WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Oreochromis niloticus AERX00000000.1 (AERX01) 413 282 8 36 31 40 9 7
Oreochromis niloticus MKQE00000000.1 (MKQE01) 634 138 34 175 138 85 7 57
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Oreochromis niloticus Vs213 ighv AERX01063565.1 7503 TEGQTLTESESVIKRPGDSHRLTCTYSGFSSDIHGAWIRQAAGKGPEWIAWIHSNGNEIYHSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Oreochromis niloticus Vs212 ighv AERX01063565.1 909 TESQTLTESESVIKRPGDSHRLTCTYSGFSGDYSNAWIRQAAGKGLEWIAVIWHDSSGSFYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs358 trbv AERX01015471.1 2782 DIRTNNVTQTPTLLLKTGDSAQMYCHHNLHSSYYHMYWFQQLPGESLRLIVHMLPYKAPDFGNISQKKSSANKIVSESGAFTVKHLEPSDSGVYLCAVS
Oreochromis niloticus Vs210 ighv AERX01063562.2 9395 VKCEQLTQPASVIVQPGQRLTITCQVSYSLGYYTAWIRQPAGKGLEWIGMKNTAYSYYKDSLKSKFSIDLETSSKTVTLNGQNMQPEDTAVYYCAR
Oreochromis niloticus Vs217 ighv AERX01063570.2 3447 TEGQTLTESESVIKRPGDSHRLTCTYSGFSGDFHAAWIRQAAGKGLEWVAWISNSGSISYLQSFRGRFTISRDNSRKQVYLQMNSLMTEDSAVYYCARE
Oreochromis niloticus Vs214 ighv AERX01063566.2 966 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFSFGSYAMNWIRQKPGKALEWMGEGYTDSSSNKYVSSLSGRIEITKDTSNSMVHLRLSNLKPEDSAVYYCA
Oreochromis niloticus Vs49 trbv AERX01013604.1 2789 ASDTKSANQTPRSIIKRIGESVQSEFKCSHSIPSYDVILWYKQDEKGVLQLLGYLNVEYPNIEDDVKGKISFDGNGRKHSNLTISNVSVTDSAVYFCAAS
Oreochromis niloticus Vs48 trbv AERX01013604.1 1702 DGSDVNQTSMIWKKQGEDATINCSHTKDFSHNQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTVKDLVPTDKGLYFCAVS
Oreochromis niloticus Vs219 ighv AERX01063570.2 7245 TEGQTLTESESVIKRPGDSHRLTCTYSGFSSDIHGAWIRQAAGKGLEWIAWIQSDSSYIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARY
Oreochromis niloticus Vs218 ighv AERX01063570.2 5887 VKCEQLTQPASVIVQPGQRLTITCQVSYSVSGYYTAWIRQPAGKGLEWIGMKYTGDSHYKDSLKSKFSIDLETSSKTVTLNGQNMQPEDTAVYYCAKKSK
Oreochromis niloticus Vs356 trbv AERX01015471.1 8261 VSLSDQVHQTPANMYKNPNETATLRCLHTISSYNRFLWYKQSQGGQLQLLGYMWGSRPTLEANVSATLDGSADENKNCTLTIEKLQQDSSAVYFCAAS
Oreochromis niloticus Vs357 trbv AERX01015471.1 6095 VSLSDQVHQTPADMYKNPNETATLRCLHTISSYNRFLWYKQSQGGQLQLLGYMVGDSPTPEANVPVIIDGNANANQNCTLTIEKLQQDSSAVYFCAAS
Oreochromis niloticus Vs2 trgv AERX01000785.2 3436 EQLIQEDLTLTRRVGESVSFSCGGTDQCYYSEVFWYQKKEKETFRVILYIDKNSGSVYSGYGHPQKNDFSAQNKQNGCELKIKKMKRDHSATYYCNCYKLD
Oreochromis niloticus Vs215 ighv AERX01063568.1 859 TESQTLTESESVIKRPGDSHRLTCTYSGFSGDYNNAWIRQAAGKGLEWIAFIWHDSSGSFYSQSVRGRFTISKDNSRKQMYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs6 trgv AERX01000819.1 79 EQLIQGDLTLTRRVGESVSFSCGGMEQCSSNYIRWYQKKEEETFLIILYIDRSDGQVSHYNHPQKNDFSALITDSGCDLKIEKVKRDHSATYYCNCWKSA
Oreochromis niloticus Vs7 trgv AERX01000841.2 3218 EQLFQDDVTLTRRVGESVSFSCGGLEKCDSEYIRWYQKKETEKINIILVFNKNSGSVDSSFGHPQKDDFTVKNIQNGCELKIEKVKRDHSATYYCSCYKSA
Oreochromis niloticus Vs8 trgv AERX01000842.1 75 QLIQDDLTLTRRVGESVSFSCGGTDQCSSSYRYWYQKKENETFRIILRINKNNGDIYSGYGHPQKDDFSALNKQNGCELKIEKVKRDHSATYYCSCYKSA
Oreochromis niloticus Vs455 ighv AERX01032502.1 2852 TEGQTLTEFESVVKRPGDSHRLTCTYSGFSYDIAAAWVRQAAGKGLEWNASIYSGGSIYYSQSFRGPFTISRDNSRKQVYLQMNSLTAEDSAVYYCSNVFGDVCY
Oreochromis niloticus Vs518 ighv AERX01043957.2 5579 VDGQTLSESEPVVKRPGESHTLTCTASGFTFSDYWMIWVRQAPGKALEWVASHYNSANIHYSQSVQGRFTISRDNSKQQVYLQMNSLKPEDSAVYYCTRE
Oreochromis niloticus Vs519 ighv AERX01043957.2 4048 VYSIDHIQPSSLVVQPGQSLTITCQVSGYSLSDSGHGTGWIRQGEEKPLEWIFYIWYNGGTYQNDALKNKFSISRDTSAQTVTITGQHLQPEDTAVYYCVC
Oreochromis niloticus Vs353 trbv AERX01015469.2 1571 FCCSVKIYQPPYTLSREGEKSVTLQCEQDNDEYLYMFWYKHTDFRQMQLLTYSINKGIQTTEAPFNETKFFMSRPEVRNSSLHIKRVEPGDSAVYYCASRL
Oreochromis niloticus Vs514 ighv AERX01043956.2 3121 VDGQTLTQSEPAVKRPGDSHRLTCTGSGYNFGGHGMHWIRQAPGKGLEWIAWIDCGSGTFYSDSVRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs515 ighv AERX01043957.2 11399 VEGQTLTESEPVVKRPGESHTLTCTASGFTFTDYYLVWVRQATGKALEWLASHYNSYNIYYSQSVRGRFTISRDNSKQQVYLQMNSLSTEDSAVYYCTRE
Oreochromis niloticus Vs516 ighv AERX01043957.2 9250 VDGQTLTQSEPVVKRPGESHRLTCTASGFTFSDYDMSWIRQAPGKGLEWIARIYTDGSRTFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARV
Oreochromis niloticus Vs517 ighv AERX01043957.2 7550 VYSIDLIQPNSLVVQPGQPLTITCQVSGYSLTDSGYAAAWIRQREGKSMEWIFHTWYDGSSNKNDALKNKFSISRDSSAQTVTITGQNLQPEDTAVYYCARCY
Oreochromis niloticus Vs510 ighv AERX01043955.2 2876 VNCQTLTESEPVDKRPGESHKLTCTTSGFTFSSYSMDWIRQAPGKGLEWIAHIWGSGSNTYYSQSFRGRFTISRDNSRQQLYLQMNNLKTEDSAVYYCARE
Oreochromis niloticus Vs511 ighv AERX01043955.2 2034 HITSASVTTIFSAAQILLLSTASCEKLWSIHTTKYNGITNSWITQNEGKPLEWILHIWYDGSSDHNKVFKNKFSISRDSSVGKVTITGENLQPEDTAIYYCARY
Oreochromis niloticus Vs512 ighv AERX01043956.2 11119 VDGQTLTQSEPTVKRPGESHRLTCTASGYTFGSYSLVWVRQAPGKGLEWIAYIFWSDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Oreochromis niloticus Vs513 ighv AERX01043956.2 5690 VDGQTLTESEPAVKSPGESHRLTCTASGFTFSSYQMGWIRQAAGKGLEWIAFIYTDSSGIFYSQSVRGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs30 igkv AERX01008903.2 107 SDASSSVTQSPVFKAAALGETVSLSCTASKGVDDDLSWYLQKPGQPHKLLFYKISRRQPDTPSHISSSGSEPEFTLTINGVQAADAGDYYCMGAYV
Oreochromis niloticus Vs815 igkv AERX01074037.2 3075 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVYSNNHYLSWYQQKDGGVPKLLIYKSSTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs814 iglv AERX01073455.2 4290 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTDAAYWYKQIPGGVPQFVLKMYHSYSSPSYGSGFSSPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQTWDSNAAV
Oreochromis niloticus Vs817 ighv AERX01074248.1 2833 VNCEQLTQPPSVILQPGQRLTITCQVSYSLGIWTGWIRQPAGKGLEWIGVKGTGGSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus Vs816 ighv AERX01074093.1 2430 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSSYWTNWIRQPAGKGLEWIGMAAGSTTHYKDSLKSKFSISTDSSSKTVTLTGQNLQPEDTAVYYCARK
Oreochromis niloticus Vs810 ighv AERX01072977.2 802 VDGQTLTESEPAVKRPGESHRLTCTGSGYNFGGYGMHWIRQAPGKGLEWIAYIWSGGGTTYYSQSVRGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs813 ighv AERX01073415.1 1550 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSHWMHWIRQAPGKGLEWIATDTSSSTNYYSQSVQGRFTVSKDNNREQLYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs812 ighv AERX01073414.1 1550 VNGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSHWMHWIRQAPGKGLEWIATDTSSSTNYYSQSVQGRFTVSKDNNREQLYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs819 trav AERX01074735.1 328 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETTDTYPYLFWYKQEVNDFPKYVLRRDKTAGDNAQEFPKNGFDAELKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs268 trbv AERX01073867.1 416 ASDTKSVNQTPPSIITRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFNDSAVYFCAAK
Oreochromis niloticus Vs608 ighv AERX01044027.2 1944 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSDYWMQWVRQAPGKALEWVAYISGNSAYIHYSQSVQGRFTISRDNTRQQVYLQMNSLKTEDSAVYYCAREPK
Oreochromis niloticus Vs525 ighv AERX01043960.2 8470 VYGVDLIQPDSMIVQPGQSLTVTCRVSGYSLTDSSYATSWIRQREGKQMDWILTMWSGGSTTNNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs600 ighv AERX01044021.1 3689 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFSSYEMVWVRQAPGKGPEWIAFISTSTSSYATYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus Vs601 ighv AERX01044021.1 601 VKCEQLTQPVSLTVQPGQPLTITCQVSYSVRNYWTHWVRQPAGKGLEWIGEERAGHTTFYKDSLRNKFSISTDSSSNTVTLTGQNVQLEDTAVYYCARE
Oreochromis niloticus Vs602 ighv AERX01044023.2 1356 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYRMAWVRQAPGKGPEWIAYISTSDYSYATSYSQSVQGRFTISRDDSSSKLHQQINSLKTEDTAVYYCAR
Oreochromis niloticus Vs603 ighv AERX01044025.2 9974 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSGYWSHWIRQPAGKGLEWIGMAATGSTTRYKDSLKSKFSISTDSSSNTVTLTGQNLQPDDTAVYYCAM
Oreochromis niloticus Vs604 ighv AERX01044025.2 5871 VKGQTLTESEPAVKQPGQSHRLTCTTSGFTLSSYWIHWIRQAAGKGLEWIAADGGSSSKYYSQSVQGRFTVSRDNSRQQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus Vs605 ighv AERX01044025.2 3267 WSEIKLEQSASEVKRPGERVKLSCIISGYTPTDYYLHWIQQRPGRALEWIGRMNTGSNSARYASSFQSRFIMTEEDSSSKQYLEIKSLTAEDSAVYFCARQ
Oreochromis niloticus Vs606 ighv AERX01044026.2 9739 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYDMAWIRQAPGKGLEWIAYISNSGGSIYYSQSVRGRFTISRDNGREQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs607 ighv AERX01044026.2 5467 VWCDIRLDQPPSEVKRPGETVKISCVTSGYTMTSYGINWIRQKTGKALECMGWINTNTAVASYASAFQNRFTFTQDVPSSTQYLEIKSLTAEDSAVYFCAR
Oreochromis niloticus Vs86 igkv AERX01029070.1 3958 SKPQVPVTQPAAVSSTVGGSVNIKCTTGQDVIFWNNKNYLFWYQHKDGGTPKPLVYNINNRASGIPDRFTGSGSNKDFTLSISRITAEDAAVYYCMGAFDSRYW
Oreochromis niloticus Vs253 trav AERX01072000.2 1072 CRAQKDNVLQAKGEETAAAGGSVTLHCQYESSGTTNYLFWYKQDGNNSPKFILSRVSRDDGKTADEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs520 ighv AERX01043957.2 2618 ADGQTLTQSEPTVKRPGESHRLTCTASGYNFGDRSLVWVRQAHGKGLEWIAYIYWGDGSTSYSQSVRGRFTISKDNSKQQVYLQMNSLKTEDSSVYYCAR
Oreochromis niloticus Vs80 igkv AERX01029018.1 374 SSAEIILTQTPKVQSVVLGQTVSIRCEASSSMGNYLHWYLQKPSEAPKLLVYYATNRQSGVSDRFSGSGSGTDFTLTISRVQAEDAGVYYCGQSGY
Oreochromis niloticus Vs789 ighv AERX01065777.2 2738 TGGQTLTESEPVVKRPGDSHRLTCTYSGFSSDIDAAWIRQAAGKGLEWIAYIEDDSRYIYYSQSVRGRFTISRDNSRKQVYLQMNSLTSEDSAVYYCARD
Oreochromis niloticus Vs788 ighv AERX01065777.2 5634 TEGQTLIESESVVKRPGDSHRLTCTYSGLGGDIVAAWVRQAAGKGLEWIALIYSSSSTYYSQSFSGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCVK
Oreochromis niloticus Vs83 igkv AERX01029037.2 3237 SRGQITVTQPGAVSSAVGGSVNIKCTTSQRVASGNRLAWYQQKDGGVPKLFIYTASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs781 ighv AERX01065769.2 10277 TEGQTLTESEPVVKRPGQSHRLTCTYSGFSSDISAAWIRQAAGKGLEWIAWIRYDGGSTYYSQSFRGRYTISRDNNRKQVYLQMSSLTTEDSAVYYCARE
Oreochromis niloticus Vs780 ighv AERX01065766.2 722 SEGQTLTESESVVKRPGDSHRLTCTYSGFSSDIDAAWIRQAAGKKAEWIALIYSGSIYIYYSQSVRGRFTISRDNSRKQVYLQMSSLTAEDSGVYYCPQE
Oreochromis niloticus Vs783 ighv AERX01065770.1 3342 NISVGTESQTLIQSEPVIKRPGESHRLTCTYSGFSSDYATAWIRQAAGKGLEWVAWIQSDSSYIYHSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs522 ighv AERX01043960.2 19927 VYGIDLIQPDSRIVQPGQSLTITCQVSGYSLTSFGTGWVRQREGKPLEWINTIWSERSTDNNNALKNKFSISRDISAQTVTITGQNLQPEDTAVYYCA
Oreochromis niloticus Vs785 ighv AERX01065771.1 4694 VNCEQLTQPPSVILQPGQRLTITCQVSYSLGYLTAWIRQPAGKGLEWIGMKNTGGSYYKDSLKSKFNIDLDTSSNTVTLNGQNMQPEDSAVYYCARE
Oreochromis niloticus Vs784 ighv AERX01065770.1 2135 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDIVAAWVRQAAGKYLEWIAVIYSGGSTDYSQSFRGRFSISRDNSRKQVYLQMSSLTTEDSAVYYCAR
Oreochromis niloticus Vs787 ighv AERX01065776.1 1718 TDGQTLTESESVVKRPGDSHRLTCTYSGFSSDIYAHWIRQAAGKRPEWIAYINPSSSSIYYSQSVRGRFMISRDNNRKQVYLEMNSLKTEDSAVYYCARR
Oreochromis niloticus Vs786 ighv AERX01065771.1 2176 TESQTLTESESVIKRPGDSHRLTCTYSGFGGDYNNAWIRQAAGKGLERIAVIWSDSSGSYYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Oreochromis niloticus Vs265 ighv AERX01073821.1 745 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSSYWTNWIRQPAGKGLEWIGMAAGSTTHYKDSLKSKFSISTDSSSKTVTLTGQNLQPEDTAVYYCARK
Oreochromis niloticus Vs774 ighv AERX01065760.2 1573 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGYWTAWIRHPAGKGLEWIGVKSTGSSYYKDSLKTKFSIDLDTSSNTVTLNGQNMQPEDSAVYYCARV
Oreochromis niloticus Vs775 ighv AERX01065761.2 3461 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFNCCTMSWIRQKPGRALEWMGIGFSSSSRNRYVSSLSGRIEISRDDSNSMVHLRLSSLKPEDSAVYYCA
Oreochromis niloticus Vs776 ighv AERX01065762.2 6964 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFISYYMNWVRQAPGKGLEWIATLDNGSGSSKSYSQSVQGRFTISRDNSKQQLYLKMNSLKTEDSAVYYCA
Oreochromis niloticus Vs777 ighv AERX01065762.2 3501 VQCEQLTQPAYVTKQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGSKFTGASYYKDSLKSKFSIDLDSSSNRVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus Vs771 trbv AERX01065145.2 3352 VCLGVKVFQTPVEIFRTPGENVQLVCSHEKTDYVVMQWYQKSPGDQALKRIGHLYYNNKEHEESFKTHFNISGDLSGDNAKNASMFIVDLKAPEHSAVYYCAASF
