIYLSDSDTRYSPSFQGQITISCDKSISTAYLQWSNLKATDTATYYCAR
Procavia capensis V445 ighv ABRQ02182600.1 30450 VCAQVQLEQSGSELRKPGTSLKISCKTSGYSFTSYWISWVRQMPGKALEWMGKIDPSDSETRYSSSFQGQITISVDKSISTAYLQWSSLKATDTATYYCAR
Procavia capensis V446 ighv ABRQ02182600.1 36993 VCGQVQLEQSGAELKKPGQSLKISCKASGYSFTSKWLSWVRQMPGKGLEWMGAIYPGDSDTRYSSSFQGQVTISTDNSISTAYLQWQSLKTTDTATYYCAR
Procavia capensis V447 ighv ABRQ02182601.1 23366 ICAQVQLEQSGAELKKPGQSLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGEIDPSDSYTSYSPSFQGQITISVDNSISTAYLQWQSLKATDTATYYCAR
Procavia capensis V449 ighv ABRQ02182601.1 53396 VLSQVQLQESGPGLVKPSDTLSLTCAVSGYSITSGYNWSWIRQLTTEGLQWIGYITYNGNTNYNPSLRSRSTISRDTSKNQFSLQLKSVTPDDTAVYYCAR
Procavia capensis V450 ighv ABRQ02182602.1 19177 ILSAPTLRESGQGLVKPSDTLSLTCSVSGVSVSSSDYWSWIRQHPTKGLQWMGYWSGGTSYNSAFQGRISITVDSSKSQFFLKLNSVTTDDTATYYCAR
Procavia capensis V451 ighv ABRQ02182608.1 13083 VLSQVTLQESGPRLLKPSQTLSLTCSVIGGSVTSNSHWNWIRQRPGKGLEWMGHWSGSTSYNSVFQGRVSITTGTANNQFSLQLSSVTTEDTATYYCARGEKKK
Procavia capensis V465 ighv ABRQ02194562.1 2372 AISQVTLQESGPGLIKPRETLSLTCTISGFSLSTSGIRVGWIRQPSGKTLEWLAYIKWDDNKYYNPSLQSRLTISKDNSKNEVILKMTNMDPMDTAMYYCARL
Procavia capensis V466 ighv ABRQ02194564.1 10286 VKAKDHIVQWGEGTLVSSQKLSLACATYTRSVSQYAVSWIRFRQGKGLEWIAIIWPSGNTNYNPTLQSRLKISRDTGKNQVFLELNNVTTEDTGTYYCAQ
Procavia capensis V467 ighv ABRQ02194568.1 20386 ILSQVQLQESGPGVVKPPQTLSLTCAVSGFSLSSYDVSWVRQAPGKGLEWTGVIWSGGSTDYNSALKSRLSITKDNSKSQVYLKLSSVSSEDTAVYYCAR
Procavia capensis V468 ighv ABRQ02194568.1 44851 ILSQVKLQESGPGIVKPSQTLSLTCAVSGFSLSSYAVSWVRQAPGEGLEWIGVIWTGGGTSYNSALQSRLSITKDNSKSQVYLKLNSVSSEDTAVYYCAR
Procavia capensis V469 ighv ABRQ02194568.1 69641 ILSQVKLQESGPGVVKPSQTLSLTCAVSGFSLSSYAVSWVRQAPGKGLEWIGVIWGSGSTYYNSALQSRLSITKDNSKSQVYLKLNSVSSEDTAVYYCAR
Procavia capensis V470 ighv ABRQ02194573.1 518 ILSQVQLQESGPGVVKPSQTLSLTCDVSGFSLSSYHMSWVRQAPGEGLEWIGIITGGGSTYYNSALKSRLSITKDNSKSQVYFKLSSVSSEDTAMYYCAR
Procavia capensis V471 ighv ABRQ02194574.1 112 ILSQVQLQESGPGVVKPSQTLSITCDVSGFSLSSYYISWVRQAPGKGLEWIGVIWTGGSTNYNSAFQSRLSITKDNSKSQVYLKLNSVSSEDTAVYYCAR
Procavia capensis V477 ighv ABRQ02196733.1 11246 VLSQVQLQESGPELVKPSQTVSLTCTVSGFSLTDRGVHWVRQTPGKGLEWIGAIWSGGSTNYNPTLASRVSITRDTSKSQTYFKMNSVTSKDTATYYCAK
Procavia capensis V478 ighv ABRQ02196737.1 7492 VLSQVQLQESGPGLLKPSQTLSLTCTVSGFSLTGSDMHWVRQAPEDGLEWVGVIWASGNTKYNPALASRLSITRDTSKSQVYLKLGSLTSEDTAMYYCAR
Procavia capensis V479 ighv ABRQ02196739.1 4253 VLSQVQLQESGPGLVKPSQTLALTCDVSGFSLTGYYMSWVRQAPGKEPEWIGVIRSSGSTVYSTALASRVSITRDTSKSQVYLKLNSVTAEDTAMYYCAR
Procavia capensis V480 ighv ABRQ02196742.1 12748 AYGQVQLVQSGDELKKPGESVKVSCRGSGYTFTSYAMNWVRQTPEKGLQWMGWINTNTQKPTYAQGFTERYVFSMDASVSTAYLQISNLKTEDTATYYCAR
Procavia capensis V481 ighv ABRQ02196742.1 47200 VDCEVKLVESGGGLRKPGQSLSLSCVASGFTFDNYAMHWVRQAPENGLQWVSSINWNSGSKYYADSVKDRFTISRDNDKNTVFLQMEGLKEDDTGIYYCAK
Procavia capensis V482 ighv ABRQ02196742.1 74793 AHSQVQLVQSGAELKKPGETVKVSCRGSGYTFTSYSINWVQQTPEKGLQYMGWINTETQKPTYAQGFTGRFVFSMDASVSTAYLQISNLKTEDTATYYCAR
Procavia capensis V483 ighv ABRQ02196745.1 3444 ALSQVTLRESGLGLITPGQTLSLTCTFSGFSLSTSGIGVGWIRQPSGKPLEWLTVVWWTDSKNYNPSLKSRLTISKDTSKNQVFLTMTSVGPEDTAMYYCAR
Procavia capensis V484 ighv ABRQ02196747.1 8876 AVSQITLKESGPGLIKPGQTLLLTCTFSGFSLSTRYNGVGWIRQPPGKPLEWLTDIWWDDDKYYNPTLKTRLTVSKDTSKNQVFLTMTSMDPADTATYYCAHK
Procavia capensis V485 ighv ABRQ02196747.1 17692 ALSQVTLRESGPGLITPGQTLSLTCTFSGFSLNTNGIGVGWIRQPSGKPLEWLAHIWWNDDKYYNPSLKSRLTISKDTSKNQVFLKTTSVGPEDTATYYCAR
Procavia capensis V486 ighv ABRQ02196747.1 23900 AVSQITLKESGPGLIKPGQTLSLTCTFSGFSLSTSYNGVSWIRQPPGKTLEWLTNIWWNDNKYYNPTLKTRLTVSKDTSKNQVFLTMTSMDPADTATYYCAHS
Procavia capensis V487 ighv ABRQ02196748.1 22821 AISQVTLQESGPGLIKPSETLSLTCTISGFSLSTSGVRVGWIRQPSGKTLEWLAYIKWDGNKYYNPSLQSRLTISKDNSKNEVILKMTNMDPMDTATYYCAHL
Procavia capensis V495 igkv ABRQ02201759.1 2842 VHGDIVMTQSPASVAASPGETVTINCKSSQGVGNYLHWYQQKPGQAPKLLIYYANRRESGVPDRFSGSGSGTDFTLTISSFQAEDAASYYCQQGNSYP
Procavia capensis V496 igkv ABRQ02201760.1 655 ASGDIVMTQSPASRAASPGETVTINCKSSQSVSNYLDWYQQKPGQAPKLLIYRANSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCYQYDSSP
Procavia capensis V497 igkv ABRQ02201760.1 10281 SSGDIVMTQSPASLAASPGETVRINCKSSQNIGSYLNWYQQKPGQAPKLLIYYANRRESGVPDRFSGSGSRTAFTLTISSFQPEDAAIYYCQQGSSTP
Procavia capensis V498 igkv ABRQ02201760.1 24516 TSGDTVMTQSPTSLAASLGETVTINCKSSQSLYHSNSNKHVLSWYQKKPGQAPKLLIYWANTRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQYVYTP
Procavia capensis V499 igkv ABRQ02201761.1 1788 ASGDIVMTQSPASLAASPGESVTIKCKSSQGISSYLAWYQQKPGQAPKLLIYDANSRASGIPDRFSGSGSGTDYTLKISSFQAEDAAIYYCQQHS
Procavia capensis V500 igkv ABRQ02201762.1 9624 TSGDIVMTQSPASLTVSPGERVTINCKSSQSISNNLHWYQQKPGQAPKLLISYASSRASGVPDRFSGSRSGTNFTLTISSFQAEDAAIYYCQQSNSYP
Procavia capensis V501 igkv ABRQ02201762.1 25075 ASGDILMTQSPTSLAVSPGNTVTINCKSSQSVFYSSNKKDYLSWYQQKQGQAPKLLIHWASTRASGVPDRFSGSGSGTDFTLTISSFQTEDAAVYYCQQYY
Procavia capensis V502 igkv ABRQ02201762.1 33666 ARGDTVMTQSPASLAAPLGETVTINCKSSESLLYYSLDRLSWYQQKAGQAPKLLVCAASNRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQDY
Procavia capensis V503 igkv ABRQ02201762.1 53263 SRGDIVMTQSPAFLAATSGETVTINCKSSQGVSNVLAWHQQKPGQAPKMLIYGASYRASGIPNRFSGSRSGTAFTLTISSFQAEDAAVYYCQQYY
Procavia capensis V504 igkv ABRQ02201762.1 67395 ASGDIVMTQSPASLTISPGETVTINCKSSQNLLSSSKYQLFWYQQKPGQAPNLLIYWESTRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQDY
Procavia capensis V505 igkv ABRQ02201762.1 79871 AIGNIMMTQSPTSLAASPGQTVTINCKSSQSLFGSSDQKHWLAWYQQKPEQSPKLLIYWASTRKSGVPDRFSGGGSGTDFTLTISSFQAEDAAVYYCQQDY
Procavia capensis V506 igkv ABRQ02201762.1 100367 ASGDIVMTQSPTSLAASPGQTITINCKSSQSVSDDVDWYQQKPGQAPKLLIYEASNRMSGVPDRFSGRGSGTDFTFSISSFQVEDAALYYCMQSNTDN
Procavia capensis V507 igkv ABRQ02201764.1 84 ASGDIVMTQSPASLAASVGETVTINCKSSQNVGSEVNWYQQKLGQAPKLLIHYASRRASGVSDRFSGSGSGTAFTLTISSFQAEDAAVYYCQQDY
Procavia capensis V508 igkv ABRQ02201764.1 9659 ANGDIVLTQSPASLAASPGERVTINCKSSQSLTAGSYNLLSWYQQKPGQAPKLLIYDASSRASGVLDRFSGSGSRTDFTLTISSLQAEDAAVYYCQHGYGTP
Procavia capensis V509 igkv ABRQ02201765.1 4042 ASGDIVMTQSPASLAASPGETVTINCKSSQSLVYRSYNLLSWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSETDFTLTISSFQADDAAVYYCQQYYSAP
Procavia capensis V510 igkv ABRQ02201765.1 11245 ANGDIVMTQSPASLAASPGEKVTINCKSSQSLTADSYNLLSWYQQKPGQAPKLLVYAASNRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQGYSYP
Procavia capensis V511 igkv ABRQ02201766.1 5071 ASGDIMMTQSPASLAASPGETVTINCKSSQSLVYGSYNLLFWYQQKPGQAPKLLIYAASNRASGVPDRFSGSGSETDFTLTISSFQAEDAAVYYCQQDY
Procavia capensis V512 igkv ABRQ02201766.1 10867 ASGDIVMTQSPASLAASPGQTVTINCKSSQSLYSSYYKKDWLAWYQQKPGQAPKLLIYAASNRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQHY
Procavia capensis V513 igkv ABRQ02201766.1 24705 ATGDIVMTQSPASLAASPGQTVTINCKASQSLVYGSYNRLSWYQQKPGQAPKLLIYQANRRASGVPDRFSGSGSGTDFTLTINSFQAEDAALYYCQGYASSA
Procavia capensis V514 igkv ABRQ02201766.1 39983 ASGDIVMTQSPASLAASPGQTVTIQCKSSQNLTAGSYNRLSWYQQKLGQAPKLLVYDASSQASGVADHFSGSGSGTDFALTISSFQAEDAAVYYCQQYYSYP
Procavia capensis V515 igkv ABRQ02201766.1 53880 ATGDIVMTQSPASMAAFPGETVTINCRASQSLFGSSSKKERLAWYQQKPGQAPNLLIYWGSTRASGIPDRFSGGGAGTDFTLTISSFQAEDAAVYYCLQDRSAP
Procavia capensis V516 igkv ABRQ02201766.1 68769 ASGDTVMTQSPASLAASPGETVTIKCKASQSLESYFYNWLSWHQQKPGQAPKTLIYRASNRASGVPNRFTGSGSGSDFTLTISSFQAEDAAVYYCQQDH
Procavia capensis V517 igkv ABRQ02201766.1 83535 ASGDIVMTQSPASLAASPGQTVTIKCTSSQSLTSGSYNYLSWYQQKPGQAPKLLIYGASNRESGIPNRFSGSGSGTDFTLTISSFQAEDAADYYCQQTKSTP
Procavia capensis V518 igkv ABRQ02201767.1 6910 ASGDIVMTQSPASLAASPGDTVTIKCKSSQSLTSGSYSYLAWYQQKLGQPPKLLIYRASTQASGVPDRFSGSGSGTDFTLTISNFQTEDAALYYCQQGRSIP
Procavia capensis V519 igkv ABRQ02201769.1 8395 ITGDIVMTQSPASLAASPGQTVTIKCKSSQSLIYNSYNYLAWYQQKPGQAPKLLITWGSTRVPGVPDRFSGSGSGTAFTLTISSFQAEDAAVYYCLQHY
Procavia capensis V522 igkv ABRQ02203305.1 23759 ASGDIMMTQSPASLAASLGETVTINCKSSESLLYGSYNRLAWHQHKPGQAPKLLIYDASFRASGVPDRFTGSGSGTDYTLTISKVEAEDGAAYYCQQGRSAP
Procavia capensis V523 igkv ABRQ02203306.1 1074 VSGDIVMTQSPASLAASPGETVTINCKSSESLLYNSYNRLAWYQQKPGQAPKRLIYDASYRASGVPDRFSGSGSGTGYTLTISRVETEDRAVYYCQQYK
Procavia capensis V524 igkv ABRQ02203306.1 18176 ASGDIVMTQSPASLAVSLGETVTISCKSSESLLYSSYNRLGWYQQKPGQTPKQLIYSASSRVSGVPDRFSGSGSGTDFTLTISKIETEDMGVYYCLQGR
Procavia capensis V525 igkv ABRQ02203307.1 7709 ASGDIVMTQSPASLAASPGETVTINCKASQSLLYSSNNKDYLTWFQQKPGQAPKLLIYLASSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQNHYSSP
Procavia capensis V526 igkv ABRQ02203307.1 29696 GSGDIVLTQSPAFLAASVGETIAITCKSSQSLAYNSYQVLAWYQKKPGEAPALLIYDAVSRPSGVSSRFSGSGSGTDFTLTISSLKTEDVADYYCNQYRSMP
Procavia capensis V527 igkv ABRQ02203308.1 7504 ISEDIMLTQSPAYRTFTPGDTITVSCKANSSVSASYLHWYQQKPGAPIKLLIYGTSYLDSGVPDRFSGSGYGTDYSLTISNIRNEDAAVYYCQQWSSEP
Procavia capensis V528 igkv ABRQ02203309.1 453 TSGQIVLTQSPASRAFTPGETVTINCKASSSVSTNYLHWYQQKPGAPPKLLVYSTSSQASGVPVQFSGRGSGTDYSLTISNTRNEDAAIYYCQQSNSYP
Procavia capensis V529 igkv ABRQ02203309.1 6608 TNGQIVLTQSPASRAFSPGETVTINCKASSSVNSNYLCWFQQKPGASPKLLVYSTSNLASGIPARFSGTGSGTAYSLTISNIKEEDAAVYYCQQWDSN