Oreochromis niloticus Vs773 ighv AERX01065760.2 4134 TEGQTLTESESVIKRPGDSHRLTCRYSGFSSGIHVAWIRQAAGKGLEWIAWIYWDGSDIYYSQSFRGRFTISRDNNRKQVYLQMNSLTTEDSAVYYCANE
Oreochromis niloticus Vs392 iglv AERX01023659.2 4279 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTDAAYWYKQIPGGVPQFVLKMYHSYSSPSYGSGFSSPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQTWDSNAAV
Oreochromis niloticus Vs778 ighv AERX01065764.2 3041 VDGQTLTESEPAVKRPGESHRLTCTASGFSFSSFEMNWVRQAPGKGLEWVAYINSGGGSKHYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCVRE
Oreochromis niloticus Vs779 ighv AERX01065766.2 1931 NISVGTESQTLIQSEPVIKRPGESHRLTCTYSGFSSDYATAWIRQAAGKGLEWVAWIQSDSSYIYHSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs88 igkv AERX01029081.2 75 SRGQYTLTQPGAVSSAVGDTVTIKCRTSYNVYSSNRLAWYQQKDGETPKLLIYRASTQVSGISDRFNASGLDSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs678 trav AERX01049575.1 341 CNGEDKVIQEQGDVIAAEGDTVTLGCRYETSDPGPTLFWYKQDGNNSPKLILSRVSRNDGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs677 trav AERX01049574.2 10104 CKGEDKVIQEQRDVIAAEGDTVTLYCKYETTSAFPYLFWYKQDVNDYPKYVLRRDASGTENAQEFPKHRFDAELNKTSVSLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs670 igkv AERX01044399.1 1822 SSGQIIVTQSPGAQSVVAGQSVSITCRTSSSVYSIYYKKNLLSWYLQKPGGAPKLLIYHATSRQSGVSDRFSGSGSKTDFTLSIRGVQAEDSGVYYCQS
Oreochromis niloticus Vs158 ighv AERX01054523.2 7972 VYSIDLVQPESRVLPPGQSLTITCQVSGYSMTDNSYGTGWVRQREGKAMDWIFQQWGGGSLWQNDAFENKFSYSRDTSARTATITGQNLQTEDTAVYYCVRVS
Oreochromis niloticus Vs159 ighv AERX01054523.2 10000 VDSQTITQSESVVKRPAESHKLTCTGSDIDFSSNWMAWIRQAPGKGLEWIAIIEDDSDNIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus Vs154 ighv AERX01054522.2 3825 ARCQSLTSSEPVVSRPGQSVTLSCRVQGLSLAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSHQGQFSITKDTSQNRVNLVVNSLKQEDSAVYYCARE
Oreochromis niloticus Vs155 ighv AERX01054523.2 538 VYSIDLLQPDSSIVQPGQTLTITCQVSGYSLTDNTYATGWVRQREGKPMDWIFHQWGGGDFYKNDALKNKFSYSRDTSARTVTITGQNLQTEDTAVYYCVRR
Oreochromis niloticus Vs156 ighv AERX01054523.2 2812 VCSQTLTESEPVIKRPGESHKLTCTYAGISDSSDMSWIREAEGKGLEWVAYISDPSGSTKYYSTAVLNRFTISRDNNVDQVYLHMSSLTTDDSAVYYCAQT
Oreochromis niloticus Vs157 ighv AERX01054523.2 3897 VCSQTLTESEAVIKRPGDSHKLTCTYAGISDGSADISWIQHTEGKGLERVAHISAPSGGTTVYSTSVQNRFTISRDNNVDQVYLQMNRLIAEDSAVYYCARK
Oreochromis niloticus Vs152 ighv AERX01054518.2 3571 VDSQTITQSESVVKKPAESHKLTCTGSDISFSSRWMAWIRQAPGKGLEWIAIIEYDSDRIFYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus Vs153 ighv AERX01054521.2 2361 VDSQTIIQSEPVAKRPGESHRLTCTGSNIEFSSYWMACIRQAPGKGLEWVAVIRYDSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCV
Oreochromis niloticus Vs550 ighv AERX01043982.2 1967 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSDYGMSWVRQAPGNGLEWIAHIFTDGSRTFYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARY
Oreochromis niloticus Vs551 ighv AERX01043983.2 6769 VDGQTLTESESVIKRPGESHRLTCTASGFTFSSYWMTWVRQAPGKGLEWIASIYDSSSIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus Vs552 ighv AERX01043983.2 3622 VDGQTLTESEPAVKRPGDSHRLTCTTSGFTFSSYDMNWIRQAPGKGLEWIAHIWSSGSTTYYSQSVQCRFTISRDNNRQQLYLQMNRLKTEDSAVYYCA
Oreochromis niloticus Vs553 ighv AERX01043983.2 1450 LYCIDHIQPDLLVVQPGQSLTITCQISGYSSGYATGWIRQREGKALEWIFHIWYDVSTVKNDAFKNKFSISRDNSAETVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs554 ighv AERX01043984.2 2690 VYSIDLIQPDSRVTQPGQSLTITCQVSGYSITSHGTVWIRQREGKQLEWILIIWRGGSIDKNDALINKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs555 ighv AERX01043984.2 335 VYGVDLIQPDSMIVQPGQSLTVTCRVSGYSLTDSSYATSWIRQREGKQMDWIFTMWSGGSSTNNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs556 ighv AERX01043985.2 2010 VYCIDLNQPESRVVQPGQSMTITCRVSGYSLTDGNYGTCWIRQREGKQMDWINCIWSGGSSDNNDALKNKFSISRDTSAQTLTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs557 ighv AERX01043987.2 6436 VKCEQLTQSTAMTVQPGQPLTITCQVSYSLGTAWTHWIRQPAGKPLEWISRDTAVKDSLNNKFSVELDSSSNTVTLTGQNLQPEDTAVYYCAREP
Oreochromis niloticus Vs558 ighv AERX01043987.2 3395 VYSIDLIQPDSRIVQPGQSLTITCQVSGYSVTSYATAWVRQREGKPVEWINTIWTGGSTANNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARD
Oreochromis niloticus Vs559 ighv AERX01043987.2 641 VYSIDLIQPDSRVLQPGQPLTIVCQVSGYSLTDGSSATCWVRQRKGQHIDWINCMYYDGSTPNNDALKNKFSVNRDTSAQTVTITGQNLQPEDTAVYYCAR
Oreochromis niloticus Vs71 igkv AERX01024277.1 5953 HLSAVIQSATVKQDTGVRFAAIGDNVTLQCFYESQVAMHFSWYRQFLGSQPKLLSTIYKYDKPSEVLHTLEKNPRFSVERKEGTNHLQISGVHLSDSATYYCGS
Oreochromis niloticus Vs257 igkv AERX01072298.2 362 SSGEIILTQTPGSQSVVLGQTVSVRCKASSSVSTCLHWYLQKDGESPKLLIYYATSRQSGVSERFSGSGSGTDYTLTTSRVQAEDAGVYYCQQCNSWP
Oreochromis niloticus Vs524 ighv AERX01043960.2 13193 VYCIDLNQPESRVVQPGQSMTITCRVSGYSLTDSSYGTCWVRQRQRQQMDWINCMWSGGSTDNNDALKNKFSLSRDTSAETLTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs527 ighv AERX01043960.2 3303 VDGQTLTESEPAVKRPGDSHTLTCTTSGFTFSSYDMNWIRQAPGKGLEWIAHIWGSGSTTYYSQSVQGRFTISRDNNRQQLYLQMNRLKTEDSAVYYCARE
Oreochromis niloticus Vs526 ighv AERX01043960.2 6445 VDGQTLTESESVIKRPGESHRLTCTASGFTFSSYWMTWVRQAPGKGLEWIASIYDSSSIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus Vs521 ighv AERX01043959.1 717 VYSIDLIRPESRAVQPGQSLTITCQVSGYSITSYPTAWIRQREGKQLEWILIIWSGGSTDENDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs252 iglv AERX01071703.1 1572 VTGVTVLTQKPPVLSVSKGDTATMDCNLGTVNISNARWYKQIPGGSPQFVLRFYHTWGSPTYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCK
Oreochromis niloticus Vs523 ighv AERX01043960.2 17359 VYSIDLIQPDSRVLQPGQPLTIICQVSGYSLTDGSYGTCWVRQRQRQKMDWINCMCYNGNTANNNALKNKFSVSRDTSARTLTITGQNLQPEDTAVYYCAR
Oreochromis niloticus Vs250 igkv AERX01070176.2 87 SRGQITVTQPGAVSSAVGGTVSIKCRTSQNVYVHSNSHCLAWYQQKDGGVPKRLIYYASTRYSGIPARFTGTGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs394 iglv AERX01023691.2 6035 VSGLTVLTQKPPVVSVSKGQTATMDCNLGTVTNYPAYWYKQIPGGVPQYVVRFRHSWSSPEYGSGFSSPKFTCTHQSTTDYRLIIKNVEEGDSAVYYCKTW
Oreochromis niloticus Vs529 ighv AERX01043962.1 5062 VECEQLNQPASVTVQPGQRLTITCQVSYSVSGYWTHWIRQPAGKRLEWIGMAATGYTTYYKDSLKSKFSISTDSSSKTVTLTGQNVQPDDTAVYYCARN
Oreochromis niloticus Vs393 iglv AERX01023668.2 8610 VTVVTQKPPVVPVSKGETATMDCNLGTVTNYAAWWYKQIPGGVPQHVVRFHLSWGSPSYGPGFSSPKFTCTHQSTTDYRLIIRNVEEGDSAVYYCKTW
Oreochromis niloticus Vs390 iglv AERX01023656.2 3658 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTNSGVRWYKQISGFPQFVLYFIHSSSVPTYGSGFSSPKFTSTHQSRSDYRLIINNVEEGDSAVYYCQTWDSSVN
Oreochromis niloticus Vs258 ighv AERX01072428.2 688 TDSQTLTESESVIKRPGDSHRLICTYSGFSDDINAGWIRQAAGKGLEWIAFIEDDRSYIHYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCA
Oreochromis niloticus Vs84 igkv AERX01029056.2 125 SRGQITVTQPGAVSSAVGGTVNIKCRTSQDVYSSNCLAWYQQKDGGVPKLLIYYASSRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs738 trbv AERX01065132.1 1822 GADGSDVQQTPILWEREGKSATMQCNHTKGSDYLWMYWFRQLPGEKLTLIVFATTGKTDNEHDYGDFSTGKFSASKTVAESGTFTVNKLEPKDQGWYFCAVS
Oreochromis niloticus Vs632 ighv AERX01044048.2 5580 IDGQTLTQSEPVVKKPGESHRLTCTTSGLPFSSWWMAWIRQAPGKGLEWIVSNTNRGTNYYSQSVRGRFTASRDNSREQLFLQINNLKTEDSAVYYCARD
Oreochromis niloticus Vs635 ighv AERX01044050.1 808 TKGQTLTQSEPVIKRPGESHRLTCTYSGINSNYDTAWIRQAAGKGLEWVAWIYYDGSLISYSQSVRGRFTISRDNSRKQVYLQMNSLMTEDSAVYYCAQE
Oreochromis niloticus Vs634 ighv AERX01044049.2 6070 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISDGSRTIRYSESFRGRFTISRDNSRKQVYLQMNRLTTEDSAVYYCARY
Oreochromis niloticus Vs637 ighv AERX01044052.1 5649 IKCQTLTQSEPVVKNPGESHRLTCTYSGFSGHSATVWIRQAAGKGLEWIAYISSGSITISYYSQSVQGRFTISRDNSRKQVYLQMNSLTVEDSAVYYCAPV
Oreochromis niloticus Vs636 ighv AERX01044051.1 496 VKCEQLTQPASVIVQPSQHLTITCQVSYSLGWYTAWIRQPAGKGLEWIGMKHTSTSYYKDSLKNKFSINLDTSSNTVTLNGQNVQPEDTAVYYCAR
Oreochromis niloticus Vs730 trbv AERX01065128.1 401 SSGSHQVDQTPANIYSKGEEAKLYCSLSISGYYQILWYKQSKKQLQYLGYIYSGKSSLETGVNVTIDGGAEKGENCTLTIKDLKVSSSGVYFCAAT
Oreochromis niloticus Vs638 ighv AERX01044052.1 4195 TEGQTLTQSEPVVKRPGDSHRLTCTYSGFSYDIAAAWIRQAAGKGLEWIARIYDTGSSTRYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs732 trbv AERX01065131.1 7336 LTDGSDVEQTPTLWEKEGKSATMQCNHTKDFTYSYMYWFRQLPGETMTLIVFATTGKKDNEHDYGNFDKEKFSASKPVAESGTFTVKNLKPEDKGWYFCAVS
Oreochromis niloticus Vs733 trbv AERX01065131.1 3898 GTDGSDVQQTPILWGRVGGSATMYCNHTKGDVYFQMCWYRQLPGQTLELIVFISIAKNGDDHDYGNLNTEKFSASKSVPESGTLTVKNLEPKDRGLYFCVVS
Oreochromis niloticus Vs734 trbv AERX01065131.1 3223 LTGGSDVSQTPLLWSTEGQSVTMNCSHTKGGTYRQMYWYQQLPGKGMKQIVFTTAYSTHTYESGFSEERFPATKTNEQTGSLTVKQLVPEDSGVYFCSVS
Oreochromis niloticus Vs736 trbv AERX01065131.1 1457 VPKSGVHQTPAALIKAPGEEIQIHCNHSNNKFDMIQWYKQSPGKNEMILLGYARFTFTAVEDAFENIYKVTGEGSRLSTFHIPKLRESVDSAMYFCAASA
Oreochromis niloticus Vs737 trbv AERX01065131.1 448 SSFSDKVDQTPANIYTTGENVKIYCSHSITNYNRILWYKQSKTQLQLLGFLFSGRGTIEPGVNVTMDGGANEKEKCTLTIKDIELSSSGVYFCAAY
Oreochromis niloticus Vs594 ighv AERX01044018.1 2181 VKGQTLTESEPAVIQPGESHRLTCTTSGISFSSNTMVWIRQAPGKGLEWIAYINSNSAYIYYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCAR
Oreochromis niloticus Vs595 ighv AERX01044020.2 13095 VWSEIKLEQSPSEVKGFGERVKMSCTLSGYTLTDHDIHWIRQRPGRALEWIGYMSTGYNSPGYGSSFQSRFIMTEEDSSSRQYLDINGLTAEDSAVYFCARQ
Oreochromis niloticus Vs596 ighv AERX01044020.2 11553 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSSYWTNWIRQPAGKGLEWIGMAAGSTTHYKDSLKSKFSISTDSSSKTVTLTGQNLQPEDTAVYYCARK
Oreochromis niloticus Vs597 ighv AERX01044020.2 8527 VDGQTLTESEPAVKRPGESHRLTCTASGFTFSSYYMAWVRQAPGKALEWIARITNSGSSTWYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs590 ighv AERX01044015.2 20480 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYSMAWIRQAPGKGLEWIALISSSGASIYYSQSVRGRFTISRDNGREQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus Vs591 ighv AERX01044015.2 19017 VWSEIKLEQDPSQVERPGEKVKMSCILSGYTLTGYNISWIQQRPGGALEWIGWMSTGRNSAAYGSSFQSCVIMTEYDSSKQYICCLLM
Oreochromis niloticus Vs592 ighv AERX01044015.2 13210 VNGQTLTESEPAVKQPGQSHRLTCTASGFTLSSYWIGWVRQAPGKGLEWIATDGGSSSKYYSQSVQGRFTVSRDNSRQQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs593 ighv AERX01044015.2 5066 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYRMVWVRQAPGKGLEWIAYISTSSSPIHYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARC
Oreochromis niloticus Vs598 ighv AERX01044020.2 2565 VKCEQLTQPASMLVQPGQRLTITCQVSYSLSTYYTAWIRQPAGKVLEWMSDDGTVKDSLKNKFSVELDSSSKTVTLKGQNLQPEDTAVYYCARRR
Oreochromis niloticus Vs599 ighv AERX01044021.1 6212 VDGQTLTQSEPDLIKRPGESHILTCTASGFTFRDYWMVWVRQAPGKGPEWIALIRISTQSYATSYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus Vs189 trav AERX01061717.2 312 SSEDLLTPSKDVVMSLEGDTVTLSCKYSAVVQTLFWYHQKSGSRPQLLMADYSPQTEKLKFIHEREKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus Vs188 trav AERX01061695.2 2501 CKGEDKVIQEQGDVIAAEGDTVTLGCTFTSQTTPTLFWYKQEVNAYPKYILRKFLSGATDKAPEFQEDRFDAKINETSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs187 trav AERX01061692.2 1390 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVRNLYWYHQKSGSRPQLLMAEHSAQTEKLKFIHDREKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus Vs186 trav AERX01061683.1 255 SSVDLLTPSKDAVMSLEGETVTVSCNYSGSVSYFFWYKQKSSSHPQFLINEYSEQTEKLKFRKDQDKSEFYLQISSAAVTDSAVYYCAVRPTVTG
Oreochromis niloticus Vs185 trgv AERX01061331.2 205 EQLFQDDVTLTRRVGESVSFSCGGLEKCDSEYIRWYQKKETEKINIILVFNKNSGSVDSSFGHPQKDDFTVKNIQNGCELKIEKVKRDHSATYYCSCYKSA
Oreochromis niloticus Vs182 trav AERX01060103.1 187 CKGEDKVIQEQGDVIAAEGDTVTLDCRYETTDAYPYLFWYKQEINEFPKYVLRRDTTGTEDNDQEFPKDRFDAKINKIQQSVPLKIQKLHLSDSAVYYCALQ
Oreochromis niloticus Vs181 trav AERX01060092.2 7 EDKVIQEQGDVIAAEGDTVTLGCTFETSDPFPYLFWYKQEINDFPKYVLLRGTSGTAENAQEFPKDRFDAELNKREKSVPLKIQKLQLSDSAVYYCALQPTVTG
Oreochromis niloticus Vs180 trdv AERX01060091.1 195 LTAGVSITPQQTEVTETEGKSVKLTCSYQTTASGAYLYWYRHDSDLQAPQFILWKGARSLSSEYIPDKRYKTQTSDRATTLTITALTLADTALYYCALQ
Oreochromis niloticus Vs747 trbv AERX01065137.1 6002 HSQDVTQEPEISWRFLNKAAEMNCSHNKDTRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus Vs746 trbv AERX01065137.1 8020 SSLSDQVFQTPANMYKNQGQRAEINCSHSIAGYDRILWYKQTKSKQLHFLGYMVVSQGAPESGWRVDIKGSANPHQTCTLIIKDLTLNSSAVYFCAAR
Oreochromis niloticus Vs740 trbv AERX01065134.1 2325 FSFCVKIQQDPFINSHIGDRSATLSCSQDEDNSYMFWYRQSKSGKIELITYSLGEKVWDTEAPFNKSKYSMSRPSLLRSSLQIHSVEAGDSAVYYCVSRR
Oreochromis niloticus Vs165 igkv AERX01057057.1 1260 SSAEIILTQTPKAQSVVPGQTVSIRCKSSTSIGDDIDWYLQKSGKAPKLLIYDTTARQSGVPDRFWSTAVQTDFTLIISGVQTEDAGVYYCQ
Oreochromis niloticus Vs164 igkv AERX01057046.2 1364 SSGEIILTQTPGSQSVVPGQTVSVRCKASSSVSNNLHWYLQKDGESPKLLIYSATSRQSGISDRFSGSGSGTDYTLTVSRVQAEDAGVYYCQQGYSFP
Oreochromis niloticus Vs167 igkv AERX01057073.1 149 SWGQKVLTQSPGSQSVVPGQTVSVRCKASSSVSTCLHWYLQKDGESPKLLIYYATSRQSGVSDRFSGSGSGTDFTLTISRVQAEDAGVYYCQQCNSFP
Oreochromis niloticus Vs208 ighv AERX01063562.2 3064 TEGQTLTESESVVKRPGDSHRLTCTYSGFSDNIHAGWVRQAAGKGLEWIAWIHSNGKDIFYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARERD
Oreochromis niloticus Vs209 ighv AERX01063562.2 5663 TEGQTLTESEPVVRRAGDSHRLTCTYSGFGGDIDAAWIRQAAGKGLEWIAWIWSDSGGSFYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCAKE
Oreochromis niloticus Vs163 igkv AERX01057035.2 2305 SSGEQVLTQSPGSQSVVLGQTVSVRCKASSSVNNYLNWYLQKDGESPKLLIYYATNRQSGVSDRFSGSGSGTDFTLTISRVQAEDAGVYYCHQSNSWP
Oreochromis niloticus Vs204 ighv AERX01063561.2 1838 VKCEQLTQPASVIVQPGQRLTITCQVSYSVGSYYTSWIRQPAGKGLEWIGMRYTSGTYYKDSLKSKFSIDLDSSSNRVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus Vs205 ighv AERX01063561.2 3696 VTGQSMESIPSSPVMKRPGETLSLSCRGSGFTFTCCGMSWIRQQPGKALKWIGVGHIPSSNNRYVSSLSGRIEVSRDDSNSMVHLRLSNLKPEDSAVYYCA
Oreochromis niloticus Vs206 ighv AERX01063561.2 5580 VTGQSMESIPSSPVVKRPGETLNLSCRGSGFTFTCCGMPWIRQQPGKALEWIGIGFSSSSSNRYVSSLSGRVEISRDDSNSMTYLRLSNLKPEDSAVYYCA
Oreochromis niloticus Vs207 ighv AERX01063561.2 7375 LNGQAMESIPSTPVFKNPQEALSLSCRGTGFNFGSYGMHWIRQPAGKGLEWFGTIWSDASRTEYIASVQGRIEITKDDSNRMTYLRLSNLKPEDSAVYYCAT
Oreochromis niloticus Vs169 igkv AERX01057095.1 37 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYNNNNMYWYQQKDGVPKLLITYASTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus Vs168 igkv AERX01057081.1 86 SRGQITVTQPGAVSSAVGGTVSIKCRTSQNVYGNDRLAWYQQKDGGVPKLLIYYASSRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs202 ighv AERX01063557.2 1930 TEGQTLTESEPVIKRPGDSHRLTCTYSGFSSDINAAWIRQAAGKGLEWIALIYSSSSSTYYSQSFRGNSRKQLYLQMSSFTSEDSAVYYCARE
Oreochromis niloticus Vs203 ighv AERX01063560.2 755 TEGQTLTETESVIKRPGDSHRLTCTYSGFSGNINGAWIRQAAGKGLEWVARILSDSSNIFYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs255 ighv AERX01072284.2 2734 VDGQTLTQSEPAIKRPGESHTLTCTASGFSFSGYWMAWVRQAAGKTLEWVATLDSGSGSSKYYSQSVQGRFTISRDNSKQQLYLQMNSLRTEDSAVYYCARE
Oreochromis niloticus Vs569 ighv AERX01043999.1 1681 VDGQTLTESESVFTRPGESHRLTCTASGFTFRDYWMFWVRQAPGKGLEWIAFIHTSSNSYATSYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus Vs568 ighv AERX01043993.1 705 VKCEQLNQPASVIVQPGQRLTITCQVSYSGYWTAWIRQPAGKELEWIGMALGSSTEYKDSLKSKFSISTDSSSKTVTLSGQSVQPEDTAVYYCARD
Oreochromis niloticus Vs561 ighv AERX01043988.2 8727 LLTGVDGQTLTQSEPAVKRPGESHRLTCTASGYTFGRYSLVWVRQAPGKGLEWIAYIYYGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCAQN
Oreochromis niloticus Vs560 ighv AERX01043988.2 14437 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSGYWMVWVRQAPGKALEWVASHYDSANIRYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs563 ighv AERX01043988.2 1774 VNGQTLTESEPAVTQLGQSHRLTCTTSGFTLSSHWFGWVRQAPGKGLEWIAADTGGSTNYYSQSVQGRFTVSRDNSRQQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs562 ighv AERX01043988.2 4348 VHGQTLTESEPVVKKPGESHRLTCTTSGISFSSYWMSWVRQAPGKGLEWIATDTNGATNYYSQSVRGRFTVSRDNSREQLYLQTNSLKTEDSAVYYCARW
Oreochromis niloticus Vs565 ighv AERX01043992.2 9521 VKCEQLTQPASETVQPGQRLTITCQVSYSMSTYWTHWIRQPAGKGLEWIGRGCDGCTSEYKDSLKTKFSISTDSSSKTVTLTGQNLQPDDTAVYYCARQ
Oreochromis niloticus Vs564 ighv AERX01043989.2 5831 VKCEQLTQPASMLVQPGQRLTITCQVSYSLSTYYTAWIRQPAGKVLEWMSDDGTVKDSLKNKFSVELDSSSKTVTLKGQNLQPEDTAVYYCARRR
Oreochromis niloticus Vs567 ighv AERX01043992.2 3985 VWSEIKLEQSPSEVKRPGERVKMSCIISGYSLTSYNIHWIRQRPGGALEWIGWMNTGSNSATYSSSFQSRFIITEEDSSSRQYLEIKSLTAEDSAVYFCARQ
Oreochromis niloticus Vs566 ighv AERX01043992.2 7185 VDGQTLTESEPAVKRPGESHRLTCTASGFTFSSYYMVWVRQAPGKALEWIARISNGGGSTWYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs54 ighv AERX01015574.1 8100 TESQTLTESQSVVKRPGDSHSLTCTYSGFGGDYNNTWIRQAAGKGLEWIAWIYYTGSDISYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs27 igkv AERX01008864.2 5520 CSGQVTVTQPPVVTFTPGSTVTLTCRTNRAVFRFGDGDDAMYWYQKKSGQTPKLLIKYAKTLESGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCFSVHNGM
Oreochromis niloticus Vs26 igkv AERX01008864.2 305 SDASSSVTQSPVFKAAALGERVSLSCTASKGVDDDLSWYLQKPGQPPKLLFYKISRREPDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYVGQ
Oreochromis niloticus Vs25 trbv AERX01008734.1 1010 FSRGVKIDQSQIIFSYEGTKNVTLDCKQDDSDYYYMYWYRQSSDEKLELVAYSLSKDNSNIEAPFKNSQYTMSRPSVLESTLKIHLVVAGDTALYYCASSI
Oreochromis niloticus Vs29 igkv AERX01008897.1 76 SDASSSVTQSPVFKAAALGERVSLSCTASKGVDDDLSWYLQKPGQPLKLLFYKISSRESCTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYRGPE
Oreochromis niloticus Vs28 igkv AERX01008878.2 6613 CSGQVTVTQPPVKTSTPGSTVTLTCRTNQAIYREADGNEAMFWYQQKSGQTPKLLIKYAKTLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs806 trdv AERX01072711.2 1196 LTAGDSITPQQTEVTETEGKSVKLTCSYQTSDSHPWLYWYRHDSDLQAPQFILRKGGKQSTAKYIPDNRYDSKTSPTTTDLTITALTLADTALYYCALE
Oreochromis niloticus Vs807 igkv AERX01072739.1 1417 SRGQITVTQPGAVSSAVGDTVTIKCRTSQNVHVWNNNQLLAWYQQKDGGVPKMLIYYASTRYSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Oreochromis niloticus Vs804 trav AERX01072315.2 1489 CKGEDKVIQEQGDVIAAEGETVTLRCKYETSYPSPTLFWYKQEVDSYPKYMLKCFSETTDKSEEFNNDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs805 trdv AERX01072709.1 499 LTAGDSITPQQTEVTETEGESVKLTCNYETGYSHIYLHWYRHDSDLQAPQFILRKGAKGYSSEYIPDKRYKTQTSVTSTTLTITALTLADTALYYCALE
Oreochromis niloticus Vs802 igkv AERX01071124.2 1398 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYVSGSSHCLAWYQQRDGGVPKLLIYFASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs800 igkv AERX01070739.1 850 SRGQITVTQPGAVSSAVGGSVSIKCTTSQNVHVSGSSHCLAWYQQKDGETPKRLIYHASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs808 trav AERX01072831.2 1970 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETTASYSYLFWYKQELNDFPKYVLQRGTTGTADNAQEFPKDRFDAELNKKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs630 ighv AERX01044038.1 1142 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDLYGAWIRQAAGKRLEWIAYINPSSSIYYSQSFSGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCA
Oreochromis niloticus Vs363 ighv AERX01015575.1 996 VKCEQLTQPASVIVQPGQRLTITCQVSYSLGYSTAWIRQPAGKGLEWIGMKYTGNSHYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCAR
Oreochromis niloticus Vs362 ighv AERX01015575.1 1899 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDIVAAWVRQAAGKYLEWIALIYSSSSIYYSQSFRGRFTISRDNSRKQVYLQMNSLTAEDSAVYYCAKELQ
Oreochromis niloticus Vs361 ighv AERX01015571.2 3110 VHCQTLTQSELLVKRPGESHTLTCTASGFSFISYYMNWVRQAPGKGLEWVATLSSGSGSNKYYSQAVQGRFTISRDNSRQQLYLQLNSLKTEDSAVYYCA
Oreochromis niloticus Vs278 ighv AERX01075897.2 1087 VDGQTLTESEPAIKSPGESHTLTCTASGFTFRDYYMAWVRQAPGKRLEWVAYISSGSGSTKFYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARD
Oreochromis niloticus Vs792 trgv AERX01066884.1 4478 EQLNQNGLTLTRRVGESVSFSCGGINKCDGSYVFWYQKKEKETFKVILDINKNSGSIDKNYGHAQRDDFSAVKTQTGCELKIKKVKLDHSATYYCSCYKSA
Oreochromis niloticus Vs793 trgv AERX01066888.1 1170 EQLIQDDLTLTRRVGESVSFSCGGINQCYYNDIFWYQKKEKETFRVILYIDKSSGYIEKGYGHPQKNDFSAQNKQNGCELKIKKIKLDHSATYYCNCYMYG
Oreochromis niloticus Vs790 ighv AERX01065778.2 2988 VKCQQLTQPEFVTVQPGQRLTITCQVSYSLSYYRTAWIRQPAEKGLEFIGSAHYGYSTGYKDSLKNKFTINLDTSSKTMTLNGQNMQPEDTAVYYCARV
Oreochromis niloticus Vs796 trav AERX01069606.2 367 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETSYAATLIWYKQEVNSYPKYVLHCVSETTVKAEEFKNDRFDAKINEKQQSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs491 ighv AERX01043924.1 5254 VYSIDLIQPESMVVQPGQSLTITCQVSGYSLTSYATCWIRQRDGKQMDWINCMWTGGSTANNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus Vs490 ighv AERX01043921.1 2224 AAGQTLTESEPVVERPGESHRLICTASGFTFSSFWMGWIRQAPGKGLEWVAHIWANGNRAFYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus Vs493 ighv AERX01043925.2 1284 VDGQILTESESMVQRPGESHRLTCTASGFTFCSYAMAWIKQAPGKGLGQLAWVDNGSGARKYYSQSVQAQFTISRDNKRQQVYLQMNSLRSDDSAVYYCAQY
Oreochromis niloticus Vs492 ighv AERX01043925.2 5762 VYSIDLIQPDSRVLQPGQSLTIVCQVSGYSLTDNSYGTCWVRQRQRQQMDCINCMWASGNTANNDALKNKFSVSRDTSARTVTITGQNLQPEDTAVYHCAR
Oreochromis niloticus Vs495 ighv AERX01043927.1 6003 VDCQTLTQSEPAVKRPGESHRLTCTGSGFTFSSYWIHWIRQAPGKGLEWIALIYTDSSKAFYSPSVQGRFIISRDNSKQQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus Vs494 ighv AERX01043926.1 1795 VYSIDLIQPDSRIVQPGQSLTITCQVSGYSVTSYGTAWIRQREGKPLEWINTIWSGGSTDNNNALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARD
Oreochromis niloticus Vs497 ighv AERX01043928.1 2607 LHGQTLTESGPVVKRPGESHRLTCTASGYNFGGYSMHWIRQAPGKGLEWIAYISSSGGTTYYSQSVQGRFIISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus Vs496 ighv AERX01043928.1 6827 VDGQTQSEPAVKTPGESHRLTCTTSGFTFSSYWMHWIRQAPGKGLEWIAFIYTDSSGMFYSDSVRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs499 ighv AERX01043933.1 2460 VNSQTLTESGPVDKRPGESHKLTCTTSGFTFSSYSMDWIRQAPGKGLEWIADITSGGTTYYSQSAQGHFIISRDNNRQQLYLQMNNLKTEDSAVYYCARE
Oreochromis niloticus Vs498 ighv AERX01043928.1 1135 VYSIDFIQPDSLVVQPGRSLTITCQVTGYSLTDNDYATGWVRQREEKPMDWIFHQWGDNVYKNDALKNKFSFSRDTSAGTVTITGQNVQPEDTAVYYCVSLR
Oreochromis niloticus Vs705 trdv AERX01063867.1 299 LTAGDSITPQQTEVTKTEGESVKLTCSYETTSSVAYLYWYRHDSDLQAPQFILWKQGKGGTAEYIPDNPYGSETSPTSTNLTITALADTALYYCALQ
Oreochromis niloticus Vs704 trav AERX01063867.1 1820 GNSLEDDITASSAEVFSSEGRTVTVSCNYSVQANNLQWYRQDPGSDPQFLLLITDTSEPTVVRATPPNPRLTAALNKERNRVNLEISSAAVTDSAVYYCALQ
Oreochromis niloticus Vs707 trav AERX01063895.2 1350 CKGEDKVIQEQGDVTAAEGDTVTLGCRYETSDPGPTLFWYKQDGNNSPKLILSRVSRDDGNTAAEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs706 trav AERX01063876.1 3424 CKGEDKVIQEQGDVIAAAGDTVTLGCTYETSDSYSYLFWYKQELNDFPKYVLQRGTTGTADNAQEFPKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs708 igkv AERX01064427.2 417 SRGQYTVTQPGAVSSAVGGSVSINCRTSQNVYSNWLSWYQQKDGGVPKLLIYYASSRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs668 ighv AERX01044082.1 2165 VKCEQLTQPASVTVQPGHRLTITCQVSYALSSYWTGWIRQPAGKGLEWIGSRYTGGSAYKDSLKNKFSIDLDTSSKRVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus Vs669 igkv AERX01044397.1 4869 SAGQNVVVTQSASKSVQLGQTVNINCKVSTQVAHYSGSRYYLAWYHQKAGEAPKALIYLTSDRFSGISSRLSGSGAGNGLDFTLSISAVQADDAGVYYCQS
Oreochromis niloticus Vs666 ighv AERX01044079.2 1226 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVATISDGSSTWYSQSFRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCARD
Oreochromis niloticus Vs667 ighv AERX01044082.1 4612 VNISVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSAIFYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAEQ
Oreochromis niloticus Vs664 ighv AERX01044078.2 5990 VKCEQLTQPDSLSVLLGHPLTITCKVSYSVRSYWTHWNRQAPGKGLEWIGRAASGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQPEDSAVYYCARD
Oreochromis niloticus Vs662 ighv AERX01044075.2 2835 VTGQSMESIPSSPVVKKPGETLSLSCRGSGFSFDCCVMIWVREPAGKPLELIGSGFSTSSRNSYASSLRGHVEISRDDSNSMVYLRLSNLWPEDSAIYYCAKE
Oreochromis niloticus Vs663 ighv AERX01044075.2 1179 VKCEQLTQTASVNVQPGHRLTITCQVAYSLSSYRTAWIRQPAGKGLEWIGDAHYGYPTFYKDSLKNKFTINLDTSSKTVTLNGQNMRPEDTAVYYCARD
Oreochromis niloticus Vs660 ighv AERX01044074.2 2375 TESQTLTESESVVKRPGDSHRLTCTYSGFSSDIYAAWIRQAAGKGLEWIARINPSSGTYYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCAKE
Oreochromis niloticus Vs661 ighv AERX01044074.2 618 TEGQTLTQSESVVKQPGQSHRLTCTYSGFSGDDHYAWIRQAAGKGLEWIAWIQYNGGSTYYSQSFRGRFTISRDNSRKQVYLEMSSLTTEDSAVYYCARE