Procavia capensis V545 trdv ABRQ02211136.1 21260 SIMAQKVTQSPSATSRHEGAAVTLDCLYKTSATSYFIFWYKQLPSGEIFFLIRQLSSEKNAMLGRYSINFQKKDKSISLIISTLQLEDSAVYFCALWE
Procavia capensis V546 trdv ABRQ02211138.1 5368 SSMSQKVTHSQWGISRQEGQSVELDCSYEISYAYYGLLWYKRLPRGEMISLISQFFGEESTAPQDCYSIRFQKAAKTIKLIISTAQLEDSATYFCSFR
Procavia capensis V547 trav ABRQ02211138.1 11202 VRGQKEDVVQSPSILTVRERELAVVNCSYKDGTSTYFPWYKKEAKKGLKLLIEIRSNVDKKSDGRLTVLLNKEAKHVSLHISEAHSGDSALYLCAA
Procavia capensis V550 igkv ABRQ02216147.1 6766 VSGDIVMTQSPASLAATPGETVTINCKSSQNLYSSYYYKDWLAWHQQKPGQAPKLLIHWASSRASGVPDRFSGSGSGTDFTLTINSFQAEDAAVYYCQQTDSAP
Procavia capensis V551 igkv ABRQ02216148.1 23456 VHGDIVMTQSPASLAATPGQTVTINCKSSQSVFNSNVKKDILAWYQQKPGQPPKLLVYHATSRASGVPDRFIGSGSGTAFTLTISSFQPEDAALYYCQQYR
Procavia capensis V552 igkv ABRQ02216148.1 43473 VSGDIVMTQSPASLAATPGQTVTINCKSSESVFDSDDDTNYLSWYQQKQGQAPKLLIYAASNQESGVPDRFSGSGSETDFTLTISSFQAEDAAVYYCMQGYSSP
Procavia capensis V553 igkv ABRQ02216148.1 50881 VSGDIVMTQSPASLAATPGQTVTINCKSSESVFDSDDDTNYLSWYQQKPGQAPKLLIYWATTRESGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCMQSN
Procavia capensis V556 trav ABRQ02217204.1 7974 TTGDAKTTQPNSMWTTEGKPVNLPCDHSGISTNEYIYWYRQIPNQGPEYVIYGIKTNVTNAMASLVIPTDRKSSTLILPRVTPRDAAVYYCIVGE
Procavia capensis V557 igkv ABRQ02220951.1 977 ASGDIVMTQSPASLAASPGETVTINCKSSQSVSDYLDWYQQKPGQAPKLLIYYANSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCYQYNSSP
Procavia capensis V558 igkv ABRQ02220955.1 5273 ATGDIVMTQSPASLAASPGQTVTINCKSSQSLVYGSYSYLHWYQQKPGQAPKLLIYYANSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQSY
Procavia capensis V559 igkv ABRQ02221579.1 14613 TNGDIVMTQTPASLAASPGETVTINCKSSQSVSDYLHWYQQKPGQAPKMLIYGASYRASGIPNRFSGSGSGTDFTLTINSFQAEDAAVYYCEQTY
Procavia capensis V560 igkv ABRQ02221579.1 22922 ASGDIVMTQSPASLAASPGERVTLKCKSSQGVSSYLHWYQQKPGQAPKLLIYYATSRASGVPERFSGSGSGTDYTLTISSFQAEDAALYYCQQTY
Procavia capensis V561 igkv ABRQ02221579.1 34417 TSGDIVMTQTPASLAASPGETVTINCKSSQSLYESDVSAHLLNWYQQKPGQAPKMLIYGASYRASGIPNRFSGSGSGTDFTLTISSFQAEDAAVYYCEQTY
Procavia capensis V562 igkv ABRQ02221581.1 2784 ASGDIVMTQSPASVAASPGETVTINCKSSQSVSSYLNWYQQKPGQAPKLLIYYANSRESGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQHNSDP
Procavia capensis V563 igkv ABRQ02221581.1 25142 TSGDIVMTQTPASLAASLGGTVTINCKSSQSLYHSFVEEHLLNWYQQKPGQAPKLLIYWATNRASGVPNRFSGRGSGTDFTLTISGLKTEDVADYYCQQST
Procavia capensis V564 igkv ABRQ02221581.1 30823 ASGDIVMTQSPASLAASPGETVTINCKSSQGVGSNLHWYQQKPGQAPKLLIYYANRRESGVPDRFSGSGSGTDFTLTISSFQAEDAASYYCQQGSSNP
Procavia capensis V565 igkv ABRQ02221581.1 36875 ASGDIVMTQSPASLAASPREMVTISCKASQSVSSYLQWYQQKPGQAPKLLIYNATNRESGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCFQYNSSP
Procavia capensis V566 igkv ABRQ02221583.1 7109 ATGDIVMTQSPASLAASPGERVTINCKSSQSLVSSSYSYLNWYQQKPGQAPKMLIYGASYRASGIPNRFSGSGSGTDFTLTISSFQAEDAAVYYCQQSY
Procavia capensis V567 igkv ABRQ02222289.1 11443 ANGDIVLTQSPASLAVSPGETVTINCKASQSVISYLAWHQQKPGQAPKLLIYCASNRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQHGYGTP
Procavia capensis V568 igkv ABRQ02222289.1 18421 TNGDIVMTQSPASVAASPGETVTINCKSSQSVYYSSVNKDLLAWYQQKPGQAPRFLIYYASTRASGVPNRFSGSGSGTDFTLTISSFQAEDAAVYYCQQGCGTP
Procavia capensis V569 igkv ABRQ02222292.1 1413 ARGDIVLTQSPASLAVSPGEKVTINCKAGQSISNSLHWYQQKPGQARKLLIYCASNRASGVPDRFSGSRSGTAFTLTISSFQVEDAGDYYCQQGY
Procavia capensis V570 igkv ABRQ02222292.1 14610 ASGDIVMTQSPASLAASLGKTVTLKCKSSQGVSSYLAWYQQKPGQAPKLLIYDASNRESGVPDRFSGSGSGTDYTLTISSFQAEDAGDYYCQQYDNTP
Procavia capensis V571 igkv ABRQ02222294.1 5787 ASGDIVMTQSPASLAVSPGERVTINCKSSQSVDSYLNWYQQKPGQAPKLLIYYTDSRASGVPDRFSGSGSGTDYTLTISSFQAEDAAVYYCQQYDSRP
Procavia capensis V572 igkv ABRQ02222294.1 26509 ASGDIVMTQSPASVAASPGEKVTINCKSSQGVSSYLHWYQQKPGQAPKLLIYNANSRASGVPDRFSGSGSGTDYTLTISSFQAEDDALYYCQQGNSRP
Procavia capensis V573 igkv ABRQ02222299.1 4686 SSGDVVVTQSPASLAVSPGQTATISCKASENIYSALAWYQQKPGQAPKLLIYVASNRASGVPDRFSGSGSGTDYILTISSFQAEDAAVYYCQQYSNYP
Procavia capensis V574 igkv ABRQ02222299.1 18186 ASGDVVMTQSPASLALSLGETATISCKASQNIYSALAWYQQKPGQAPKLLINLGPTPAPGVHDRFSGSGSGTDYTLTISSFQAEDAAVYYCQQYSNYP
Procavia capensis V575 igkv ABRQ02224359.1 5219 VSGDIVMTQSPASLAVSLGGTVTINCKSSQSLYNSNNKKNWLVWHQQKPRQAPRLLIYQASNRASGVPDRFSGSGSGTDFTLTISSFQAEDVANYFCMQVYDTP
Procavia capensis V576 igkv ABRQ02224360.1 2686 VSADIVVTQSPASLAASLGGTVTINCKSSQSLYSSSNKKNWLAWYQQKPGQAPKLLIYQASNRASGVPDRFSGSGSETDFTLTISNFQAEDAAVYYCQQDYSSP
Procavia capensis V577 igkv ABRQ02224361.1 75 VSGDIVMTQSPASLTASLGGTVTINCKSSQSLYSSNNKKNWLVWYQQKPAQAPKLLIYQASNRASGVPDRFSGIGSGTDFTLTISNFQAEDAAVYYCQQDY