Oreochromis niloticus Vs631 ighv AERX01044039.1 550 TGGQTLTESESVVKRPGDSHRLTCTYSGFSYDIAVAWIRQAAGKGLEWIAWIDSGSGSSKYYSQSIRGRFTISRDNSRKQVYLQMNSLTNEDSADYYCAR
Oreochromis niloticus Vs277 ighv AERX01075659.2 1205 TEGQTLTESGPVIKRPGDSHRLTCTYSGFSSDIYAVWVRQAAGKGLEWIARISDNSNYIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs639 ighv AERX01044052.1 730 TESQTLTESESVIKRPGDSHRLTCTYSGFSSDIHAVWVRQAAGKGLEWIAYISDSSAYIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCTRE
Oreochromis niloticus Vs231 ighv AERX01063581.2 6453 VNCEQLTQPPSVILQPGQRLTITCQVSYSLGIWTGWIRQPAGKGLEWIGVKGTGGSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus Vs230 ighv AERX01063581.2 3962 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDIDAAWIRQAAGKGLEWVTWIRSDSIEIYYSQSVRGRFTISRDNSRKQVYLQMNSLMTEDSAVYYCARQ
Oreochromis niloticus Vs233 ighv AERX01063582.2 4374 VKCEQLTQPPSVIVQPGQRLTITCQVSYSVSGDWTGWIRQPAGKTLEWIGMKYTGNSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCVRG
Oreochromis niloticus Vs232 ighv AERX01063582.2 1018 NISVGSESQTLIQSESVIKRPGESHRLTCTYSGFSSDYETAWIRQAAGKGLEWIAYISSGSGSIYYSESFRGRFTTTRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs239 trgv AERX01065431.1 1682 LVTMAAELMQKDLTLTATPGKKVSFSCGTAQCSGSYVHWYQKKDNDKFRVILHINIRTGEVNSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCCCAQS
Oreochromis niloticus Vs68 iglv AERX01023642.1 170 VSGVTVLTQKPLLSVRKGETATMDCNLGTVTNDARWYKQIPGGVPQYVLRMYHGWSSPQYGSGFSAPKFTSTHQSTKDYRLIINNVEEGDSAVYHCHTWDGSVN
Oreochromis niloticus Vs536 ighv AERX01043966.1 2766 VWSEIKLEQSASEVKRPGERVKLLCTLSGYSLTSYNIFWIRQRPGRALEWIGYISTGDNSPGYASSFQSRFIITEEDSSSRQYLEITSLTAEDSGVYFCARE
Oreochromis niloticus Vs537 ighv AERX01043967.1 5221 VDGQTLTESESVVKRPGESHRLTCTASGFTFRDHWMVWVRQAPGKGPEWIAFIDTSTYSYATSYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARG
Oreochromis niloticus Vs534 ighv AERX01043965.1 3512 VNGQTLTESEPVTKRPGESHRLTCTVSGFTLSSYYMAWVRQAPGKALEWIAYIGTYSSPIRYSQSVQGRFTISRDDSSSKIYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus Vs535 ighv AERX01043966.1 4236 VDGQTLTQSEPVVKRPGESHRLTCTASGFTFSSYSMAWVRQAPGKGPEWITYISTSTYSYDTAYSQSFRGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus Vs532 ighv AERX01043964.1 6543 VKCEQLTQPASETVQPGQRLTITCQVSYSVSGYYTAWIRQPAGKGLEWIGMAAGSTTYYKDSLKSKFSISTDSSNNRVTLSGQNMQPEDTAVYYCARL
Oreochromis niloticus Vs533 ighv AERX01043964.1 4298 VDGQTLTQSEPVVKNPGNSHRLTCTASGFTFSNYWMHWIRQAPGKGLEWIAIIRTSTHSYATYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCA
Oreochromis niloticus Vs530 ighv AERX01043963.2 4582 VWSEIKLEQSPSEVKGFGERVKMSCTLSGYTLTDHDIHWIRQRPGRALEWIGYMSTGYNSPGYGSSFQHRFIMTEEDSSRRQYLDINGLTAEDSAVYFCARQ
Oreochromis niloticus Vs531 ighv AERX01043963.2 2333 VKCEQLNQPASVTVQPGHRLTITCQVSYSVSSYLTAWIRHPAGKGLEWIGMALGSSTEYKDSLKSKFSISTDSSSNTVTLTGQNVQPDDTAVYYCARD
Oreochromis niloticus Vs248 trav AERX01068581.1 1061 CKGEDKVIQEEGDVIAAEGDIVTLRCKYETSYPSPTLFWYKQEVDSYPKYMLKSFSETTDKSEEFNNDKFDAKINKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs249 trgv AERX01069485.2 116 EELIQEDLILTRRVGENVSFSCGEINKCDGSYVFWYQKKEYETFRVILDIDKNSGNIDKNYGHPQKDDFSAVKTQNGWELKIEKVKRDHSATYYCSCYKSA
Oreochromis niloticus Vs538 ighv AERX01043968.1 3368 VFGQTLTESDPAVKQPGESHRLTCTASGFIFSSYWMAWVRQAPGKGLEWISTVRNDGGNSYYAQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs539 ighv AERX01043969.2 2498 VWSEVKLEQSPSEVKRPGERVKMSCIISGYTLTQHYLHWIRQRPGRALEWIGRMDTGKNSAIYGSTFQSRFVMTEEDSSSKQYLEINSLTAEDSAVYFCARR
Oreochromis niloticus Vs609 ighv AERX01044029.2 31990 VKCEQLSQPDTVTVQPSQSLTITCQVSYSVGNYHTAWIRQPEGKGLEFIQSARVGYSTYYNDLLKNKFSISLDSSSNTVTLNGQNEQPEDTAVYYCA
Oreochromis niloticus Vs259 ighv AERX01072429.2 780 TEGQTLTETESVIKRPGDSHRLTCTYSGFSSDIHAVWNRQAAGKGLEWIAFIESDSSKIYYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Oreochromis niloticus Vs622 ighv AERX01044032.1 4690 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCSMHWIRQPAEKGLEWMGRVYSDASRTDYSSSLQGRIEVTRDNSNSMTYLRLSDLKPEDSAVYYCA
Oreochromis niloticus Vs623 ighv AERX01044033.2 2847 VKCEQVTQPASVIVQPGQPLTITCQVSYSLGSYRTAWIRQPAGKGLEWIGMKYTGDSFYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus Vs620 ighv AERX01044029.2 4530 HAQTVTQSEPVVKKPGESHRLTCTASGLSFSSNWMAWIRQANGKGLEWIATEANGGTNYYSQSVQGRFTVSRDNSREQLFLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs621 ighv AERX01044032.1 5789 TEGQTLTESKSVVQRPGYSHTLICTYSGFSSDIHAAWIRQAAGKGLEWIAYCRSGSGTISYSQSVRGRFTITRDNNRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs626 ighv AERX01044034.2 3807 INISAGIEGQTLTESESVVKRPGDSHRLTCTYSGFSGDYSNAWIRQAAEKGLEWIALISSGSGTWYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYFCARY
Oreochromis niloticus Vs627 ighv AERX01044034.2 1964 TEGQTLTESESVVKQPGQSHRLTCTYSGFSGDIDAAWIRQAAGKGLEWIAYINSGSSYISYSQSVRGRFTISRDNSRKQVYLEMSSLTTEDSAVYYCARE
Oreochromis niloticus Vs624 ighv AERX01044033.2 1919 VKCEQLTQPASVIAQPGQSLTITCQVSYSPGSWRTAWIRQPAGKGLEWIIIGGSGYTTYYKDSLKNKFSISADSSSKTVTLSGQNVQPEDTAVYYCARE
Oreochromis niloticus Vs625 ighv AERX01044034.2 13943 VYGQTLTESEPVIKGSGESHRLTCTASGFTFSSYYMAWVRQAPGKGLEWIASHYTSAYIYYSQSFQGRFTISRDNSKQQLYLQMNGLKTEDSAVYFCARE
Oreochromis niloticus Vs628 ighv AERX01044035.2 875 VKCEQLTQPDSLSVLSGHPLTITCKLSYSVRSYWTHWNRQAPGKGLEWIGRAASGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQPEDSAVYYCARD
Oreochromis niloticus Vs629 ighv AERX01044038.1 2939 VKCEQLTQPEFVTVQPGQRLTITCQVSYSLSSYRTSWIRQPAGKGLEWIGSVRDGYSTYYKDSLKNKFTINLDTSSKTVTLNGQNMQAEDTAVYYCARE
Oreochromis niloticus Vs479 ighv AERX01043909.1 4342 ARCQSLTSSEPVVSRPGQSVTLSCRVQGLSLSYLHWIRQKPGKGLEWIGRIDGGTGTIFAQSLQGQFSITKDTSQNRVNLVVNSLKQEDSAVYFCARE
Oreochromis niloticus Vs198 ighv AERX01063552.2 12045 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFTCCTMHWVRQQPGKALEWMGIGFSSSNSNTYVSSLSGRIQISRDDSNSMVHLRLSNLKPEDSAVYYCAK
Oreochromis niloticus Vs199 ighv AERX01063555.2 1280 TEGQTLTESEHVIKRPGESHRLTCTYSGFSDDIHAAWIRQAAGKGLEWIAFIWGDSSGIYYSQSFRDRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs190 trav AERX01061719.2 1684 SSEDLLTPSKDAVMSLEGDTVTLSCNYSGYVQALFWYHQKSGSRPQLLMAEHSAQTEKLKFIHEREKKEFHLEISSAAVTDSAVYYCAVRPTVTG
Oreochromis niloticus Vs194 trav AERX01063310.2 19553 VIQTTEVPQLISLTVVDLGDNATFGCEVSEKELKSFHWYKQSLGHLPQSVASVVFNQIALSDEFKDSRFTVNKETSQYIFTIRNVSKEDEATYFCQTG
Oreochromis niloticus Vs196 ighv AERX01063551.1 17934 VTGQSMESIPSTPVVKRPGETLSLSCRGSGFTFTCCTMNWVRQQPGKALEWIGESWSDSSKNSYASSLRGRIEVSRDDSNSLTYLRLSNLKPEDSAVYYCA
Oreochromis niloticus Vs197 ighv AERX01063552.2 8904 LNGQAMESIPSTPVLKKPQEAVSLSCRGSGFSFGSFGMNWIRQPAGKALEWLGLIWSHGSRTAYASSVEGRIEITKDNSNSMVYLRLSSLKPEDSAVYYCA
Oreochromis niloticus Vs695 trav AERX01060127.2 3805 VICEELTAINTQKSSLEDSTVTLSCSYSKPVVGTYYFFWYQQYPGKPPKFLISHSDKGQLISDPVFRLSVKVNETLMTLQISSAAVTDSAVYYCAVR
Oreochromis niloticus Vs694 trdv AERX01060116.2 12231 LTAGDSITPQQTEVTKTEGESVKLTCSYETRASSANLYWYRHHSELQAPQFILWKRGKGTAAEYIPDNRYGSQTSSTSTSLTITALTLADTALYYCALQ
Oreochromis niloticus Vs754 trbv AERX01065138.2 4414 VCLGVKVSQTPVEVFRTPGENVQLVCSHEKTDYVLMQWYQKSPGDQALKRIGHLYHNSKEHEEVFKTHFNISGDLSGEKAKNASLFIVDLKAPEHSAVYYCAASY
Oreochromis niloticus Vs753 trbv AERX01065138.2 5046 FSQDVIQEPEIRWSYVNKAAEMNCSHNKDITHNQMYWYIQRPGETMRLIVYTALGGVPDYGGAPENKYSATKAKAENGALTVNDLQQNDTGVYFCAVS
Oreochromis niloticus Vs750 trbv AERX01065137.1 2069 LCLGVEVHQTPSEVFRTPGENVQLVCSHGKTDYTLMQWYQKSPGDQALKRIGHLNYNNKEHEKSFEKHFNITGDLTGSQPKNASMFIVDLKPEHSAVYYCAASY
Oreochromis niloticus Vs176 trav AERX01059754.2 1572 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETTDTYPYLFWYKQEVNDFPKYVLRRDKTAGDNAQEFPKNGFDAELKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs177 trav AERX01059754.2 3853 VTCDQLTPVKDEESSLEGSTVTLTCTYTKGAADYFFWYRQHPGKTPEFLISHLESGEIGIPPSSSRLSVGVRKDETKMDLQISSAAVTDSAVYYCAVR
Oreochromis niloticus Vs174 trav AERX01059723.2 95 CKGEDKVIQEQGDVIAAEGDTITLYCKYETTDAYPYLFWYKQEVNSYPKYMLKSFSETTDKSEEFNNDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCALK
Oreochromis niloticus Vs175 trav AERX01059735.1 3179 CKGEDKVIQEQGDVIAAEGDTVTLGCTFETSYPGPTLIWYKQEVNSYPKYMLKCVSESTVKAAEFNDDRFDAKINKTEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs170 igkv AERX01057097.2 2226 SRGQITVTQPGAVSSAVGGTVNIKCRTSQNVYVYSSYHYLQWFQQRNGNVPKLLLKRAHERISGTPARFTGSGSHKDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus Vs273 ighv AERX01074665.1 330 VDGQTLTESEPAVKRPGDSHRLTCTASGFTFSSFEMNWVRQAPGKGLEWVAYNSGGGSTKYYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Oreochromis niloticus Vs275 ighv AERX01074707.1 1198 LNGQAMESIPSTPVLKNPQETLSLSCRGTGFSFGSYAMHWIRQPAGKTLEWLGIIWYDASKTVYASSVEGRIEITRDNSNSMVYLRLSSLKPEDSAVYYCA
Oreochromis niloticus Vs274 ighv AERX01074667.1 1198 LNGQAMESIPSTPVLKNPQETLSLSCRGTGFSFGSYAMHWIRQPAGKTLEWLGIIWYDASKTVYASSVEGRIEITRDNSNSMVYLRLSSLKPEDSAVYYCA
Oreochromis niloticus Vs178 trav AERX01059771.1 121 CRAQKDNVLQAKGEETAAAGGTVTLGCQYNTSGDNHYLYWYKQDGHKSPKFILSRFRIGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs276 ighv AERX01075502.1 1264 VNGQTLRESEPVVKRPGQSHRLTCTASGFTFSDYRMVWVRQAAGKGPEWIAYISISDYSYATHYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus Vs284 ighv AERX01076645.1 874 VDGQTLTESEPAIKSPGESHTLTCTASGFTFRDYYMAWVRQAPGKRLEWVAYISSGSGSTKFYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARD
Oreochromis niloticus Vs285 ighv AERX01077265.1 330 VDGQTLTESEPAVKRPGDSHRLTCTASGFTFSSFEMNWVRQAPGKGLEWVAYNSGGGSTKYYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Oreochromis niloticus Vs280 trbv AERX01076444.2 947 VCLGVKVSQTPVAVFRRPGENVQLVCSHEKTDYMLMQWYQKSPGDQALKRIGHLYYNNKEHEEVFKTHFNISGDLSGEKAKNASLFIVDLKAPEHSAVYYCAASY
Oreochromis niloticus Vs281 trbv AERX01076513.1 935 LTDANDVTQTPMLWEQQGDNATIDCSHNKGAFYVQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEVRDGTFTVKNLEPKDSGWYFCAVS
Oreochromis niloticus Vs282 trbv AERX01076514.1 935 LTDANDVTQTPMLWEQQGDNATIDCSHNKGAFYVQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEVRDGTFTVKNLEPKDSGWYFCAVS
Oreochromis niloticus Vs283 ighv AERX01076522.1 978 TEGQTLTESEPVVKRPGDSHRLTCTYSGFSSDINVGWIRQAAGKRLEWIAFIEYDSSYIHYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs578 ighv AERX01044006.2 8867 VKCEQLTQPASVTVQPGQRLTITCQVTYSVSSWYTAWIRQPAGKGLEWIGSARTGSTTYYKDSLKSKFSISTDSSSKTVTLTGQNVQPEDTAVYYCA
Oreochromis niloticus Vs579 ighv AERX01044006.2 6330 VDGQTLTESEPAVKQPGQSHRLTCTTSGMSFSSYTMVWIRQAPGKALEWVAYISGNSAYIYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs572 ighv AERX01044000.2 9033 VDGQILTESEPVVKRPGESHRLTCTASGFTFSSYPMAWVRQAPGKGLEWVAYISTSSSPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARR
Oreochromis niloticus Vs573 ighv AERX01044000.2 3658 VLGQTLTESEPAVKRPGESHRLTCKASGFNSNWMAWIRQAAGKGLEWISTVRNDGGDSYYAQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs570 ighv AERX01044000.2 13908 VWSEVKLEQSASEVKRSGERVKMSCIISGYSLTSYNIGWIRQRPGRALEWIGCMSTGSNSARYASSFQSRFIMTEEDSSRSQYLEIKSLTAEDSAVYFCARI
Oreochromis niloticus Vs571 ighv AERX01044000.2 10670 VNSDTLTQPASMIVRPGEHLTITCQVSYSLSSYLTAWIRQPAGKGLEWIGMAGSGWTTYYKDSLKNKFSISFESSSKTVTLRGTNVQPEDTAVYYCARQ
Oreochromis niloticus Vs576 ighv AERX01044005.1 1703 VKCEQLTQPDAVTVQPGQPLTIICQVSYSVSSYSTAWVRQPAGKNLEWIGQQCHGCTPAYKDSLKNKFSISTDSSSNTVTLTGQNVQPEDTAVYYCARD
Oreochromis niloticus Vs577 ighv AERX01044006.2 12714 VKCEQLNQPASVTVQPGQRLTITCQASYSVGGYWTAWIRQPAGKGLEWIGSASTGSTTQYKDSLKSKFSISTDSSSNTVTLTGQNVQPDDTAVYYCARD
Oreochromis niloticus Vs575 ighv AERX01044005.1 7089 VNGQTLTESEPAVKQPGQSHRLTCTTSGLSFSSYGMTWIRQAPGKGLEWIATISNGGSSTWYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus Vs782 ighv AERX01065769.2 4497 VKCEQLTQPASVNVQPSQHLTITCQVSYSLSYWTAWIRQPAGKGLEWIGMKSTGSSYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDTVLYYCARE
Oreochromis niloticus Vs482 ighv AERX01043915.2 12650 IYGQTLTESEPVVKRPEDSHRLTCTASGFTFSSYWMDWIRQAPGKGLEWVASIRYDSGEIYHSQSVRGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs483 ighv AERX01043915.2 3262 VDSQTITQSESVVKRPAESHKLTCTGSNIDFSSYWMAWIRQAPGKGLEWIAIIEYDSDSIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARR
Oreochromis niloticus Vs481 ighv AERX01043911.2 2320 VDSQTITQSEPVAKRPGESHRLTCTGSNIDFSSYRMAWVRQGPGKGLEWVARIRYDSAYIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus Vs486 ighv AERX01043920.2 10027 VYSIDLIQPESRSVQPGQSLTITCQVSGYSMTDDNYATGWIRQREGKAMDWISHQWGTSGLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRY
Oreochromis niloticus Vs487 ighv AERX01043920.2 7922 VDSQTVTQSESVVKRPAESHKLTCTGSDIDFSSYWMAWIRQAPGKGLEWIAIIEDDSDSIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus Vs484 ighv AERX01043915.2 1074 VYSIDLIQPESRSVQPRQSLTITCQVSGYSMTDDTYGTGWIRKREGKAIDWISHQWGGGSLRQNDALKNKFSYSRDTSARTVTITGQNLQTEDTAVYYCVRIR
Oreochromis niloticus Vs485 ighv AERX01043916.1 1408 QTITESEPAVKRPGESHRLTCTTSGFSFSSEVWNWIRQAPGKGLEWIALVHTASTPIYYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCAKR
Oreochromis niloticus Vs488 ighv AERX01043920.2 5864 VYSIDLIQPESRSLQPGQSLTITCQVSGYSMTDGSYATGWVRQREGKAMDWISHQWGGGTLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRVS
Oreochromis niloticus Vs489 ighv AERX01043921.1 8829 VDGQTLTESEPAVKRPEESHRLTCTTSGFNFGDYWMHWIRQAPGKGLEWIARISFWAGSTINYSQSVRGRFTISRDNNKRQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs712 trbv AERX01065114.1 5463 SSLNSQIYQTPAQLYISRETEEVEINCSHSIQGYDRILWYRQMNNRHLQFLGYVYGTMDNPEKGLDVKLKGDANKNKTCTLTIEKLGPNSSAVYFCA
Oreochromis niloticus Vs718 trbv AERX01065118.1 1438 GSSLSDQVDQTPADIYTQGEEVKIHCSHSIPSYDTILWYKQSEKQLQLLGYMWNDKGYPETGLNVTVDGDARQHKNCTLTIKYLKVSSSGVYFCAAR
Oreochromis niloticus Vs719 trbv AERX01065119.1 1788 GSPASDQVNQTPANIYTKGGDVKIHCSHRIQNYYQILWYKQSEKQLQLLGYMYYDNSYPEAGVNVTMDGGAEKDQNCTLTIRDLKASSSGVYFCAAS
Oreochromis niloticus Vs659 ighv AERX01044074.2 5277 TEGQTLTESEPVVKGPGDSHRLTCTYSGFGYDIGAAWIRQAAGKGLEWIAYINPGSGSSKYYSQSVQGRFTISRDNSRKQVYLQMNRLTTENSAVYYCARY
Oreochromis niloticus Vs658 ighv AERX01044073.2 1249 VDGQTLTESEPVIKRPGESHTLTCTASGFTFRDYYMAWVRQAAGKGLEWVAYISSGGGSTKFYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCTRD
Oreochromis niloticus Vs653 ighv AERX01044066.2 4764 TEGQTLTESEPVIKRAGDSHRLTCTYSDFNVHEDNVWIRQAPGNGLEWIAYISGGGSYIHYSQSFRGWFTISRDNSRQQVYLQMNSLNNEDSAVYYCA
Oreochromis niloticus Vs652 ighv AERX01044066.2 6410 VQCEQLTQPAYVTKQPGQRLSITCQVSYSVGSYFTAWIKQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSKTVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus Vs651 ighv AERX01044065.2 1919 VKCEQLTQPTSVTVQPGHRLTITCQVSYALSSYWTGWIRQAAGKGLEWIGSRYTGGSAYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus Vs650 ighv AERX01044065.2 4317 VNISVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSAIFYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAEQ
Oreochromis niloticus Vs657 ighv AERX01044067.2 1208 VDGQTLTESEPAVKRPGESHRLTCTTSGFTFSSYAMDWVRQAPGKGLEWIAFIHTGSSHIYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCA
Oreochromis niloticus Vs656 ighv AERX01044067.2 2800 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVATLDSGSGSSKYYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Oreochromis niloticus Vs655 ighv AERX01044066.2 831 VKCEQLTQPTSVTVQPGHRLTITCQVSYALSSYWTGWIRQAAGKGLEWIGSRYTGGSAYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus Vs654 ighv AERX01044066.2 3180 VNISVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSSTYYSQSFRGRFTISRDNSRKQVYLQMNSLTAEDSAVYYCAEQ
Oreochromis niloticus Vs226 ighv AERX01063579.2 3603 TCPTLQLTQPPSVIMQPGQHLTITCQVSYSLGWYTAWIRQPAGKGLEWIGVKGIAGSYYKDSLKNKFSVDLDTSSNTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus Vs227 ighv AERX01063579.2 5067 TEGQTLTETESVIKRPGDSHRLTCTYSGFSSDINGAWIRQAAGKGLEWIAFIWDDSSGSYYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Oreochromis niloticus Vs224 ighv AERX01063578.2 225 LNGQAMESIPSTPVLKKPQEAVSLSCRGSGFSFGSFGMDWIRQPAGKALEWLGLIWSDASSTVYASSVEGRIEITKDNSNSMVYLRLSNLKPEDSAVYYCA
Oreochromis niloticus Vs225 ighv AERX01063579.2 10 VTGQSMESIPSTPVVKRPGETLSLSCRGSGFSFDSYTMHWIRQKPGKALEWMGIGYSDSSSNRYVSSLSGRIQITKDTSNSMVHLRLSNLKPEDSAVYYCAK
Oreochromis niloticus Vs222 ighv AERX01063574.1 10 VTGQSMESIPSTPVVKRPGETLSLSCRGSGFTFSCCTMHWIRQKPGETLEWMGEGYTDSSKNKYVSSLRGRIEITKDNSNSMVHLRLSSLKPEDSAVYYCAK
Oreochromis niloticus Vs223 ighv AERX01063577.2 25 VKCAQLTQPPSVIVQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGMRYTSGTHYKDSLKSKFSIDLDSSSNRVTLNGQTMQPEDTAVYYCAR
Oreochromis niloticus Vs220 ighv AERX01063572.1 652 VKCEQLTQPPSVIVQPGQHLTITCQVSYSLGWYTAWIRQPAGKGLEWIGVKHTSTSYYKDSLKKKFSIDLDTSSNTLTLNGQNMQPEDTAVYYCARESR
Oreochromis niloticus Vs221 ighv AERX01063573.2 131 TEGQTLTESEPVIKRPGDSHRLTCTYSGFGGDIHGAWIRQAAGKGLEWIAWISNGGSIYYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAKE
Oreochromis niloticus Vs200 ighv AERX01063556.2 428 VKCEQLTQPASVIVQPGQHLTITCQVSYFLDWYTVWIRQPAGKGLEWIGMKHTGDSHYKDSLKNKFSIDLDTSSNTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus Vs228 ighv AERX01063579.2 6329 TDGQTLSGSEPVVKRPGDSHRLTCTYSGFSSDIHAAWIRQAAGKGLEWIAIIWRDSSGSVYSQSVRGRFTISRDNNRKQVYLQMNSLASEDSAVYYCATE
Oreochromis niloticus Vs229 ighv AERX01063581.2 1511 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCTMNWIRQKPGKALEWMGVGYSSSSRNRYVSSLSGRIEISRDDSNSMVHLRLSSLKPEDSAVYYCAR
Oreochromis niloticus Vs201 ighv AERX01063557.2 1175 TDSQTLTESESVIKRPGDSHRLTCTYSGFSSDIHAAWLRQAAGKGLEWIAGLHSDSNHIRYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus Vs503 ighv AERX01043936.2 13646 IKGQTLTQSDSAVKRPGESHRLTCTGSGYNFAGFGMHWTRQAPGKGLEWIASIWSDGSNTYYSQSVRGRFTISKDNNRQQVYLQMNSLKTEDSAVYYCARQ
Oreochromis niloticus Vs502 ighv AERX01043936.2 16576 VDGQTLTQSEPAVKRPGDSHRLTCTGSGYNFGGHGMHWIRQAPGKGLEWIAYIYSDGSETFYSDSVRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs501 ighv AERX01043934.2 877 VDGHTLTQSEPAIKRPGESHRLTCTASGYNFGDRSLVWVRQAHGKGLEWIAYIRNDGSSTSYSQSVQGRFTISKDNSKQQVYLQMNSLKTEDSSVYYCAR
Oreochromis niloticus Vs500 ighv AERX01043934.2 6578 VDGQTLTESESVIKRPGESHRLTCTGSGFTFSSYLMAWVRQAPGKGLEWLASHYDSSNIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus Vs506 ighv AERX01043938.2 371 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSSYGMSWIRQAPGKGLEWIAHIFTDGSRTFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARV
Oreochromis niloticus Vs505 ighv AERX01043936.2 7261 GDSQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALEWVANIRYDSAYIYYSQSVQGRFTISRDNSKQQLYLRMNSLNTEDSAVYYCARD
Oreochromis niloticus Vs504 ighv AERX01043936.2 10472 VNCQTLTESEPVDKRPGESHKLTCTTSGFTFSSYSMDWIRQAPGKGLEWIAYISSGGGSNTYYSQSVQGRFTISRDNSKQQLYLQMNNLKTEDSAVYYCARE
Oreochromis niloticus Vs509 ighv AERX01043949.2 795 VDGQTLTQSEPAVKRPGESHRLTCTASGYTFGDYSLVWVRQAPGKQLEWIAYLYWSDGSTSYSQSVQGWFTISKDNSKQQLYLQMSSLKTEDSAVYYCARN
Oreochromis niloticus Vs508 ighv AERX01043947.2 1422 VYSIDLIQPDSRIVQPGQSLTITCQGSGLSVTNYGRGWVREREGNPLEWINLIWTGGGINKNDALKNKFSISRDYSGQTVTLTGQNLQPEDTAVYYCA
Oreochromis niloticus Vs240 trdv AERX01066473.2 1300 LTAGDSITPQQTEVTKTEGKSVTLTCNYETNESDTYLHWYRHDSDLQAPQFILRKRAKGDTAEYIPDKRYKTQTSPTSTTLTITALTLADTALYYCALE
Oreochromis niloticus Vs241 trav AERX01066489.2 247 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVLNLYWYHQKSGSHPQLLMAEHSAQTEKLKFIHDREKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus Vs242 trav AERX01067394.2 792 VTCDQLTPVKDEESSLEGSTVTLTCTYTKGAADYFFWYRQHPGKAPEFLISHLESGEIGIPPRSSRLSVGVRKDETKMNLQISSAAVTDSAVYYCAVQ
Oreochromis niloticus Vs619 ighv AERX01044029.2 7597 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSYRMVWVREAPGKGLEWIAFIHTGSSHIYYSQSVQGRFTISRHDSSSKLFLQMNSLKTEDTAVYYCARC
Oreochromis niloticus Vs618 ighv AERX01044029.2 10443 VKCEQLTQSGPVTLQPDQRLTINCQVTYSISTYWTVWIRQPAGKGLEWVGGSGVGHSTLYKDSLKNKFSISLDSSSKTVTLNGQNLQPEDTAVYYCARK
Oreochromis niloticus Vs617 ighv AERX01044029.2 12343 VKCEQLTQPKSETVQPGQRLTITCQVTYSLSTSWTGWIRQPAGKGLEWIGSRYTGEAAYKDSLKNKFSIDLDTSSKTVTLIGQNMQPDDTGMYYCAKD
Oreochromis niloticus Vs616 ighv AERX01044029.2 16213 VDICVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFGGDIYADWIRQPPGKGLEWIAHIESSSSSYYSQSFRGRFTISRDNSRKQVYLQMNSLMTEDSAVYYCVQE
Oreochromis niloticus Vs615 ighv AERX01044029.2 18416 VDGQTLTESEPVIKRPGESHTLTCTASGFTFRDYPMAWVRQAPGKGLEWVAYFSGGSGSTKYYSQSVQGRFTISRDNNKQQVYLEMNSLKTEDSAVYYCARK
Oreochromis niloticus Vs614 ighv AERX01044029.2 20326 VYSIDLIQSDSAVVQPGQSVTITCQVSGYSLTDRNYATGWIRQSEGKTLEWILHRWGNGDMAQNNALKNKLLHHTYTSNSSVTLTGVNLQPEDTAVYYCVRS
Oreochromis niloticus Vs613 ighv AERX01044029.2 21955 IDGQTLTESEPAVKRPGESHTLTCTASGFTFRDYWMAWVRQAPGKGLEWIASISYPSGSNKYYSQTVQGRFTISRDNDKQQVYLEMSSLTTADSAVYYCAR
Oreochromis niloticus Vs612 ighv AERX01044029.2 25390 TEGQTLTQSEAVVQRPGESHRLTCTYSGFSGDFYAAWIRQAAGKGLEWIAWIRYDGSSTYYSQSVEGRFTISRDNSRKQVYLQMNSLTADDSAVYYCARQ
Oreochromis niloticus Vs611 ighv AERX01044029.2 27752 VYSIDLIQSDSAVVQPGQSVTITCQVSGYSLTDRNYATGWIRQSEGKTLEWIVHRWGSGVYAQNNALKNKLLHRTHTSTSSVTLTGVNLQPEDTAVYYCVRV
Oreochromis niloticus Vs610 ighv AERX01044029.2 29854 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSCCNMHWNRQPAGKALEWLGRVRSSGSGTDYSSSLRGRIEVTRDNSNSLTYLRLSNLKPEDSAVYYCAKD
Oreochromis niloticus Vs85 igkv AERX01029067.2 9469 SRGQITVTQPGAVSSAVEGSVNMDCKISHTVINSDSVEWYQHKQGEPPKLLIYYSNQRVSGISSRFTGSGSDKDFTLTISGVQAEDAAVYYCKG
Oreochromis niloticus Vs682 trav AERX01054125.2 3330 CKGEDKVIQEQGDVIAAEGDTVTLGCRYETTRANPTLFWYKQEVNSYPKYMLKCFSETTDKSEEFNNDRFDAKINKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs683 trav AERX01054129.2 1830 CKGEDKVIQEQGDGIAAEGVTVTLGCTFASQTTATLFWYKQEVNSYPKYILRKFLSGATDKAPEFQEDRFDAKINETSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus Vs763 trbv AERX01065144.2 4428 VCLGVEVRQSPSEFITKAGSKVEIFCSHEKTDYRMMLWYQQLPGETAMKLIGYLYYKDPTFEEQYDNFNITGDLSVNTVKKGYLIVQVAKQEHSAAYYCAASK
Oreochromis niloticus Vs762 trbv AERX01065143.2 833 FSQDVIQEPEIRWSYVNKAAEMNCSHKRDISHNQMYWYIQRPGETMRLIVYTALGGVPDYGGAPENKYSATKAKAENGALTVNDLQQNDTGVYFCAVS
Oreochromis niloticus Vs767 trbv AERX01065145.2 6929 SSLSDQVHQIPADMFQIQGQTATINCSHSIDDYDRILWYKQTKSKELHFLGYMFENLRNPEPGVNVTMAGNANKDETCTLTIADLTVSSSAVYFCAAR
Oreochromis niloticus Vs764 trbv AERX01065144.2 3256 VCLGVKVSQTPVAVFRRPGENVQLVCSHEKTDYMLMQWYQKSPGDQALKRIGHLYYNNKEHEEVFKTHFNISGDLSGEKAKNASLFIVDLKAPEHSAVYYCAASY
Oreochromis niloticus Vs143 igkv AERX01053227.2 6511 SSAEIILTQTPKAQSVVPGQTVSIRCKSSTTIGDDINWYLQKSGKTPKLLIYDTTERQSGVPDRFRATAVQTDFTLIISGVQTEDAGVYYCQ
Oreochromis niloticus Vs142 igkv AERX01053225.2 21 SRGQITVTQPGAVSSAVGGSVNIKCRTSQRVDSGNRLAWYQQKDGGVPKLLIYHASNRESGIPAHFTGSGSNSDFTLTISGVQAEDAAVYYCQSAHVINSQ
Oreochromis niloticus Vs141 igkv AERX01051927.1 62 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYVSGSSHRLAWYQQKDGVLKMLIHSASTRLSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs269 trbv AERX01073867.1 1614 VSSTYTVQQTPPSIIKKVGQAVSSEIHCSHEVLIFERILWYKQDKDRAPQFLGYLNLNSPYPEEDVKGKISFNGNGKKYSNLTISNVSVTDSAVYFCAAS
Oreochromis niloticus Vs144 igkv AERX01053229.2 3593 SRGQYTVTQPGAVSSAVGGSVSIKCSTSQDVYSSNCLAWYQQKDGGVPKLLIYYASSRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs260 ighv AERX01072430.1 364 VKCEQLTQPPSVIVQPGQRLTITCQVSYSLGYWTAWIRQPAGKGLEWIGMKYTGDSHYKDSLKNKFSIDLDTSSNTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus Vs261 trbv AERX01073330.1 1059 SSLSDQVHQIPADMFQIQGQTATINCSHSIDDYDRILWYKQTKSKELHFLGYMFENLRNPEPGVNVTMAGNANKDETCTLTIADLTVSSSAVYFCAAR
Oreochromis niloticus Vs266 trbv AERX01073866.1 416 ASDTKSVNQTPPSIITRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFNDSAVYFCAAK
Oreochromis niloticus Vs267 trbv AERX01073866.1 1614 VSSTYTVQQTPPSIIKKVGQAVSSEIHCSHEVLIFERILWYKQDKDRAPQFLGYLNLNSPYPEEDVKGKISFNGNGKKYSNLTISNVSVTDSAVYFCAAS
Oreochromis niloticus Vs94 trav AERX01032939.2 4208 CKGEDKVIQEQGDVIATEGDTVTLECRYETSDTYPYLFWYKQEIYYFPKYVLQRDKGSENNALEFPKERFDAEFNDKAVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus Vs95 trdv AERX01032939.2 9094 LTAGDSITPEQAEVTETQGRSVTLTCNNQTNYTHPELHWYRHHSDLQAPQFILWKGARSRSGVQYIPDDRYDSEASSTSTNLTITALTLTDTALYYCALQ