Procavia capensis V578 igkv ABRQ02227233.1 14882 ASGDIVMTQSPASLTASLRETVTINCKASENIYSSLAWYQQKPGQAPKLLIYGASIRESGVPDRFSGGGSGTDFTLTISSFQDEDAADYYCQQTY
Procavia capensis V579 igkv ABRQ02227233.1 28317 ASGDIVMTQSPASLVVSPGQTATISCKASQNIYRSLAWYQQKPGQAPKLIIYGTSNRASGVPNRFSGSGSRTDYTLTIRSFQTEDAAVYYCQQSY
Procavia capensis V580 igkv ABRQ02227236.1 813 AIGDLVMTQTPASLAVSLEETATISCKASQNIGGYLAWYQQKPGQAPKLLIYGTSSRESGVPDRFKGTGSGTDYTLTISSFQAEDTADYFCQGYASYA
Procavia capensis V582 igkv ABRQ02232785.1 4190 ASGDLVMTQTPASLDVSLGETATISCKASQNIGSYLAWYQQKPGQAPKLLIYAASSRESGVPDRFKGSRSGTDYTLTISGLQAEDTADYYCQGYASYA
Procavia capensis V583 igkv ABRQ02232785.1 22642 ASGDIVMTQSPASLAVSPGEKATIRCKASQDIGSDLAWYQQKPGQAPKLLIYDASNQASGVADRFQGSGSGADYTLTVSSFQAEDVANYFCMQEY
Procavia capensis V588 ighv ABRQ02238232.1 1356 VLSQVQLQESGPGLVKPSQTLALTCDVSGFSLTGYYMSWVRQAPGKEPEWIGVIRNSGTTSYSTALASRVSITRDTSKSQVYLKLNSVTAEDTAVYYCAR
Procavia capensis V589 ighv ABRQ02240242.1 17986 VLSQVQLKESGPGLVNPSTSPSFSLTCTVSGFSITTNYYYWSWIRQSTEKGLEWIGHIAYNGNTYYNSAFQSRTTISRDTSKNEFTLQLKSVTTDDTAVYYCAR
Procavia capensis V590 ighv ABRQ02240242.1 26510 VLSQVQLKESSPGLVNPSTSPSFSLTCTVSGVSITSSSYYWSWIRQSTEKGLEWIGSIAYSGGTSYNSAFQSRTTISRDTSKNEFSLQLKSVTTDDTAVYYCAR
Procavia capensis V592 igkv ABRQ02242718.1 2222 VSGDTVMTQSPASLTATLGETVTIKCKSSQSVYNSNYKKDFLSWFQQKTGQPPKLLIYYASSRASGIPDRFSGSGSGTDFTLTISGLQAEDVAVYYCMQSNSFP
Procavia capensis V593 igkv ABRQ02242718.1 18178 ASGDIMVDQSPVSVAAFPGETVTINCKVSQSLFSSSYKKDRLAWYQQKPGQAPKLLISWAMTRASGVPDRFTGTGSETDFTLTISSLQAEDAAVYYCHQYYLA
Procavia capensis V594 igkv ABRQ02242718.1 27534 VRGDIVMTQSPASLAASPGETVTINCKSSQGISSNLDWFQQKPGQAPKLLIYRASSRESGVPDRFSGSGSGTDFTFTISSFQAEDTATYYCMQNNNYP
Procavia capensis V595 igkv ABRQ02242718.1 42137 ASGDIVMTQSPASLAASPGETVTLKCKSSQGISSYLNWYQQKTGQAPKLLIYNANSRASGVPNRFSGSGSGTDFTLTISSFQAEDAAVYYCQTFARSA
Procavia capensis V596 igkv ABRQ02242718.1 53927 VSGDIVMSQSPASLAASPGERVTINCKASQSIGTSVQWYQQKPGQAPKLLIYWASSRASGVPDRFSGSGSGTDFTLTISSFQAEDSAVYYCQQGYSYP
Procavia capensis V597 igkv ABRQ02242718.1 67943 ANGDIVMTQSPASEAASSGQTVTINCKSSESVGSYLYWFQQKPGQAPKLLIYGVSNRDSGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCLQAY
Procavia capensis V598 igkv ABRQ02242719.1 5819 VSGDIVMTQSPASLAASPGETVTISCKSSDSLVDGSYHRLAWHQQKPGQAPKLLIYSASYRASGVPDRFSGSGSGKDFTLTISKVETEDRAVYYCQQHKSIP
Procavia capensis V599 igkv ABRQ02242719.1 17055 VSGDIVMTQSPASLAASPGETVTINCKSSESLLRGSYNRLAWYQQKPGQAPKLLIYDASDRISGVSNRFSGSGSGTGYTLTINRAEIEDGAIYYCQQHKSIP
Procavia capensis V600 igkv ABRQ02242720.1 1007 ASGDIMMTQSPASLAASLGETVTINCKSSESLLYGSYNRLAWYQQKPGQAPKRLIYHASTRVSGVPNRFTGSGSGTDYTLTISKVEAEDGAAYYCHQGRSAP
Procavia capensis V602 ighv ABRQ02244446.1 6187 VLSQVQLQESGPGLVKPSQTLSLTCSVSGQSISSYGWSWIRQPPGKGLEWLGVGYYSGSTWKTNYGSSVQSRISITADSSKNQFYLKLSSTTTEDTATYYCAR
Procavia capensis V603 ighv ABRQ02244446.1 11298 VLSQVQLQESGPGLVKPSQTLSLICSVSGESISSGYAYSWIREPPGKGMEWLGARYYYDDSWNTAYSPSVQSRISITADSSKNQLSLELRSVTAEDTAMYYCGI
Procavia capensis V604 trdv ABRQ02245176.1 732 SSMSQRVMQSQPAVSTQQGRTVELDCSYETTFPYYSLLWYKRLPTGKMIFLISQHSSEKSTTPQDRYSIKFQKSTKTIKLIISTAQLEDSAAYFCCLR
Procavia capensis V605 igkv ABRQ02248822.1 50 ASGDIVMTQSPASLAASPGESVTIKCKSSQGISSYLAWYQQKPGQSPKLLIYDANSRASGIPDRFSGSGSGTDYTLKISCFQAEDAAIYYCQQHY
Procavia capensis V606 trav ABRQ02251523.1 140 GSNGNTVIQTQGQVILSKGDLLTVNCSYTSSGYLALFWYVQYPSGGLQLLLKAAKANDKGSKNGFEAMYNVETSSFHLEKASAQESDSAVYYCALN
Procavia capensis V608 igkv ABRQ02255386.1 5373 ANGDIVMTQSPASLAASLGETVTLKCKSSQGVSSYLYWYQQKPGQAPKLLIYRASNRESGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQYSNSP
Procavia capensis V609 igkv ABRQ02260407.1 2186 ASGDIVVTQSPTSLALSLGETATISCKASENIYSALAWYQQKPGQAPKLIIYGTSNRASGVPNRFSGSGSGTDYTLTISSFQAEDAAVYYCQQGSSYP
Procavia capensis V610 igkv ABRQ02260408.1 3867 ASEDIVMTQSPASLAVSPGEKVSMSCKASENIYGRLVWYQQKPGQASKLLIYSTSNRASGVPNRFQGSGSGTDYTLTISSFQTEDAALYYCQQGRSIP
Procavia capensis V611 igkv ABRQ02260408.1 11891 ASGDIVMTQSPASLTASLRETVTINCKASENIYSSLAWYQQKPGQAPKLLIYGASIRESGVPDRFSGGGSGTDFTLTISSFQDEDAADYYCQQTY
Procavia capensis V616 igkv ABRQ02281271.1 7046 VNGDIVMTQSLASLAATPGQTVTINCKSSESVFDSDNNKNYLSWYQQKPGQAPKRLIYWATTRESGVPDRFSGSGSETDFTLTISSFQAEDAAVYYCMQSNSYP
Procavia capensis V620 igkv ABRQ02291373.1 5351 ASGDIVMTQSPASLAASPGQTVTIQCKSSQSLTAGFYNRLAWYQQKPGQAPRLLIYRASSRVSGVPDRFSGSGSGTDFTLTISSFQDEDAAVYYCQGYASSA
Procavia capensis V750 trav ABRQ02052891.1 37281 GTRGDSVTQTEGQVTFSEGTFLTINCTYTATGYPTLLWYIQHPNEGLQFLLKATRANEKGRNNSFEATYSKETSSFHLEKASVHEADSAVYYCALG