Oreochromis niloticus Vs546 ighv AERX01043981.2 3510 VDGQTLTQSEPAVKRPGESHRLTCTASGYNFGSYSLVWVRQAPGKGLEWIAYIYWGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Oreochromis niloticus Vs545 ighv AERX01043981.2 7727 VYSIDHIQPSSLLVQPGQSLTITCQVSGYSLTDSGYGTGWIRQREGKLLDWIFYIWYDGNTYQNDALKNKFSMSRDTSAQTVTITGQHLQPEDTAVYYCARY
Oreochromis niloticus Vs544 ighv AERX01043980.2 2169 VDGQTLTQSEPVVKRPGDSHTLTCTGSGFSFSGYWMHWVRQAPGKGLEWVAGISEASGYIHYSQSVQGWFTISRDNSKQQVYLQMNRLKTEDSAAYYCARR
Oreochromis niloticus Vs543 ighv AERX01043976.1 650 VNGQTLTESEPAVKQPGQSHRLTCTASGFALSSYWIHWIRQAPGKGLEWIATDTTSSTKYYSQSVRGRFTISRDNSREQLYLQMNSLKTDDSAVYYCA
Oreochromis niloticus Vs542 ighv AERX01043974.2 480 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSSWMAWIRQAPGKGLEWIATDGGGSSKYYSQSVQGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs541 ighv AERX01043972.2 2068 VKGQTLTESEPAVKQPGESHRLTCTTSGFTLSSYWIHWIRQAPGKGLEWIAADTGSTKYYSQSVRGRFTISRDNSREQLYLQMDSLKTEDSAVYYCA
Oreochromis niloticus Vs540 ighv AERX01043970.1 1421 VWSEVKLEQSASEVKRSGERVKMSCIISGYSLTSYNIHWIRQRPGRALEWIGYMSTGNNSPRYASSFQSRFIMTEEDSSRSQYLEIKSLTAEDSAVYFCARI
Oreochromis niloticus Vs87 igkv AERX01029076.1 891 SRGQITVTQPGAVSSAVGGTVNIKCRTSPNVNLWNNNHLLAWYQKKDGGVPKLLIYDAGTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus Vs549 ighv AERX01043982.2 4782 VYSIELIQPDSRVMQPGQSMTITCQVSGYSLTDGSYGTCWIRQRQGKQMDCIFCMWSDGSTDKNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARG
Oreochromis niloticus Vs548 ighv AERX01043982.2 6200 ADCQTLTESEPAVKRPGESHRLTCTTSGFNFGDYSMHWVRQAPVKGLEWMAYIRYDSALIYYSQSVQGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCVRY
Oreochromis niloticus Vs211 ighv AERX01063563.2 3208 LNGQAMESIPSTPVLKNPHETLSLSCRGSGFNFGSYGMHWIRQPAGKGLEWFGTILSDASRTEYIASVQGRIEITKDDSNRMTYLRLSNLKPEDSAVYYCAT
Oreochromis niloticus Vs81 igkv AERX01029022.2 4254 EIILTQTPKAQSVVPGQTVSIRCKSSTTIGDDINWYLQKSGKAPKLLIYDTTARQSGVPDRFRATAVQTDFTLIISGVQTEDAGVYYCQQRNSFP
Oreochromis niloticus Vs821 trbv AERX01074786.1 785 LTVIVLQSKDQISDPGRTVMLECKMGPGFSMGSYTMFWYRQNHHGAPIEFLMREYEKPVGRLESFIDTSKNNFSLQITELHINDSSTYYCAA
Oreochromis niloticus Vs82 igkv AERX01029026.2 2990 SSGEKVLTQTPGSQSVVLGQTVSVRCKASSSVSGCLNWYLQKDGESPKLLIYSATSRQSGVSERFSGSGSGTDYTLTISRVQAEDAGVYYCQQCNSWP
Oreochromis niloticus Vs644 ighv AERX01044056.2 2835 VTGQSMESIPSSPVVKKPGETLSLSCRGSGFSFDCCVMIWVREPAGKPLELIGSGFSTSSRNSYASSLRGRVEISRDDSNSMVYLRLSNLRPEDSAIYYCAKE
Oreochromis niloticus Vs645 ighv AERX01044056.2 1179 VKCEQLTQTASVNVQPGHRLTITCQVAYSLSSYRTAWIRQPAGKGLEWIGDAHYGYPTFYKDSLKNKFTINLDTSSKTVTLNGQNMRPEDTAVYYCARD
Oreochromis niloticus Vs646 ighv AERX01044057.2 455 TGGQTLTESEPVVKRPGDSHRLTCTYSGFSYDIAAAWIRQAAGKRLEMIAWIYDDGSSKFYSQSVRGRFTISRDNSRKQVYLQMNSLTTQDSAVYYCAR
Oreochromis niloticus Vs647 ighv AERX01044062.2 4588 TEGQTLTESESVIKRPGDSHRLTCTYSGFGGDYNNAWIRQAAGKGLEWIAYISGGSSYIYYSESVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARY
Oreochromis niloticus Vs640 ighv AERX01044054.1 534 TGGQTLTESESVIKRPGDSHRLTCTYSGFSYDIAVAWVRQAAGKGLEWIAWIESGSGSSKYYSQSVQGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARN
Oreochromis niloticus Vs641 ighv AERX01044055.2 2766 VNISVGTEGQTVTESEPVVKRPGDSHRLTCTYSGFSSDIHANWIRQAAGKRPEWIAYINPSSGTYYSQSVRGRFTISRDNSRKQVYLQMSSLTSEDSAVYYCARD
Oreochromis niloticus Vs642 ighv AERX01044055.2 587 TDGQTLTESESVVKRPGDSHRLTCTYSGFSSDIYANWIRQAAGKGLEWIAYINPGSSSIYYSQSVQGRFTISRDNSRKQVYLQMNSLTSEDSAVYYCAKE
Oreochromis niloticus Vs643 ighv AERX01044056.2 4146 VKCEQLTQPGSLTVRPGDRPSPVHHLTITCQASYSLSSARTFWIRQPAGKELECIGSVHIGHSTRYKDSLQNKFSIDIDCSNRTSTLIGQNVQPEDSAVYYCARE
Oreochromis niloticus Vs648 ighv AERX01044063.2 3185 VQCEQLTQKASETVQPGQRLTITCQVSYSVTSRWTAWIRQPAGKGLEWIGSRVGATLAYKDSLKNTFSISLDSSSNTVTLTGQNMQPEDTAVYYCARD
Oreochromis niloticus Vs649 ighv AERX01044063.2 580 IDGQTLTQSEPVVKRPGESHRLTCTTSGLSFSSWWMAWIRQAPGKGLEWIASNTYRGANYYSQSVQGRFTASRDNSREQLFLQMNNLKTEDSAVYYCARD
Oreochromis niloticus Vs720 trbv AERX01065120.1 3614 GSSDSDQVDQTPANIYTNGEEAKIHCSHSISSYNQILWYKQSEKQLLLLGYMYYDKSNPEPGVNVTMDGDARQHKNCTLTIKELELSSSGVYFCAAS
Oreochromis niloticus Vs528 ighv AERX01043961.2 5413 VWSEFKLEQSPSQVKRPGEKVKMSCIISGYSSTNYNINWIRQRPGRALEWIGRMTTWSNSAFYGSSFQSRVIITGEDVPSSTHYLEIKSLTAEDSAIYFCARQ
Oreochromis niloticus Vs589 ighv AERX01044015.2 22462 VDGQTLTQSEPVVKRPGDSHTLTCTGSGFTFSDYWMNWVRQAPGKGLEWVATDTSSSTNYYSQSVRSRFTISRDNSKQQVYLQMNRLKTEDSAVYYCARR
Oreochromis niloticus Vs588 ighv AERX01044014.2 2722 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYRMAWVREAPGKGPEWIAYIGTSDYSYATSYSQSVQGRFTISRDDSSSKLHQQINSLKTEDTAVYYCARR
Oreochromis niloticus Vs583 ighv AERX01044010.2 3886 VNGQTLRESEPVVKRPGQSHRLTCTASGFTFSDYRMVWVRQAAGKGPEWIAYISISDYSYATHYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus Vs582 ighv AERX01044008.1 2154 VKCEQLTQPASETVQPGQRLTITCQVSYSVTSYYTAWIRQPAGKALEWIGMAAGSTTYYKDSLKSKFSISTDSSNNRVTLNGQNMQPEDTAVYYCARL
Oreochromis niloticus Vs581 ighv AERX01044007.2 892 VWSEIKLEQSPSEVKGFGERVKMSCTLSGYTLTDHDIHWIRQRPGRALEWIGYMSTGYNSPGYGSSFQSRFIMTEEDSSSRQYLDINGLTAEDSAVYFCARQ
Oreochromis niloticus Vs580 ighv AERX01044007.2 5622 VDGQTLTQSEPVVKNPGNSHRLTCTASGFTFSNYFMHWIRQAPGKGLEWIATIRTSGYSYATYYSQSVQGRFTISRDDSSSKLYLQMNNLKTEDTAVYYCARE
Oreochromis niloticus Vs587 ighv AERX01044012.1 3157 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGLEWIAFIETSTYSYATFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARG
Oreochromis niloticus Vs585 ighv AERX01044011.2 12788 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSSYWMHWVREAPGKGLEWVATIQVTSTYYSQSVQGRFTISRDNTRQQVYLQMNSLKTEDSAVYYCAREPK
Oreochromis niloticus Vs584 ighv AERX01044010.2 1302 VEGQTLTQSEPVVKRPGESHRLTCTSSGFTFSDYEMVWVRQAPGKGLEWIAIISISTYSYATYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus Vs216 ighv AERX01063569.1 1910 TEGQTLTESEPVVKRPGDSHRLTCTYSGFSSDINVGWIRQAAGKRLEWIAFIEYDSSYIHYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARD
Oreochromis niloticus Vs47 trbv AERX01013602.1 164151 DGSDVTQNSTIWKKQGEDGTINCRHTKSVDYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDFNTGTFTIKNLVPKDKGLYFCAVS
Oreochromis niloticus Vs256 ighv AERX01072286.2 1528 TEGQTLTESEPVIKRAGDSHRLTCTYSDFNVHEDNVWIRQAPGNGLEWIAYISGGGSYIHYSQSVKSHFTISRDNSRQQVYLQMNSLNNEDSAVYYCA
Oreochromis niloticus Vs391 iglv AERX01023658.1 3031 VSGVTVVTQKPPVVSVRKGETATMDCNLGTVDTFVFWYKQIPGGVPQYVMCFHYGSTRPCYGSGFSSPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQIL
Oreochromis niloticus Vs739 trbv AERX01065132.1 870 HVDGSDVTQTPILWKYQGDSATMSCNHTKGDLYFQMYWYRQLPGETMKLIVFTTRGKKDDDQDFGDFSKEKFSVTKPTADKGTFTVKNLQPNDKGLYFCAVS
Oreochromis niloticus Vs633 ighv AERX01044048.2 1205 TEGQTLTESESVVKRPGDSHRLTCTYSGFSSDYWNAWIRQAAGKGLEWVALINPDSSSTYYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCAR
Oreochromis niloticus Vs166 igkv AERX01057066.1 180 SSGEQVLTQTPKAQSVVPGQTVSVRCKASSSVSSNLNWYLQKDGESPKLLIYSATNRQSGISDRFSGSGSRTDFTLTISRVQADDAGVYYCQHY
Oreochromis niloticus Vs809 ighv AERX01072975.1 365 VNCQTLTQSGPVDKRPGESHQLTCTTSGFTFNSYSMDWIRQAPGKGLEWIADITSVSTTYYSQSFQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARY
Oreochromis niloticus Vs665 ighv AERX01044078.2 5038 VDGQTLTESEPVIKRPGESHTLTCTASGFTFSSYDMHWVRQTPGKGLEWVAEVSTGSSKYYSQSVQGRFTISRDNSKQQVYLEMNSLKTEDSAVYYCARE
Oreochromis niloticus Vs401 trav AERX01024237.2 14323 WISVSVAQFYTVAVEPGQEITLQCSNFSSFATHIFWFRLADRLNASRISFMSTANSRVTFRDGFQYTKFNMTSNTSVVFLEIKQVDPSDSGLYFCGE
Oreochromis niloticus Vs478 ighv AERX01043908.1 2514 VCSQTVTESEPVIKRPGDSHKLTCTYAGISDGSADISWIQHTEGKGLEWVAHISAPSGGTTVYSTSVQNRFTISRDNNVDQVYLQMTSLTTEDSGVYYCARQ
Oreochromis niloticus Vs195 ighv AERX01063551.1 14233 VTGQSLESVPSSPVMKRPGETLSLSCRGSGSEFTCCGMHWIRQQPGKTLEWIGVGHRPSSNNRYANSLSGRIEVSRDDSNYIVYLRLSSLKPEDSAVYYCAR
Oreochromis niloticus Vs574 ighv AERX01044001.2 482 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYWMAWIRQAPGKGLEWIATDAGGSSKYYSQSVQGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus Vs480 ighv AERX01043909.1 542 VCSQTLTESEPVIKRPGDSHKLTCTYAGISDGDARISWIRQAEGKGLEWVAYISAPSGSDKYYSTAVQNRFTISRDNNVDQVYLHMSSLTTEDSAIYYCAR
Oreochromis niloticus Vs507 ighv AERX01043945.2 592 VNGQTLTESEPAVKRPGESHRLTCTGSGYNFGGHGMHWIRQAPGKGLEWIANIWSDGSNTYYSQSVRGRFTISRDNNRQQVYLQMNSLKTEDSAVYYCA
Oreochromis niloticus Vs547 ighv AERX01043982.2 9052 VYSVDLIQPDSMIVQPGQSLTITCRVSGYSLTDSNYATNWIRQRDGKQMDWIFTMWHDGSTSKNDALKNKFSMSRDTSARTVTITGQNLQPEDTAVYYCARM
Oreochromis niloticus Vs586 ighv AERX01044011.2 5584 VWSEIKLEQSTSEVKRPGERVKMSCIISGYTLRDYYISWIRQRPGRTLEWIGRMDTGSNSAHYASTFRSRFIITEENSGSRQYLEIRSLTAEDSAVYFCARQ
Oreochromis niloticus V9 trbv MKQE01000011.1 8986771 LTDANDVTQTPMLWEQQGDNATIDCSHNKGAFYVQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEVRDGTFTVKNLEPKDSGWYFCAVS
Oreochromis niloticus V8 trbv MKQE01000011.1 8982293 ASDTKSVNQTPPSIITRIGESVQSEIKCSHSIKDYEVILWYKQDQHQTLEILGYVNLQFVNKESNPSGNISFDGDGRKKSALTIYNLKFNDSAVYFCAAKRHSAA
Oreochromis niloticus V7 trbv MKQE01000011.1 8979451 ASDTKSANQTPPSIIKRIGESVQSEIKCSHSIPSYQVILWYKQDEKGVLQLLGYLNLEYPNIEVDVKGKISFDGDGRKHSNLTISNVSVTDSAVYFCAAS
Oreochromis niloticus V6 trbv MKQE01000011.1 8977974 LTDGGEVKQTAMLWKNQGDNVSIECSHTYGSSYYYMYWYRQLPGELMKQMVFTIANSKPDFEPDFRDKKFSTTKPDADSGTLIVKNLVPGDQGLYFCAVSMHSDT
Oreochromis niloticus V5 trbv MKQE01000011.1 8975817 DGSDVNQTSMIWKKQGEDATINCSHTKDFSHNQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDAYTGTFTVKDLVPTDKGLYFCAVS
Oreochromis niloticus V4 trbv MKQE01000011.1 8961262 LTDRSDVDQTSMLWKNQNDNATIHCSHTKGGGYFQMYWYRQLPGELMKQMVFTTPSTEPDFEPDFRDDKFSATKRDALSGTLIVKNLVPGDQGLYFCAVS
Oreochromis niloticus V3 trbv MKQE01000011.1 8958085 ASDTKSADQTPPSIIKRIGESVQSEIKCSHSIPSYQVILWYKQDEKGVLQLLGYLNLEYPNIEVDVKGKISFDGDGKKYSNLTISNVSVTDSAVYFCAAS
Oreochromis niloticus V2 trbv MKQE01000011.1 8957020 DGSDVTQTSMIWKKQGEDATINCSHTKDYTYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFTREKFAATKPDAYTGTFTVKDLEPKDKGLYFCAVS
Oreochromis niloticus V1 trbv MKQE01000011.1 8954687 ASDTKSANQTPPSIIKRIGESVQSEIKCSHSIPSYQVILWYKQDEKGVLQLLGYLNLEYPNIEDDVRGKINFDGDGKKYSNLAISNVSVTDSAVYFCAAS
Oreochromis niloticus V0 trbv MKQE01000011.1 8953622 DGSDVTQNSTIWKKQGEDGTINCRHTKSVDYSQMYWYRQLPGETMKLVVFTSTAKPDHDFGNFSREKFAATKPDFNTGTFTIKNLVPKDKGLYFCAVS
Oreochromis niloticus V46 trav MKQE01000011.1 9050296 VFLGLEVRQSSSDIIANVSSNVQIFCSHDKTDYYVMFWYQQSPGDTAMKLIGFLNYAAVTLEEQYRDHFSITGNLGGNSAKNGSLSIQVKGQQDSAVYYCAASK
Oreochromis niloticus V45 trbv MKQE01000011.1 9047752 LCLGVEVHQTPSEVFRTPGENVQLVCSHGKTDYTLMQWYQKSPGDQALKRIGHLNYNNKEHEKSFEKHFNITGDLTGSQPKNASMFIVDLKPEHSAVYYCAASY
Oreochromis niloticus V44 trbv MKQE01000011.1 9047752 LCLGVEVHQTPSEVFRTPGENVQLVCSHGKTDYTLMQWYQKSPGDQALKRIGHLNYNNKEHEKSFEKHFNITGDLTGSQPKNASMFIVDLKPEHSAVYYCAASY
Oreochromis niloticus V43 trbv MKQE01000011.1 9043817 HSQDVTQEPEISWRFLNKAAEMNCSHNKDTRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus V42 trbv MKQE01000011.1 9043817 HSQDVTQEPEISWRFLNKAAEMNCSHNKDTRYTQMYWYIQRPGETMRLIVYTVFRGNPDYGGAPENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus V41 trbv MKQE01000011.1 9041798 SSLSDQVFQTPANMYKNQGQRAEINCSHSIAGYDRILWYKQTKSKQLHFLGYMVVSQGAPESGWRVDIKGSANPHQTCTLIIKDLTLNSSAVYFCAAR
Oreochromis niloticus V40 trbv MKQE01000011.1 9035272 FSQDVIQEPEIRWSYVNKAAEMNCSHNKDITHNQMYWYIQRPGETMRLIVYTALGGVPDYGGAPENKYSATKAKAENGALTVNDLQQNDTGVYFCAVS
Oreochromis niloticus V39 trbv MKQE01000011.1 9034596 SSLSDQVFQTPADMHKNQGRRAEINCVHKIANYDRILWYKQTENSQLQLLGYMLKTKDVLEPGWMVEIKGSADKDKTCTLIIKDLTLNSSAVYFCAAS
Oreochromis niloticus V38 trbv MKQE01000011.1 9034596 SSLSDQVFQTPADMHKNQGRRAEINCVHKIANYDRILWYKQTENSQLQLLGYMLKTKDVLEPGWMVEIKGSADKDKTCTLIIKDLTLNSSAVYFCAAS
Oreochromis niloticus V37 trbv MKQE01000011.1 9027563 VCLGVKVSQTPVEVFRRPGENVQLVCSHEKTDYMLMQWYQKSPGDQALKRIGHLYYNNKEHEEVFKTHFNISGDLSGDKAKNASLFIVDLKAPEHSAVYYCAASY