Procavia capensis V751 trav ABRQ02052891.1 29284 VLSQQNGVKQSAGSLSIIEGDIASLNCTYEDRNSQYFFWYRQYSGKGPEFLISVYSKEHKKEGRLTAQLNKDGQYVSLLITDSRHSDSAMYFCAV
Procavia capensis V752 trav ABRQ02052891.1 7350 GRRAQTVTQPVDHLFVFEGAPVQVKCNYSYSGSPVLFWYIQYPKEGLQLLLRHISGNSIKGFRGDLDKDKMTFHLKKQSAQEEDSAMYYCAVS
Procavia capensis V753 trav ABRQ02052891.1 4757 VNSQVEQNPEALSIQEGENATMSCSYKSSIDSLQWYRQDSGRGLVRLIMMRSNERQKANGTLIAMLDTSTKGSYLFITASRTADTATYFCAVY
Procavia capensis V754 trav ABRQ02052892.1 23890 HAKTQSVTQPDHPVSVSEGVSLELGCNYSYDRTPSLFWYRQYPRQGLQLLLKYISGDSLVKGISGFMAEFRKTENSFHLRKSFVHWSDSAEYFCVLS
Procavia capensis V755 trav ABRQ02052895.1 10060 ITGDAKTTQPNSVDSTEGKRVNLPCNHSSISTSEYIYWYRQILDQSPEYVIHGLKGNVTEEVAILVIPTDRKSSTLILPHVTLRDAAVYYCMVR
Procavia capensis V756 trdv ABRQ02052896.1 14006 SSMSQKVIQSQLEASGQEGQAIELDCSYEVKFSYYRLFWYKRLPSRVMVFLISQGANKKPATPQDRYSITFKKIAKTIKLITPTAQLEDSAQYFCGLWA
Procavia capensis V757 trav ABRQ02052896.1 9581 VSGQKEDVVQSPSILTVRERETAVINCSYKDGTFYYFPWYKKEAGKGLKLLIEIRSNEDRKRNGRLTVLLNKEAKHVSLHVSATQPGDSALYLCAA
Procavia capensis V758 trav ABRQ02052900.1 300 LRVEMKVEQSPRVLIIQEGRKSSLTCNFSISVTSVQWFQQNPGQQLKLLFYVASGMKQKGRLESTVNTKERYSHLYIKDSQPGDSATYFCAVE
Procavia capensis V759 trav ABRQ02052904.1 34424 GVSSKDIVEQSPPSLNVQEGSSANFTCTFPSSSFYALHWYCWEPAKSPKVLFVLLSDGDELDKGHVRATLNTKKGYSYLYIKGSQLEDSATYLCAF
Procavia capensis V760 trav ABRQ02052904.1 22146 GNGQQVKQIPQFLPILEGENVTIYCNSSSTFNYLQWYVQKPGGRPVFLIKLLKAGDVETQKRLTARFGKTRKDSSLHITATQAADVGTYFCAV
Procavia capensis V761 trav ABRQ02052904.1 14262 ETRAQTVTQADGQISVSDGAPLQLRCNYSYYTVPNLFWYVQYPNKGPRFLLKYISGDTLVKGIKGFEAEFKKNETSFHLRKLSVHWTDSAEYFCAVS
Procavia capensis V762 trav ABRQ02052904.1 3147 ESAGQLKQSPWFLSVQEGENFTTYCNSSSVFTTFVWYRQKPGEGPVFLLRLTKSGDLKQKRITAQFGQARKDSSLRIADAQAEDAGLYLCAGAQYSQ
Procavia capensis V763 trdv ABRQ02052906.1 1885 SIVAQKVTQVQSATSRQEGEAVTLNCLYETSETLYSILWYKQLPSGETIFLIGQLSSGQNSVDHRYSLNLQKEAKSINLTISALQLSDSAMYFCALL
Procavia capensis V764 trav ABRQ02052907.1 27509 VSSKQEVQQSPPALSAQEGDNLAVSCNYTDSAILFLQWYRQDLGKGLTLLLSIQANQGEQMNGRLKVSLDKSSRRSVLNISSSQTCDSTTYLCAA
Procavia capensis V765 trav ABRQ02052907.1 14738 MKGAEVEQSPPVLNLQEGDSYTLRCNFSFSPNNVQWFRQNPGESLTTLFYIPSGTKQLGRLTATTVAKERQSSLHISSSQTTDSAIYFCAVSHSAPP
Procavia capensis V766 trav ABRQ02052908.1 2966 SSGEDQVEQSPPALILQEGEDSNLTCSYSVSSFRGLQWYKQDPGKSPKLLFFLFSVGDDKEKERLRGILSTKESSLYITASELEDSATYLCAV
Procavia capensis V767 trav ABRQ02052915.1 3165 GTKGDSVTQTEGLVTRSEGGHVFLNCTYQISYTTSLFLFWYVQYLDKAPELLLKSSTESKGTENRGFQANLVKSENSFHLQKHSLQMSDTALYYCAMR
Procavia capensis V768 trav ABRQ02052918.1 6965 RTSGDSVTQEGSPVTLTEGASLTLNCTYQTSYLTFLFWYVQYLNKAPELLLKSSSESQEVNSRGFQAKHVKSDSAFPLKKPSVQVSDSAVYYCVMS
Procavia capensis V769 trav ABRQ02052922.1 11543 VNSQIEQNPEVLQVQEGENATMNCSYKSNLNNLQWYRQASGRGLAPLIVIYSNEREKQNRNLRVTLDASTKRSSLFITSSQTADIATYFCAVY
Procavia capensis V770 trav ABRQ02052928.1 2953 LPSQQKGVEQSSGSLSIPEGDTASLNCTYEDSGSQYFLWYRQYSGKGPEFLISMYSKGDKKEGKFTAYLNKDSKHFSLLITDTQPSDSATYFCAV
Procavia capensis V771 trav ABRQ02052930.1 54432 EIRAQSVTQPDVPVSVFEGDSLELKCSYSYSGSLYLYWYVQYPNKGLQFLLKYLSGDNLVKGISGFEAEFRKNESSFNLRKHSAHWKDSAEYFCAVQ
Procavia capensis V772 trav ABRQ02052930.1 48629 NIRAQSVTQHDGPVSASEGASLELVCNYSYSTIPYLFWYRQYPSQGLQLLLMYFSGNALVKGINGFEAEFRRSESSFNLRKHSADWNDSAEYFCAVS
Procavia capensis V773 trav ABRQ02052930.1 22024 VCQGENVEQYPSTLSVLEGSSSVINCTYSDSGSVYFPWYKQEPGKGPQLITDIRSNVGHNQGKGLVVLLDKKARHLSLHISAAQPGDSAIYFCAAR
Procavia capensis V774 trdv ABRQ02052930.1 16388 FSTAQKVTQIQPAVMVREKGAVTLYCAYDTSDSRFSLSWYKQTSSGAMTFLIRQDSYNKENETEGRYFLNFQAAAKSINLVISDLLLADSAVYFCVLRE
Procavia capensis V775 trav ABRQ02052930.1 9468 GASGDSVIQTEGQVTVSERTALTINCTYTATGYPTLFWYIQHRGEGLQLLLKVTKVNEKGRNNGFEATYNKETSSFHLEKASVEESDSAVYYCALS
Procavia capensis V776 trav ABRQ02052932.1 13539 GTSGDSVTQTEGPVTFTEEATMILNCTYETIDPSPYLFWYVQYPNDGLQLLKRSTESEKMDNKGFQANHVKSSKSFLLRKSSIQMSDSAVYYCVLN
Procavia capensis V777 trav ABRQ02052932.1 4227 EIRAQSVTQPDVLVSVSEGDSLELRCSYSYSGTPYLYWYVQHPKKGLQFLLKYYSGDTLVKGTSGFEAELNRSESSFNLRKHSAHWNDSAEYFCAVS
Procavia capensis V778 trav ABRQ02052933.1 2298 HARTQSVTQPDGPVSVSEGASLELGCNYSYGATPYLFWYRQYPSQGLQLLLKYISGNTLVKGVNGFEAEFSRSKSSFNLRKHFAHWKDSAEYFCVLS
Procavia capensis V779 trav ABRQ02052939.1 17436 DIGAQSVTQPDAPVSVSEGHSLELRCNYSYSRTPYLYWYVQHPNKGLQFLLKYLSGDPLVKGISGFEAEFSRSESSFTLRKHSAHWNDSAEYFCALD
Procavia capensis V780 trav ABRQ02052939.1 6433 DSRAQSVTQSDGPFSVSEGASLELGCNYSYGATPSLFWYRQYPSQGLQLLLKYISGNSLVKDANGFEAEFSRSKSSFNLRKHSAHWKDSAEYFCAVG
Procavia capensis V781 trav ABRQ02052940.1 13540 EIGAQSVTQPDALVSVSEGHSLELRCSYSYSGTPYLYWYVQHPNEGLQFLLKYLRGDTLVKGISGFEAEFSRSESSFTLRKHSAHWKDSAEYFCALD
Procavia capensis V782 trav ABRQ02052941.1 4220 GTNGDSVIQTEGPVTLYERAPMVLNCTYQSTYTNPYLFWYVQYPNQGLQFLKHSRETQQMDSKGFQASYGNSDNSFHLKKPTVQTSDSAVYYCVLS
Procavia capensis V783 trav ABRQ02052943.1 21866 MGKGEKLEQSPSLLSVQEEESSFFSCTYTDSASSYFLWYKQELGKGPQLLILILENVDKKQEQRLTVQLNKEEKRFSLHIADTHPGDSATYFCATR
Procavia capensis V784 trav ABRQ02052943.1 9175 MGRGEKVEQSPSLLSVQEGKSSFFNCTYTDSASDYFFWYKQQPGKGLQFLIYTFSSVDKKQERRLTVLLNKKEKHFSLHIADLYPGDSATYFCAAR
Procavia capensis V785 trav ABRQ02052947.1 5530 GVRGVKVEQSPSGLSLQEGTSSTLRCNYSAIIQSLQWFQQNPGGSLISLFFIASGTIQKRRFKSTINSKEFYSTLQIATSQLEDSATYLCAVE
Procavia capensis V786 trav ABRQ02052961.1 2268 SMGQGIQQPTELTVMEGDFVQVNCMYQTSGFNGLCWYQQSDGREPTFLYSNVLGGFEKRARSSSFLSRSSMCSYLLLRELHTKDSACYICAAR
Procavia capensis V788 trgv ABRQ02053138.1 16901 VLGQLKLEQREISVSKQASKRADIICKAYGVNFASEAIHWYRQKSNQIIEHLTYITSTNSPSTINLGEKKNKLMTSINVQESASILTINFLEKEDDAIYYCAVWD
Procavia capensis V789 trgv ABRQ02053138.1 5907 GDTKMTISQDQLSFTRTQGRTVHISCKLSGIPLENIFVHWYQHKEAEPLRRILYSSTRNFKQDKPNPRMETNMKENGVFYLIINNVIKEDEATYYCACWD
Procavia capensis V790 trgv ABRQ02053163.1 11616 VLGQLKLEQREISVSKLASRSADIICKASGVNFASQGIHWYRQKSNQVIEHLTHITSTKSPSRVNLGEKKSILVASINVQESTSILTISFIEREDEATYYCAVWD
Procavia capensis V845 trdv ABRQ02073756.1 7813 YSKAQSVHQSTNALYKKQGESVTLDCTFTVSSSYYVMFWYQQSSSGVIANIIYLRYDSKNSRKGRYSVVFHKPNKAFRLTISALEPQDSAIYFCAVTEI
Procavia capensis V847 trav ABRQ02073769.1 52642 VSSDKVIQNPPSLVIQEGSSVSLSCNYEVTYFESLLWYKQKEKAPTLLVKLFSNEIEKKSGRFCSTLNNKEHFSILHVTALQPRDSATYLCATA
Procavia capensis V848 trav ABRQ02073769.1 47851 VRRADWIRPQETEVSGTAGKAVNLLCYYSASSARTVDLYWYRQYPTRAPEYILYRGWGYSRKGDASFATERFYSKSTANTTNLYLRNLLPADTATYYCALRD
Procavia capensis V849 trdv ABRQ02073769.1 44621 FSKSQSVTQFPPEIFAQAGEFVTLNCKYSVYDPTPVLAWFGRNPSGRIFYLISQSTTHPRTTRNGRFSLNLEKATNTIILTISAVKPGDSGEYFCAIKT
Procavia capensis V850 trav ABRQ02073772.1 319 ITGDAKTTQPNSMESTEGKPVNLPCNHSAITTSEYIHWYRQIPNQGPEYVIHGLNGNVTKEMASLVIPAGRKSSTLILPHVTLKDTAVYYCMVR
Procavia capensis V851 trav ABRQ02073777.1 959 KDKEGQQVKQSPPSLMIQEGKNSILNCDYTNNLFDYFVWYKKSPAKGPELLISIRSVTDRNENERFTVFLNISAKHLSLHIASSQPGDSATYFCAAR
Procavia capensis V852 trav ABRQ02073778.1 8220 VRAEMKVEQSPQVLIIREGRNASLLCNFSESTTNVQWFQQNSGEHLKFLFYIASGVKQKGRLEFTVNTKERYSHLYIKDSQLGDSATYFCAAE
Procavia capensis V853 trav ABRQ02073779.1 5016 ESTQQLEQSPQFLSIQEGKSFTTYCNSSSTFNTFYWYRQRLGQGPVFLLMLTRSGDVKQQKRLMAQFGDARKDSSLHITVTQPEDAGLYLCAG
Procavia capensis V854 trav ABRQ02073793.1 1591 VRGAQVEQSPSVLSLQEGDSDTLRCSFSFSPTAVQWFRQNPEGRLITLFYVASGTKQDGRLNATTVIAQRHSSLYISSSQTTDSALYFCAARHSAPS
Procavia capensis V855 trav ABRQ02073795.1 787 VSSKQEVQQSPPALSAQEGDNLDLNCSYTDSAIYSLHWYRQELGKGLTLLLSIQTNQKEQTNGRLKVTLDKSSRHSALYIASSQTVDSTTYLCAV
Procavia capensis V856 trdv ABRQ02073800.1 15168 SNVAQEVTQNQPTTTVVEKEAVTLTCGYKSPTTNYALSWYKQPLNGELIFLIHQGSYDKQNATKGRYSLNFQKEAKFISLTVRASQVGDSAVYFCTLKDI
Procavia capensis V857 trav ABRQ02073802.1 20414 PELLLKSSTESKVTRPEGTHVILNCTYQNSYTASPFLFWYVQYPSKAPELLLKSSTESKGTENEGFQANLDTSEKSFHLQTHSLQMSDSAVYYCAMR
Procavia capensis V858 trav ABRQ02073802.1 5926 SSGEDQEEQSPLTLILQEGEDSSLNCSYPVSRFSGVQWYKQDPGKGPELLFILYSAGDDKEKERLRGMLSTKGSSLHITASNLEDSATYLCAV
Procavia capensis V859 trav ABRQ02073808.1 9216 VDSQVEQNPEILHIQEGENATMNCSYKSSINNLQWYRQDLGRSLVLLFRILSNEREKHNGNLGATLDTFSKSSSLFITSSQAADSASYFCAVD
Procavia capensis V860 trav ABRQ02073808.1 1929 RISGDSVTQTESPVTLSEGATLTLNCTYQTSYSAFLFWYVQYLNKAPELLLKSSSESQEVNSRDFQAKHVKSDSAFPLKKPSVQVSDSAVYYCVMS
Procavia capensis V861 trav ABRQ02073815.1 23332 MSQGENVEQRPSTLSVLEGSSSVINCTYSDSASSYFPWYKQEPGKGPRLIIDIRSNVGQNQDKGLIVLLDKKAKHFSLHIPAAQPGDSAVYFCAAS
Procavia capensis V862 trav ABRQ02073817.1 4555 ESNEDTVTQTEGQVTLSEGDLLTVNCSYTSTQYPAFFWYVRYPKGSLQLLLKAAKANDKGSKNGFEATYNKETSSFHLKKASAQESDSAVYYCALS
Procavia capensis V863 trav ABRQ02073819.1 6266 GIRAQSVTQPDVLVSVSEGESLELRCSYSYSGILYLYWYVQYPNTGLQFLLKYYSGDTLVKGINGFEAEMRKNDSSFNLRKHSARWKDSAEYLCALD
Procavia capensis V864 trav ABRQ02073820.1 6601 SSTAQTVTQSPQQMSVQEAESVTLDCIYDTSDTDYYLFWYKQPPSGEMIFVIRQEAFKQQNATDKRFSVNFQKAAKSFSLTISNSQLGDTAVYFCVYSS
Procavia capensis V914 trbv ABRQ02095539.1 7735 FGAQTIRQWPEVEVQQAGSPLSLQCTVRGTSNPNLYWYRQATGGPLQLLFTSVSVGDVQAETQEHLSATRPQDGQFTLRAEKLQPRHSGMYLCAWS
Procavia capensis V943 igkv ABRQ02108723.1 18475 ASGQIVLTQSPGSWAFSPGETVTINCNAGSSVGTSYLHWYQQKPGAPPKLLVCKTSNVASGVPARFRDSGSGTDYSLTISNNREEDAAFYYCE
Procavia capensis V944 igkv ABRQ02108723.1 13998 TRADIVLKQSPAFLSVTPGDSVAITCKASQNIDDDIHWYQQKPGEAPKLIVKYATTLMSGVPSRFSGSGYDIDFTLKISNTQSEDAAYYFCQQDDSLP
Procavia capensis V946 igkv ABRQ02108729.1 4397 SSGDVVMTQTPLTLPVAVGETATISCKSSESLLHSNGNTYLLWIQQKPGQAPRSLIYKVSNRYSGVPDRFVGSGSATDFTLKISKVEAEDVAVYYCMQGTKTP
Procavia capensis V947 igkv ABRQ02108733.1 9785 ARCDIQMTQSPPSLSASLGDTVTITCRASQSISSWLAWYQQKPGKSPKLLIYKASTLQSGVPARFKGSGSGTDFTLTISSLETEDFATYYCQQYSSSP
Procavia capensis V948 igkv ABRQ02108733.1 1431 STGDIGMTQTPLTLPVTLGEQATISCKSSQSLLHSNGYTYLHWYQQKPGQAPRPLIYRVSNRFSGIPDRFSGSGSGTDFTLKISRVEAEDVAVYYCMQ
Procavia capensis V972 iglv ABRQ02121950.1 21490 SVASYELTQAPSVSVALGQKATITCSGDNIGNKYTHWYQQKPGQAPVLIIYRDSERPSGIPDRFSGSSSGSTATLTISRLQAKDEADYYCHVWDSNT
Procavia capensis V1065 ighv ABRQ02170437.1 4457 VLSQVQLKESGPGLVNPSTSPSFSLTCTVSGVSITSGSYYWSWIRQSKEKGLEWIGYIAYSGGTGYNSAFQSRTTISRDTSKNEFSLQLKSVTTDDTAVYYCAR
Procavia capensis V1066 ighv ABRQ02170440.1 25241 VLSQITLQESGPGLVKPSQTLSLTCSVSGGSVTSSYWWNWIRQRPGKGLEWMGFWTGSTSYNPVFQGRITITADTAKNQFSLSLSSVTSEDTAIYYCAR
Procavia capensis V1067 ighv ABRQ02170441.1 1650 VLSQITLQESGPGLVKPSQTLSLTCSVSGGSVTSSYWWNWIRQRPGKGLEWMGYWTGSTRYNPVFQGRITITADTAKNQFSLSLSSVTTEDTATYYCAR
Procavia capensis V1109 ighv ABRQ02192326.1 6232 VQCEVQLVESGGDLRKPGGSLRLSCVASGFTFSNNWMNWIRQAPGKGLEWVGEINSDSSSKNYAASVKGRFTISRDNAKNTLYLQMDKLKTEDTAVYYCV
Procavia capensis V1110 ighv ABRQ02192327.1 5684 VQCEVQLVESGGDLRQPGGSLTLSCVASGFTFSNYGMIWVRQPRGKGLEWVGSISSGSSYKYYAPSVEGRFTISRNNAKNTLYLQMNNLETEDAATYYCA
Procavia capensis V1111 ighv ABRQ02192329.1 12201 AQCEAQLVESGGDLRKPGGSLRLSCVASESTFSSYWMHWIRQAPGKGLEWVGNINPDSSSKNYAPSVKGRFTISRDNARNSLYLQMDKLKTEDTATYYCT
Procavia capensis V1112 ighv ABRQ02192336.1 35569 VLSQVQLQESGPGLVKPSQTLSLTCSVSGQSISSEDYLWSWIRQPPGKGLEWLGAGAHIGSWNAAYNPSIQSRISITADLSKNQLLLELRSVTAEDTATYYCAR
Procavia capensis V1113 ighv ABRQ02192336.1 12535 VLSQVQLQESGLGLVKPSQTLSLTCSASGGSISNYVWSWIRQPPGKGLEWLGRGYYSSSTWKTNYGSSVQSQISITADSSKNQFYLKLSSMTTEDTATYYCAR
Procavia capensis V1114 ighv ABRQ02192336.1 7379 VLSQVQLQESGPGLVRPSQTLSLTCSVSGESISSGYAYSWIREPPGKGLEWLGTHYYYDNSWNTAYSPSIQSRISITADSSKNQLLLELRSVTTEDTATYYCGI
Procavia capensis V1115 ighv ABRQ02192337.1 16375 VLLQVQLQESGPVLVRPSQTLSLICSVSGESISSGYAYSWIREPPGKGLEWLGTCYYYDDSWNTAYSPSIQSRISITADSPKNQLLLELRYVTAEDTATYYCAR
Procavia capensis V1116 ighv ABRQ02192337.1 5706 VLSQMQLQESGPGLVKPSQTLSLTCSVSGQSITSIGYGWSWIRQPPGKGLEWLGYGVHIGSWNTAYNPSIQSRISITADSSKNQFLLELRSVTAEDTAMYYCAR
Procavia capensis V1148 ighv ABRQ02207256.1 141710 GHCQIQLVQSGPELKKPGDSMKISCKASGYTFTSYCMNWVRQRPGQGLEWMAYMCPSSGSTGYAQKFQGRATMTRDTSISTAYLELSRLSSEDTAVYYCAR
Procavia capensis V1149 ighv ABRQ02207256.1 128916 GHCQIQLVQSGPELKKPGDSMKISCKASGYTFTNYYMQWVRQRPGQELEWMGYIYPGSSSTSYAQKFQGRVTMTTDTSTNTAYLELSRLSSEDTAVYYCAR
Procavia capensis V1150 ighv ABRQ02207256.1 99001 ILSQVTLKESGPGLIKPTDTLSLTCTVSGFSLSTKNTAVSWIRQPPGKALEWLALIYWDDDKRYSSSLKSRLTISKDNSKNQVFLTMKNMDPTDTATYYCARG
Procavia capensis V1151 ighv ABRQ02207256.1 87302 VHCEEKLVESGGDLRKPGGSLKLSCVASGFAFSNYGMQWIRQYPGKGLEWVAVIWYDGSQKYYADSVKGRFTISRDNSKNTLYLQMDNLRTEDTGVYYCAS
Procavia capensis V1152 ighv ABRQ02207256.1 62252 VYCDVKLVESGGGLRKPGGSLKLSCAVSGFTYSNYVIHWIRQYPGKGLEWVAVTWDGGYQKYHADSVKGRFTISRDNSEDIVYLQMDNLRTEDTATYYCAS
Procavia capensis V1153 ighv ABRQ02207256.1 28184 TNSEIKLVQSGPELKKPGESVKISCKASGYTFTDYYMHWVQQISGKGLEWIARHDPEDGKTMYSQKFQGKATMTSDTSTNTAFMELNNLSPEDTAMYYCA
Procavia capensis V1154 ighv ABRQ02207256.1 5474 VLSQVQLQESGPGLVKPSQTLSLTCSVSGESLSSGYAYSWIRQPPGKGLEWLGYGYYSGSKWKTNYGSSIQSRISITADSSKNQLFLELRSMTAEDTATYYCAR
Procavia capensis V1155 ighv ABRQ02207257.1 940 GHCQIQLVQSGPELKKPGDSMKISCKASGYTFTSYNMHWVRQCPGQGLEWMGYINPSSGGTGYAQKFQGRVIVTRDTSTSTAYLELSCLSSEDTAVYYCV
Procavia capensis V1158 trdv ABRQ02209470.1 3479 KGMPCDELTQSPTEHTAVLGSEATLFCTFNLQSSNPDLFWYRMRPDHSFQFVLYRDNSGYKDADFTGGRFSVKHSHSQKTFHLVISSVRAEDSATYYCAYA
Procavia capensis V1159 trdv ABRQ02209475.1 7475 KGMPCDELTQSPTEHAAVLGSEATLFCTFNLQSSNPDLFWYRMRPDHSFQFVLYRDNSRHKDADFTRGRFSVKHSHSQKAFHLVISSVRAEDSATYYCAYA
Procavia capensis V1162 igkv ABRQ02211500.1 37479 IRGQNILTQSPASKALALGETVTINCKASSSVNTAYFHWYQQKPGTSPKLLVYGTSNLASGVPARFSGSGSGTDYSLRISNIRDEDAAVYYCQQW
Procavia capensis V1163 igkv ABRQ02211500.1 30801 TSGQVVLTQSPASTAFSPGETVTINCKASSSVSTSYFHWYQQKPGSPPKLLVYGTSNLHSGIPSRFSGSGSGTDYALKITSIRDEDAADYFCQAWSSYQ
Procavia capensis V1164 igkv ABRQ02211500.1 9979 SSGQIVMTQSPASRAFSPGETVTINCEASTSISTNRLHWYQQKPGAPPKLLVYRTSTLASGVPSRFSGSGSGTDYSLTISNIREEDAAIYYCEQTNSNP
Procavia capensis V1170 igkv ABRQ02213178.1 2756 SSGDVVVTQSPASLAVSPGQTATISCKASENIYSALAWYQQKPGQAPKLLIYVASNRASGVPDRFSGSGSGTDYILTISSFQAEDAAVYYCQQYSNYP
Procavia capensis V1171 igkv ABRQ02213179.1 8349 ASGDVVVTQSPASLAVSPGQTATISCKASENIYSNLAWYQQKPGQAPKLLIYDANSRASEVPDRFSGSGSGTDYTLTISSFQAEDAAVYYCQQYSDSP
Procavia capensis V1172 igkv ABRQ02213179.1 1708 ASADLVMTQSPASLALPLGETATISCKASENIYSSLAWYQQKPGQPPKLLIYDASSRESGVPDRFKGSGSGTDYTLTISGLQAEDTADYYCQGYASYA
Procavia capensis V1173 igkv ABRQ02213181.1 23370 TSGDIVMTQSPASLAVSPGETATIRCKASQGIGNELSWYQQKPGKAPKLLIYGASTRASGVPDRFRGSRSGADYTLTITSFQNEDVASYYCMHDY
Procavia capensis V1174 igkv ABRQ02213184.1 99960 ATGDIVMTQSPASLAASPGEKVTINCKSTQSLEYNSYNWLAWYQQKPGQAPRLLIYAASNRASGVPDRFSGSGSGTDFTLTISSFQAEDAAFYYCHQTRSTS
Procavia capensis V1175 igkv ABRQ02213184.1 88193 ASGDIVMTQSPASLAASPGETVTISCKSSQSLVYSSYNRLAWYQQKPGQAPKLLIYLASNRASGVPDRFSGSGSETDFTLTISSLQVEDATVYYCQQYSNYP
Procavia capensis V1176 igkv ABRQ02213184.1 78527 ASGDIVMTQSPAALAASPGQTVTIKCKSSQSLVSGSSNYLAWYQQKEGQAPKLLINWASNRASGVPGRFSGSGSGTDFTLTVSSFQAEDAAVYYCQQSNSSP
Procavia capensis V1177 igkv ABRQ02213184.1 58592 ASGDIVMTQSPASLAASLGEKVTINCKSSQSVSSYLAWYQQKPGQAPKLLIYAASSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQQYYSYS
Procavia capensis V1178 igkv ABRQ02213184.1 45767 AFGDIVMTQSPASLAASPGETITINCRASQSVFGSNSKKERLVWYQQKPGQAPKLLIYWGSTRASGVPDRFSGSGSGTDFTLTINSFQAEDAASYYCQQDHSSP
Procavia capensis V1179 igkv ABRQ02213184.1 37153 ASGDIVMTQSPASLAALPGQTVTINCKSSQSLVSGSYNLLSWYQQKPGQAPKLLIYDASSRASGVSDRFSGSGSGTDFTLTISSFQADDAAVYYCLQPC
Procavia capensis V1180 igkv ABRQ02213184.1 19338 ATGDIVMTQSPASLAAIPGETVTINCRASQSVFGSNTKKEYLAWYQHKPGQSPKLLIYWGSTRESGVSDRFSGSGSQTDFTLTIRSFQAEDAAAYYCLQHRSSP
Procavia capensis V1183 trav ABRQ02214979.1 31854 RTKGDSVTQTEGLVTRPEGTRVILNCTYQSSYPNLFLFWYVQYPSKAPELLLKSSTESKGAENEGFQANLVKSENSFHLQKHSLRISDSALYYCAMR
Procavia capensis V1184 trav ABRQ02214979.1 17137 SSGEDQVQQSPQALILQEGEDSSLKCSYSVSNFRGLQWYTQDPGKGPELLFLLYSVGDDKQKERLRSTLSKTESSLYITASKLEDSATYLCAV
Procavia capensis V1185 trav ABRQ02214979.1 1095 GTGTQMVTQPDILVTVSEGDALELRCNYSSSVSPYLFWYMQYPNHHFRLLLKYVSGNTHVSGINGFKAEFRKTDNSFHLRKPSAHWSDSAEYFCALN
Procavia capensis V1190 igkv ABRQ02225642.1 22706 TSGDIVMTQSPGSLAASLGETVTLKCKSSQGIGSYSNWYQQKPGQALKLLIYYATSRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQ
Procavia capensis V1191 igkv ABRQ02225642.1 4370 ANGDIVLTQSPASLAVSPGETVTINCKASQSVISYLAWHQQKPGQAPKLLIYCASNRASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCQHGYGTP
Procavia capensis V1192 igkv ABRQ02225643.1 16282 ANGDIVMTQSPASLAVSVGERVTINCKSSQSVRSYLNWYQQKSGQAPKLLIYWATSRASGVPNRFSGRGSGTDFTLTISSFQAEDAALYYCQQTY
Procavia capensis V1193 igkv ABRQ02225643.1 1327 TSGDIVMTQSPASLAASAGETVTIKCKSSQGISSYLAWYQQKPGQAPKLLIYAASSRASGVPNRFTGRGSGTDFTLTISSFQAEDAGVYYCQQHYNIH
Procavia capensis V1194 igkv ABRQ02225644.1 14293 ASGDIVMTQSTASLAASLGETVTIKCKSSQSVSNYLAWHQQKPGQAPKRLIYAASTRASGVPDRFSGSGSGTDFTLTISSFQAEDAASYYCQQYNSYP
Procavia capensis V1195 igkv ABRQ02225644.1 6868 ASGNIVMTQSPASLAASPGETVTLKCKSSQGISSYLNWYQQKPGQAPKLLIYGASNRASGVPDRFSGSGSGTDYTLTISSFQAEDAGVYYCQYGYYSA
Procavia capensis V1196 ighv ABRQ02226612.1 3153 VLSQVQLKESGPGLVNPSTSPSFSLTCTVSGFSITTKYYYWSWIRQSTEKGLEWIGYIGYGGGTSYNSAFQSRTTISRDTSKNEFSLQLKSVTTDDTAVYYCAR
Procavia capensis V1197 ighv ABRQ02226613.1 26366 VLSQVQLKESGPGLVNPSTSPSFSLTCTVSGFSITTNNYYWSWIRQSTEKGLEWIGHIAYNGNTYYNSAFQSRTTISRDTSKNEFTLQLKSVTTDDTAVYYCAR
Procavia capensis V1198 ighv ABRQ02226613.1 17787 VLSQVQLKESGPGLVNPSTSPSFSLTCTVSGVSVTTNYYYWSWIRQSTEKGLEWIGYIAYNGGTGYNSAFKSRTTISRDTSKNEFSLQLKSVTTDDTAVYYCAR
Procavia capensis V1199 ighv ABRQ02226613.1 12110 VLSQVQLKESGPGLVNPSTSPSFSLTCTVSGFSITTSNYYWNWIRQSTEKGLEWLGLINYNGGTSYNSAFKSRTTISRDTSKNEFSLQLKSVTTDDTAVYYCAR
Procavia capensis V1220 ighv ABRQ02293814.1 3004 ILSQVQLKESGPGVVKPSQTLSLTCAVSGFSLSDYAMSWVRQAPGEGLEWIGIITGGGSTYYNSALKSRLSITKDNSKSQVYLKLSSVSSEDTAVYYCAR
Procavia capensis V1222 trbv ABRQ02294786.1 925 PVSAMVNQSPKYQVTRVGNLVTLNCSQNLNHEIMYWYQQKQNQPPKLLFYYYDTQFNNETDTSNNFQPIRPDTSSFGLGIRSPGVGDSAMYLCASS
Procavia capensis V1223 ighv ABRQ02295890.1 15534 ILSQVTLKESGPGLIKPTDTLSLTCTVSGFSLSTSGIAVSWIRQPPGKALEWLALIYWDDDKHYSSSLKSRLTISKDNSKNQVFLTMKNMDPMDTATYYCARR
Procavia capensis V1224 ighv ABRQ02295890.1 4622 VHCEEKLVESGGDLRKPGGSLKLSCVASGFAFSNYGMQWIRQYPGKGLEWVAVIWYDGSQKYYADSVKGRFTISRDNSKNTLYLQMDNLRTEDTGVYYCAS
Procavia capensis V1225 ighv ABRQ02296022.1 13320 VLSQITLQESGPGLVKPSQTLSLTCSVSGGSVTSSYWWNWIRQRPGKGLEWMGYWTGSTRYNPVFQGRITITADTAKNQFSLSLSSVTTEDTATYYCAR
Procavia capensis V1229 trbv ABRQ02308226.1 2350 PACADVSQTPRHHVTGTGKKITLECSQTMGYDNMYWYRQDPGKEPQLIHYSYGVNSEEKGELSSRWTTSRKTKEHFPLTLESASLTESAQYLCAASQ