Oreochromis niloticus V35 trbv MKQE01000011.1 9021348 HSQDVTQQPEIRWSYVNKAAEMNCSHNKDKGHSQMYWYIQRPGETMRLIVYTVFGGKPDYGGAPENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus V34 trbv MKQE01000011.1 9021348 HSQDVTQQPEIRWSYVNKAAEMNCSHNKDKGHSQMYWYIQRPGETMRLIVYTVFGGKPDYGGAPENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus V33 trbv MKQE01000011.1 9021348 HSQDVTQQPEIRWSYVNKAAEMNCSHNKDKGHSQMYWYIQRPGETMRLIVYTVFGGKPDYGGAPENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus V32 trbv MKQE01000011.1 9018500 VCLGVKVFQTPVEIFRTPGENVQLVCSHEKTDYVVMQWYQKSPGDQALKRIGHLYYNNKEHEEVFKTHFNISGDLSGEKAKNASLFIVDLKAPEHSAVYYCAASY
Oreochromis niloticus V31 trbv MKQE01000011.1 9017866 FSQDVIQEPEIRWSYVNKAAEMNCSHKRDISHNQMYWYIQRPGETMRLIVYTALGGVPDYGGAPENKYSATKAKAENGALTVNDLQQNDTGVYFCAVS
Oreochromis niloticus V30 trbv MKQE01000011.1 9017190 SSLSDQVFQTPADMYKNQGQRAEINCVHKIASYDRILWYKQTENSQLQLLGYMLKTKDVLEPGWMVEIKGSADKDKTCTLIIKDLTLNSSAVYFCAASYHSA
Oreochromis niloticus V29 trbv MKQE01000011.1 9017190 SSLSDQVFQTPADMYKNQGQRAEINCVHKIASYDRILWYKQTENSQLQLLGYMLKTKDVLEPGWMVEIKGSADKDKTCTLIIKDLTLNSSAVYFCAASYHSA
Oreochromis niloticus V28 trbv MKQE01000011.1 9014005 HSQDVTQQPEIRWSYVNKAAEMNCSHNKDKGHNQMYWYIQRPGETMRLIVYTVFGGKPDYGGASENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus V27 trbv MKQE01000011.1 9014005 HSQDVTQQPEIRWSYVNKAAEMNCSHNKDKGHNQMYWYIQRPGETMRLIVYTVFGGKPDYGGASENKYSASKAAIENGALTVNDLQQNDSGVYFCAVS
Oreochromis niloticus V26 trbv MKQE01000011.1 9010369 VCLGVKVSQTPVAVFRRPGENVQLVCSHEKTDYMLMQWYQKSPGDQALKRIGHLYYNNKEHEEVFKTHFNISGDLSGEKAKNASLFIVDLKAPEHSAVYYCAASY
Oreochromis niloticus V25 trbv MKQE01000011.1 9005345 VCLGVKVFQTPVEIFRTPGENVQLVCSHEKTDYVVMQWYQKSPGDQALKRIGHLYYNNKEHEESFKTHFNISGDLSGDNAKNASMFIVDLKAPEHSAVYYCAASF
Oreochromis niloticus V24 trbv MKQE01000011.1 9004644 LSPSDRVHQEPADMYKTSEDIAKIQCLQSIDDNHNRILWYKQSNNQLQLLGYMLANRGSPETGLNVSIEGSANKDQTCTLTIKRLDFNSSAVYFCAASYHSAT
Oreochromis niloticus V23 trbv MKQE01000011.1 9004644 LSPSDRVHQEPADMYKTSEDIAKIQCLQSIDDNHNRILWYKQSNNQLQLLGYMLANRGSPETGLNVSIEGSANKDQTCTLTIKRLDFNSSAVYFCAASYHSAT
Oreochromis niloticus V22 trbv MKQE01000011.1 9003031 SSLSDQVHQNPAHMYKEQGETADITCSHSIDNYDRILWYKQTKGHLQFLGYIVGNLGNPETGANVTIIGNANKDKTCTLTIKDLTLNRSAVYFCAAR
Oreochromis niloticus V21 trbv MKQE01000011.1 9003031 SSLSDQVHQNPAHMYKEQGETADITCSHSIDNYDRILWYKQTKGHLQFLGYIVGNLGNPETGANVTIIGNANKDKTCTLTIKDLTLNRSAVYFCAAR
Oreochromis niloticus V20 trbv MKQE01000011.1 9001766 SSLSDQVHQIPADMFQIQGQTATINCSHSIDDYDRILWYKQTKSKELHFLGYMFENLRNPEPGVNVTMAGNANKDETCTLTIADLTVSSSAVYFCAAR
Oreochromis niloticus V19 trbv MKQE01000011.1 9000360 LIDAKDVTQTPMLWERQGNNATMDCSHTKDANYIQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFKKEKYSATKTEVRDGTFTVKDLQPKDSGWYFCAVS
Oreochromis niloticus V18 trbv MKQE01000011.1 9000360 LIDAKDVTQTPMLWERQGNNATMDCSHTKDANYIQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFKKEKYSATKTEVRDGTFTVKDLQPKDSGWYFCAVS
Oreochromis niloticus V17 trbv MKQE01000011.1 8999104 VSSTYTVLQTPPSIIKKVGQSVSSQIHCSHNVSIFDRILWYKQDEHRALKFLGYLNGEYPYPEDDVKGKISFDGNARKHSNLTISNVSVTDSAVYFCAA
Oreochromis niloticus V16 trbv MKQE01000011.1 8996769 LTDAKDVTQTPMLWEQQGNNATMDCSHTKGASYFQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFKKEKYSATKTEARDGTFTVKNLQPKDSGWYFCAVS
Oreochromis niloticus V15 trbv MKQE01000011.1 8996769 LTDAKDVTQTPMLWEQQGNNATMDCSHTKGASYFQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFKKEKYSATKTEARDGTFTVKNLQPKDSGWYFCAVS
Oreochromis niloticus V14 trbv MKQE01000011.1 8995547 VSSTYTVQQTPPSIIKKVGQSVSSEIHCSHSVSTFNWILWYKRDKHRALKFLGYLNVKSPNPEDDVKGKINFDGDARKHSNLTISNVSVTDSAVYFCAA
Oreochromis niloticus V13 trbv MKQE01000011.1 8993767 LIDAKDVTQTPMLWKRQGNNATMDCSHTKDANHFQMYWYKQLPGENMELIVFTTTAKKYDHDFGKFGKEKYSATKTEARDGTFTVKNLQPKDSGWYFCAVS
Oreochromis niloticus V12 trbv MKQE01000011.1 8992507 VSSTYTVQQTPPSIIKKVGQSVSSEIHCSHSVSSFTQILWYKREKHRSLKFLGYLNVISPNPEDDVKGKINFDGDARKHSNLTISNVSVTDSAVYFCAA
Oreochromis niloticus V11 trbv MKQE01000011.1 8990731 LIDAKDVTQTPMLWERQGNNATMDCSHTKDATYIQMYWYRQLPGENMELIVFTTTAKKYDHDFGKFSKEKYSATKTEARDGTFTVKHLEPKDSGWYFCAVS
Oreochromis niloticus V10 trbv MKQE01000011.1 8989503 VSSTYTVQQTPPSIIKKVGQSVSSEIHCSHEVSSFNRILWYKQDEHRALKFLGYLNVNSPIPEDDVKGKINFDGDARKHSNLTISNVSVTDSAVYFCAA
Oreochromis niloticus V84 trbv MKQE01000011.1 9164402 SSFSDKVYQTPANIYTNGEDAKISCSHNISSYNQILWYKQSKKQLELLGYMVLTGSNAEAGLNVVMEGSASQGKNCTLTIKETKLNSSGVYFCAAS
Oreochromis niloticus V83 trbv MKQE01000011.1 9161783 SSLSDQVNQDPANIYTRGEDAKIYCSQSIPNYNRILWYKQLETQLQFLGYMYLNDDNPEPGVNVMINGSARTGEKCTLTIKDIKPSSSGVYFCAAS
Oreochromis niloticus V82 trbv MKQE01000011.1 9160404 STSSDQVDQTPADIYTKGEDVKVYCSHSIQSYNKILWYKQSEKQLQYLGYMNIDKGYPETGVNVTMEGNANKGKNCTLTIKDLKLSSSGVYFCAASYHSAA
Oreochromis niloticus V81 trbv MKQE01000011.1 9155753 SSLSDQVDQTPADIYTQGEEVKIHCSHSNPNFYTILWYKQSEKQLQLLGYTNYDKSYLEPGVNVTMDGDARQHKNCTLTIKDPHVSSSGVYFCAASYHSA
Oreochromis niloticus V80 trbv MKQE01000011.1 9153920 SSLSDQVDQDPANIYTRGEDAKIYCSHSIPSYNQILWYKQLETQLQFLGYMYLNDDNPEPGVNVMINGSARTGEKCTLTIKDIKPSSSGVYFCAAS
Oreochromis niloticus V79 trbv MKQE01000011.1 9152568 STSSDQVDQTPADIYTKGEDVKIYCSHSIQSYDEILWYKQSEKQLQYLGYMNIDKGYPETGVNVTMEGNANKGKNCTLTIKDLKVSSSGVYFCAAS
Oreochromis niloticus V78 trbv MKQE01000011.1 9152568 STSSDQVDQTPADIYTKGEDVKIYCSHSIQSYDEILWYKQSEKQLQYLGYMNIDKGYPETGVNVTMEGNANKGKNCTLTIKDLKVSSSGVYFCAAS
Oreochromis niloticus V77 trbv MKQE01000011.1 9149534 SSLSDQVSQTPANIYTEGEEVKIYCWHSNPSYDQILWYKKSEKQLQLLGYMYYDKSYPEPGVNITMDGDARQNKNCTLTIKDPQVSSSGVYFCAARYHSA
Oreochromis niloticus V76 trbv MKQE01000011.1 9147909 SSLSDQVDQTPADIYTQGEEVKIHCSHSNPNFYTILWYKQSEKQLQLLGYTNYDKSYLEPGVNVTMDGDARQHKNCTLTIKDPHVSSSGVYFCAASYHSA
Oreochromis niloticus V75 trbv MKQE01000011.1 9143622 SSLSDQVDQTPADIYTQGEEVKIHCSHSIPSYDTILWYKQSEKQLQLLGYMWNDKGYPETGLNVTVDGDARQHKNCTLTIKYLKVSSSGVYFCAARYHSA
Oreochromis niloticus V74 trbv MKQE01000011.1 9141446 GSPASDQVNQTPANIYTKGGDVKIHCSHRIQNYYQILWYKQSEKQLQLLGYMYYDNSYPEAGVNVTMDGGAEKDQNCTLTIRDLKASSSGVYFCAAS
Oreochromis niloticus V73 trbv MKQE01000011.1 9133854 SSSSDKVDQTPPNIHTKEKEVEIYCSHRIQDYNQILWYKQSEKKLQLLGYLRYGTGTPETGVNVTIDGGAEKGENCTLTIKDLKVSSSGVYFCAASYHSA
Oreochromis niloticus V72 trbv MKQE01000011.1 9129703 ASSFSDQVHQTPPNIYAKEDEAKIYCSHSISGYYTILWYKQSEKQLQFLGYMLDDRGNPETGVTVRMDGDAREHKNCTLTIKDLKVSSSGVYFCAAS
Oreochromis niloticus V71 trbv MKQE01000011.1 9123962 SSFSDQVYQTPANIYTKGDEAKIYCSHSISGYYQILWYKQSEEQLQFLGYMLYKEGNPEPGVNVTMDGDANQKENCTLTIKDLKVSSSGVYFCAAG
Oreochromis niloticus V70 trbv MKQE01000011.1 9123962 SSFSDQVYQTPANIYTKGDEAKIYCSHSISGYYQILWYKQSEEQLQFLGYMLYKEGNPEPGVNVTMDGDANQKENCTLTIKDLKVSSSGVYFCAAG
Oreochromis niloticus V69 trbv MKQE01000011.1 9122739 ASSFSDQVHQTPPNIYTKEDEAKIYCSHSISGYYTILWYKQSEEQLQFLGYMLDDKGNPETGVNVTMDGDARQHKNCTLTIKDLKVSSSGVYFCAAS
Oreochromis niloticus V68 trbv MKQE01000011.1 9121428 GSSVQVYQTPTNIYTTGGDAKINCSHSIPTYNQILWYKQSEKTLQLLGYLRFGTVTPETGANVTMDGGANEKETCTLTIKDLKVSSSGVYFCAAS
Oreochromis niloticus V67 trbv MKQE01000011.1 9118308 SSSSDKVDQTPANIHTKEKEVKIQCSHRIQDYDTILWYKQSEKQLQLLGYLRYGKDYPETGVNVTMDGGAEKEENCTLTIKDLKVSSSGVYFCAAS
Oreochromis niloticus V66 trbv MKQE01000011.1 9116643 SSLSDQVNQTPANIYAKEEEEAKMNCSHSIQSYDTVLWYKQSEKQLQFLGYMYLSNYNPEPGVNVSMDGNADKGKNCTLIIKELKLSSGGVYFCAAYYHSAA
Oreochromis niloticus V65 trbv MKQE01000011.1 9114381 SSGSHQVDQTPANIYSKGEEAKLYCSLSISGYYQILWYKQSKKQLQYLGYIYSGKSSLETGVNVTIDGGAEKGENCTLTIKDLKVSSSGVYFCAAT
Oreochromis niloticus V64 trbv MKQE01000011.1 9112968 SSSSDQVDQTPANIYTTGEEVKINCSHSIQSYDTILWYKQSKKTLQLLGYLRFGKDYPEPGVNVTIGGSANVKENCTLTIKEFELSSSGVYFCAASYHSA
Oreochromis niloticus V63 trbv MKQE01000011.1 9111802 SSISHQVDQTPANIYTKGEEAQINCSHSITNYNQILWYKQSKTQLQLLGFLFLGKGTIEPGVNVTMDGGANINEKCTLTIKDIELSSSGVYFCAAS
Oreochromis niloticus V62 trbv MKQE01000011.1 9110342 SSLSDQVHQTPANIYAKEAEEAKMNCSHSIQSYETILWYKQSEKQLQLLGYMRYDKRYPETGVNVTMDGDARQHKNCTLTIKDLKVSSSGVYFCAAS
Oreochromis niloticus V61 trbv MKQE01000011.1 9105043 SSSSDQVNQTPANIYTTGEEVKINCSHSIQSYNTILWYKQSKTQLQLLGFLFLGQDTIEPGANVTIDGGANVKEKCTLTIKDIELSSSGVYFCAAS
Oreochromis niloticus V60 trbv MKQE01000011.1 9103064 SSSSDQVDQTPANIYTTGEEVKINCSHSIQSYEIILWYKQSEKTLQLLGYLRFGKGYPEPGVNVTIGGSANVKEKCTLTIKDIELNSSGVYFCAAS
Oreochromis niloticus V59 trbv MKQE01000011.1 9103064 SSSSDQVDQTPANIYTTGEEVKINCSHSIQSYEIILWYKQSEKTLQLLGYLRFGKGYPEPGVNVTIGGSANVKEKCTLTIKDIELNSSGVYFCAAS
Oreochromis niloticus V58 trbv MKQE01000011.1 9101300 SSSSDKVNQTPANIYTNGEEAKIYCSHSITNYNTILWYKQSEETLQLLGYLRVGKGTPETGVNVTIDGGANIKEKCTLTIKDIEVSSSGVYFCAAS
Oreochromis niloticus V57 trbv MKQE01000011.1 9100116 SSFSDKVDQTPANIYTTGENVKIYCSHSITNYNRILWYKQSKTQLQLLGFLFSGRGTIEPGVNVTMDGGANEKEKCTLTIKDIELSSSGVYFCAAY
Oreochromis niloticus V55 trbv MKQE01000011.1 9096668 GTDGSDVQQTPILWGRVGGSATMYCNHTKGDVYFQMCWYRQLPGQTLELIVFISIAKNGDDHDYGNLNTEKFSASKSVPESGTLTVKNLEPKDRGLYFCVVS
Oreochromis niloticus V54 trbv MKQE01000011.1 9093232 LTDGSDVEQTPTLWEKEGKSATMQCNHTKDFTYSYMYWFRQLPGETMTLIVFATTGKKDNEHDYGNFDKEKFSASKPVAESGTFTVKNLKPEDKGWYFCAVS
Oreochromis niloticus V53 trbv MKQE01000011.1 9091476 LTDGSDVEQTPILWEREGQNATMQCNHTKDATYRYMYWFRQLPGETMTLIVFATTGKKDNEHDYGNFDKDKFSANKPVVENGTFTVKNLKPEDKGWYFCAVS
Oreochromis niloticus V52 trbv MKQE01000011.1 9087040 LTDGSDVSQTPLLWKSEGQSATMTCNHTKSFDYRQMYWYQQLPGQKIKQIVFTAPNTQHTYETGFSEEKFPATKSSYETGSLTVEKLVPGDNGVYFCAVS
Oreochromis niloticus V51 trbv MKQE01000011.1 9084956 LTDGSDVSQTPLLWKSEGQSATMTCNHTKNFDYTQMYWYQQLPGQKIKQIVFTAPTTQHTYESGFSKERFPATKNSYETGSLTVEKLVPGDSGVYFCAVS
Oreochromis niloticus V50 trbv MKQE01000011.1 9083123 GADGSDVQQTPILWEREGKSATMQCNHTKGSDYLWMYWFRQLPGEKLTLIVFATTGKTDNEHDYGDFSTGKFSASKTVAESGTFTVNKLEPKDQGWYFCAVS
Oreochromis niloticus V49 trbv MKQE01000011.1 9061285 QASAVIFEQSPPQIVDKNRQVQINCKHNDSTLLLMLWYQQLNENTSMTLIGSGYEQSPTYEGEFEKQFTLSRSSTVEGTLTIKKTDVSHSAVYFCAA
Oreochromis niloticus V48 trav MKQE01000011.1 9055360 TVLSALVIQQSPLNLLIKSQQQEFKLDCYHGDNSYPYMFWYQHKSAAGGQRTMDLIGQLHYENPTLEKTFKSKFNITGHSKGKAQLVISNVNLEDTAQYFCAAS
Oreochromis niloticus V122 trav MKQE01000018.1 29573 QKDNVLQAKGEETAAAGGTVTLHCLYNSSTTTAPSLFWYKQDGNNSPKFILSRVSRDDGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V121 igkv MKQE01000016.1 11952642 SQMFSSEHQESRFISAQVGGKVTLKCLYDAHVSARVFWFKQNLGQKPKIISHFFKYNVNNSFNEELKNNPRFTLDTQDGKYHLTIKALQISDSATYYCVQYS
Oreochromis niloticus V120 igkv MKQE01000011.1 12647358 SDASSSVTQSPVFKAAALGETVSLSCTASKGVDDDLSWYLQKPGQPHKLLFYQISRRQSDTPSHISSSGSEPEFTLTINGVQAADAGDYYCMGAYV
Oreochromis niloticus V119 igkv MKQE01000011.1 12643858 CSGQVTVTQPPVVTFTPGSTVTLTCRTNRAVYRWSDGDQGMAWYQQKSEQTPKLLIRYVKTLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQSFHEINSAYV
Oreochromis niloticus V118 igkv MKQE01000011.1 12640495 SDASSSVTQSPVFKAAALGERVSLSCTASKGVDDDLSWYLQKPGQPPKLLFYKISSREPDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYVDQ
Oreochromis niloticus V117 igkv MKQE01000011.1 12634897 CSGQVTVTQPPVVTFTPGSTVTLTCRTSQAVYRWSDGNEGMAWYQQKSGPTPKLLIKLAKTLESGTPSQFSGSGSSSDFSMTIIGVQAEDAAVYYCQSFHVINSAEV
Oreochromis niloticus V116 igkv MKQE01000011.1 12629263 SDASSSVTQSPVFKAAALGERVSLSCTASKGVDDDLSWYLQKPGQPLKLLFYKISSRESCTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYRGPE
Oreochromis niloticus V115 igkv MKQE01000011.1 12608290 CSGQVTVTQPPVVTSTPGSTVTLTCRTNPAVVRYTDGDQGMFWYQQKSGQTPKLLIKYVKTLESGTPSRFNGSGSSSDFSMTISGVQAEDAAVYYCKS
Oreochromis niloticus V114 igkv MKQE01000011.1 12608290 CSGQVTVTQPPVVTSTPGSTVTLTCRTNPAVVRYTDGDQGMFWYQQKSGQTPKLLIKYVKTLESGTPSRFNGSGSSSDFSMTISGVQAEDAAVYYCKS
Oreochromis niloticus V113 igkv MKQE01000011.1 12601707 CSGQVTVTQPPVVTFTPGSTVTLTCRTNSAVGTCNSKHCMFWYQQKSGQTTKLLVKHGSIIQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCKSVHSGPV
Oreochromis niloticus V111 igkv MKQE01000011.1 12585617 CSGQVTVTQPPVETSSPGSTVTLTCRTSQAVYRFSSGEGMYWYQQKSGQTPKLLIKFAKTLESGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCKSYHEKNSAAV
Oreochromis niloticus V110 igkv MKQE01000011.1 12574566 CSGQVTVTQPPVETFTPGSTVTLTCRTSQAVYRDSDGDDAMFWYQQKSGQTPKLLIKYVKTLESGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQSFHAINSAPV
Oreochromis niloticus V109 igkv MKQE01000011.1 12570018 SDASSSVTQSPVFKAAALGQTVSLSCTVSKGVDDDLSWYLQKPGQPPKLLFYQISSRESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGVYGGPV
Oreochromis niloticus V108 igkv MKQE01000011.1 12570018 SDASSSVTQSPVFKAAALGQTVSLSCTVSKGVDDDLSWYLQKPGQPPKLLFYQISSRESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGVYGGPV
Oreochromis niloticus V107 igkv MKQE01000011.1 12542596 CSGQVTVTQPPVVTSTPGSTVTLTCRTNPAINILVNDDYAMYWYQHKSGQTPKLLIKYAKTLQSGTPTRFSGSGSSSDFSMTISGVQAEDAAVYYCQS
Oreochromis niloticus V106 igkv MKQE01000011.1 12536475 CSGQVTVTQPPVMTSTPGSTVTLTCRTNPAIYRWGDGNEGMFWYQQKSGQAPKLLIKYAKTLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQS
Oreochromis niloticus V105 igkv MKQE01000011.1 12528136 CSGQVTVTQPPVLTSTPGSTVTLTCRTNSAVGTCNSKPCMFWYQQKSGQTPKLLIKFAKTLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCKSVHSGPV
Oreochromis niloticus V104 igkv MKQE01000011.1 12523474 SDASSSVTQSPVFKAAALGQTVSLSCTASQGVDDDLSWYLQKPGQPPKLLFYQISSRESDTPSHFSSSGSEPEFTLTINGVQADDAGDYYCMGVYGGPV
Oreochromis niloticus V103 igkv MKQE01000011.1 12523474 SDASSSVTQSPVFKAAALGQTVSLSCTASQGVDDDLSWYLQKPGQPPKLLFYQISSRESDTPSHFSSSGSEPEFTLTINGVQADDAGDYYCMGVYGGPV
Oreochromis niloticus V102 igkv MKQE01000011.1 12509282 CSGQVTVTQPPVVTFTPGSTVTLTCRTSQAVFRFDDGDDAMYWYQQKSGQAPKLLIRYAKTLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQSVHEINSAGV
Oreochromis niloticus V101 igkv MKQE01000011.1 12509282 CSGQVTVTQPPVVTFTPGSTVTLTCRTSQAVFRFDDGDDAMYWYQQKSGQAPKLLIRYAKTLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQSVHEINSAGV
Oreochromis niloticus V100 igkv MKQE01000011.1 12502178 CSSQVTVTQPPVVTFTPGNTVTLTCRTNPAVYRDSDGDDAMSWYQQKSGQTPKRLIKYAKMLESGTPSRFNGSGSSSDFSMTISGVQAEDAAVYYCQS
Oreochromis niloticus V99 igkv MKQE01000011.1 12498538 CSGQMTVTQPPVLTSTPGSTVTLTCRTSQAVFRDSDDDDYIFWYQQKSGQAPKLLIRYAKKLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCKSVHVINGAWV
Oreochromis niloticus V98 igkv MKQE01000011.1 12471367 SDASSSVTQSPVFKAAALGERVSLSCTASKGVDDDLSWYLQKPGQPSKLLFYKISRRESDTPSHFSSSGSEPEFTLTINGVQAADAGDYYCMGAYVGQ
Oreochromis niloticus V97 igkv MKQE01000011.1 12467725 CSGQVTVTQPPVLTSTPGSTVTLTCRTSPAVYRYDDGDDAMYWYQQKSGQAPKLLIKWAKTLESGTPSRFSGSGSSSDFSMTINGVQAEDAAVYYCQSYHEINSAWV
Oreochromis niloticus V96 igkv MKQE01000011.1 12467725 CSGQVTVTQPPVLTSTPGSTVTLTCRTSPAVYRYDDGDDAMYWYQQKSGQAPKLLIKWAKTLESGTPSRFSGSGSSSDFSMTINGVQAEDAAVYYCQSYHEINSAWV
Oreochromis niloticus V95 igkv MKQE01000011.1 12456647 CSGQVTVTQPPVVTFTPGSTVTLTCRTSQAVYRSSNGDAMYWYQHKSGQASKLLIKYAKTLESGTPSRFNGSGSSSDFSMTISGVQAEDAAVYYCQS
Oreochromis niloticus V94 igkv MKQE01000011.1 12339779 CSGQVTVTQPPVVTFTPGSTVTLTCRINPAVYRYSFGDDAMSWYQQKSGQTPKPLIKYAKTLESGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQS
Oreochromis niloticus V93 igkv MKQE01000011.1 12316856 CSGQVTVTQPPVLTSTPGSTVTLTCRISRAVAGCGDGQCMFWFQQKSGQTPKLLIRQVSTRHSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCKSVHSRPV
Oreochromis niloticus V92 igkv MKQE01000011.1 12299581 CSGQVTVTQPPVVTSTPGSTVTVACRTSQAVKRWDDGDAMSWYQHKSGQAPKLLIKYAKTLQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCQSQHYINSAWV
Oreochromis niloticus V91 trav MKQE01000011.1 9216414 KVESVTFEQSSAQVVNTGTEELRINCSHDGSNLQVMLWYQHKQSDQAMSLIGYTVLMGEPNYESQFTDRFQIKRDDTVKGSLIIKNLNLSDSAVYFCAA
Oreochromis niloticus V90 ighv MKQE01000011.1 9190052 FSRGVKIDQPQFIFSHEGTANVTLDCKQDDNQYDYMYWYRQSSDGKLELVTYSLMKDSGNIEAPFEKSKYTMSRPSMLETTLQIHPVAAEDTALYYCASRI
Oreochromis niloticus V89 trav MKQE01000011.1 9184599 LTVVVLQSEYQISDPGRTVTLECKMGSEFSMSSYTMLWYRQNHHGAPVDYLLNEYDKPVGRLESFIDTSKNNFSLQITELHMNDSSTYYCAA
Oreochromis niloticus V88 igkv MKQE01000011.1 9181535 FSSGVKIDQSQIIFSHEGTADVTLDCKQDDNQYYYMYWYRQSSDGKLELVTFSTGQNSWNIEAPFEKTKYTMSRPTVLEATLQIHPVVAEDTALYYCASSI
Oreochromis niloticus V87 trav MKQE01000011.1 9180352 LTVVVLQSEDQISDPGRTVTLECKMGSEFSMSSYTMLWYRQNHHGAPVDYLLNEYDKTVGRLKSFLDASKNNFSLQITELHMNDSSTYYCAA
Oreochromis niloticus V86 trbv MKQE01000011.1 9170909 GISLGVRVHQSPSAAIRNAGDDVELICTHEKTDYRVMLWYQQSPGDAALKLIGYVDYSTIKYEGEFEKYCNITGDLSGNTAKKGSLFIAGLKESEHSAVYYCAARY
Oreochromis niloticus V160 igkv MKQE01000018.1 14944927 VDAVIVLTQTPAVHTVSPGQQAVLNCNIERYDRNSVRWYKQVPGEAPQYVLSFLHSSSSLSFGTGFSSDRFNSKSSSNIDYQFIIKQAETGDSAVYYCQTYDDSAS
Oreochromis niloticus V159 igkv MKQE01000018.1 14944927 VDAVIVLTQTPAVHTVSPGQQAVLNCNIERYDRNSVRWYKQVPGEAPQYVLSFLHSSSSLSFGTGFSSDRFNSKSSSNIDYQFIIKQAETGDSAVYYCQTYDDSAS
Oreochromis niloticus V158 iglv MKQE01000018.1 14919566 VSGVTVLTQKPPVISVRKGETATMDCNLGTVINTVYWYKQIPGGSPQFVLYFYHSYSSPTYGSGFSSPKFTSTHQSTKDYCLIIKNVEEGDSAVYYCKTWDSSVSEYA
Oreochromis niloticus V157 igkv MKQE01000018.1 14912604 VSGVTVLTQKPPVLSVRKGETATMDCNLGTGTNAAAWHKQIPGGSPQHVVRFYHGWSSPGYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQTWDGSAASGV
Oreochromis niloticus V156 iglv MKQE01000018.1 14895864 VSGLTVLTQKPPVVSVSKGQTATMDCNLGTVTNYPAYWYKQIPGGVPQYVVRFRHSWSSPEYGSGFSSPKFTCTHQSTTDYRLIIKNVEEGDSAVYYCKTW
Oreochromis niloticus V155 iglv MKQE01000018.1 14888954 VSGVTVLTQKPVVSVRKGETATMDCNLGIVTNDATRWYKQIPGGVPQFVLRFRYDSSSPSYGSGFSSPKFTSTHQSRSDYRLIIKNVEEGDSAVYYCKTWDSSVSEYA
Oreochromis niloticus V153 iglv MKQE01000018.1 14886950 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVTNFAAWHKQIPGGVPQHVVRFYHSWSSPNYGSGFSAPKFTSTHQSTTDYRLIINNVEEGDSAVYYCQTWDNSANSGV
Oreochromis niloticus V152 iglv MKQE01000018.1 14886950 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVTNFAAWHKQIPGGVPQHVVRFYHSWSSPNYGSGFSAPKFTSTHQSTTDYRLIINNVEEGDSAVYYCQTWDNSANSGV
Oreochromis niloticus V151 igkv MKQE01000018.1 14880996 IVLTQTPAVHIVSPGQEVVLNCNIERYDGNYVSWYKQVPGTVPQYVLRFHHSDSSPSFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSTVYYCQTWDDSARAAV
Oreochromis niloticus V150 igkv MKQE01000018.1 14880996 IVLTQTPAVHIVSPGQEVVLNCNIERYDGNYVSWYKQVPGTVPQYVLRFHHSDSSPSFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSTVYYCQTWDDSARAAV
Oreochromis niloticus V149 iglv MKQE01000018.1 14879345 VSGVTVVTQKPVVSVRKGETATMDCNLGTVTGSSARWYKQIPGGVPQYVLKFHHSDSSPRYGSGFSSPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCKTWDSSVDEFA
Oreochromis niloticus V148 iglv MKQE01000018.1 14873468 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVDSYAAWYKQIPGGVPQYVLDFYHSSSSPDYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCKTWDDSVDEYV
Oreochromis niloticus V147 iglv MKQE01000018.1 14873468 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVDSYAAWYKQIPGGVPQYVLDFYHSSSSPDYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCKTWDDSVDEYV
Oreochromis niloticus V146 trav MKQE01000018.1 623815 DKVIQEQGDVIAAEGDTVTLDCRYETTDAYPYLFWYKQEINEFPKYVLRRDTTGTEDNDQEFPKDRFDAKINKIQQSVPLKIQKLHLSDSAVYYCALQPTVTG
Oreochromis niloticus V145 trav MKQE01000018.1 623815 DKVIQEQGDVIAAEGDTVTLDCRYETTDAYPYLFWYKQEINEFPKYVLRRDTTGTEDNDQEFPKDRFDAKINKIQQSVPLKIQKLHLSDSAVYYCALQPTVTG
Oreochromis niloticus V144 trav MKQE01000018.1 583736 DKVIQEQGDVIAAEGDTVTLGCTFETSDPFPYLFWYKQEINDFPKYVLLRGTSGTAENAQEFPKDRFDAELNKREKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V143 trav MKQE01000018.1 520527 DKVIQEQGDVIAAEGDTVTLGCRYETSYAATLIWYKQEVNSYPKYVLKCVSETTVKAEEFKNDRFDAKINEKQQSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V142 trav MKQE01000018.1 467217 NVLQAKGEETAAEGGTVTLHCQYESSSSQPSLFWYKQDGNNSPKFILSRVSGDDGNTAAEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V141 trav MKQE01000018.1 467199 CRAQKDNVLQAKGEETAAEGGTVTLHCQYESSSSQPSLFWYKQDGNNSPKFILSRVSGDDGNTAAEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V140 trav MKQE01000018.1 401594 DKVIQEQGDVIAAEGDTVTLGCRFEATTTAYPYLFWYKQEINNFPKYVLQRGTSGTADNAQEFPKDRFDAEVDKTQNSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V139 trdv MKQE01000018.1 346903 LTAGDSITPQQTEVTETEGKSVTLTCSYQTNDNDIYLHWYTYNSDLQSPQFVLWNGAKSNYGAHYIPNKRYKTQTSDTTTSLTITALTLADTALYYCALQ
Oreochromis niloticus V138 trav MKQE01000018.1 346202 EDKVIQEQGDVTAAEGDTVTLGCQYESSGTNNNLFWYKQDGNNSPTFILSRVSRDDGNTEDEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V137 trav MKQE01000018.1 330892 CKGEDKVIQEQGDVIAAEGDTVTLGCQYESSGTNNNLFWYKQDGNNSPKFILSRVSGDDGNTAAEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V136 trav MKQE01000018.1 327442 RVIQEQGDVTAAEGDTVTLGCRFETSDAGPTLFWYKQKKNGSPKLLVQRFFSSAENSEAKDRFDAEVDKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V135 trdv MKQE01000018.1 277437 LTAGDSITPQQTEVTETEGESVKLTCSYQTSDIYIYLYWYRHDSDLQAPQFILWKGARSWSGNEYIPDKRHKTQRSDRSTDLTITALTLADTALYYCALQ
Oreochromis niloticus V134 trav MKQE01000018.1 276402 KVIQEQGDVTAAEGDTVTLGCRFETISTNPTLIWYKQEVNSYPKYMLKCVSTSAVKAEEFNNDRFDAKINKKENSVPLKIQKLQLSDSAVYHCALQ
Oreochromis niloticus V133 trav MKQE01000018.1 250996 DKVIQEQGDVIAAEGDTVTLGCQYESSVTNNYLFWYKQDGNNSPKFILSRFSRDDGDTADEFKERFSSTLDSSIKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V132 trav MKQE01000018.1 246372 EDKVIQEQGDVTAAEGDTVTLGCRYETSDPGPTLFWYKQDGNNSPKLILSRVSRDDGNTAAEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V131 trav MKQE01000018.1 246372 EDKVIQEQGDVTAAEGDTVTLGCRYETSDPGPTLFWYKQDGNNSPKLILSRVSRDDGNTAAEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V130 trav MKQE01000018.1 198996 EDKVIQEQGDVTAAEGDTVTLGCRYETSDTSPTLFWYKQKKNGSPKLLVRRFFLSADNSEAKDRFDAEVDKKKKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V129 trdv MKQE01000018.1 160468 LTAGDSITPQRTEVTETEGESVTLTCSYETSYSVAELHWYRHHSDLQAPQFILWKQGKGGTAEYIPDKRYKTQTSPITTDLTITALTLADTALYYCALE
Oreochromis niloticus V128 trav MKQE01000018.1 121763 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSDTYFFWYKQKPNSHPDFLMAYYSDKTERMKFIHDDQKKEFYLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V127 trav MKQE01000018.1 121763 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSDTYFFWYKQKPNSHPDFLMAYYSDKTERMKFIHDDQKKEFYLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V126 trdv MKQE01000018.1 112389 LTAGDSITPQQTEVTETEGESVTLTCSYETTYGYPQLHWYRHHSDLHAPQFILWKGGKQNTAEYIPDKRYGSQTSPTSTSLTITALTLADTALYYCALE
Oreochromis niloticus V125 trav MKQE01000018.1 84254 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETSDPGPTLFWYKQKMNGSPKLLLRRFFLSADNSEAKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V124 trav MKQE01000018.1 40057 QKDNVLQAKGEETAAAGGTVTLDCLYNSSFPSGNYLFWYKQDGNNSPKFILSRLSGDDGNTAAEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V190 iglv MKQE01000018.1 15151904 VSGVTVVTQKPPVVSVRKGETATMDCNLGIVTNEPAWWYKQIPGGVPQYVVRFRHDWSTQYYGSGFSSPKFTCTHQSTTDYRLMIKNVEEEDSAVYYCKTW
Oreochromis niloticus V189 iglv MKQE01000018.1 15149611 VSGVTVLTQKPPVSSVRKGETATMDCNLGTVINTVYWYKQIPGGVPQFVLYFYHSYSSPTYGSGFSSPKFTSTHQSTKDYRLIIKNVEEGDSAVYYCQTWDSSVSEYA
Oreochromis niloticus V188 iglv MKQE01000018.1 15145480 VSGVTVVTQKPPVLSVRKGETATMDCNLGTVDNYVYWYKQIPGGVPQFVLYFYHSWSSPSYGSGFSSSKFTSTHQSTSDYRLIIKNVEEGDSAIYYC
Oreochromis niloticus V187 iglv MKQE01000018.1 15123775 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVTGSAARWYKQIPGGVPQFVLYFYHSSSSPGYGSGFSSPKFTSTHQSTSDYRLIINNVEEGDSAVYYCQTWDSNAVV
Oreochromis niloticus V186 iglv MKQE01000018.1 15120688 VSGVTVLTQKPPVLSVRKGETATMDCNLGTGTNYVYWYKQIPGGVPQFVLYFYHSSSSPGYGSGFSSPKFTSTHQSTSDYRLIINNVEEGDSAVYYCHTWDSNAVV
Oreochromis niloticus V185 iglv MKQE01000018.1 15120688 VSGVTVLTQKPPVLSVRKGETATMDCNLGTGTNYVYWYKQIPGGVPQFVLYFYHSSSSPGYGSGFSSPKFTSTHQSTSDYRLIINNVEEGDSAVYYCHTWDSNAVV
Oreochromis niloticus V184 iglv MKQE01000018.1 15105221 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTNSGVRWYKQISGFPQFVLYFIHSSSVPTYGSGFSSPKFTSTHQSRSDYRLIINNVEEGDSAVYYCQTWDSSVN
Oreochromis niloticus V183 iglv MKQE01000018.1 15105221 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTNSGVRWYKQISGFPQFVLYFIHSSSVPTYGSGFSSPKFTSTHQSRSDYRLIINNVEEGDSAVYYCQTWDSSVN
Oreochromis niloticus V182 igkv MKQE01000018.1 15090714 VDAVIVLTQTPAVHTVSPGQQAVLNCNIERYDRNSVRWYKQVPGEAPQYVLRFHHSDSSLSFGTGFSSDRFNSKSSSNIDYQFIIKQAETGDSAVYYCQTYDDSAS
Oreochromis niloticus V181 igkv MKQE01000018.1 15090714 VDAVIVLTQTPAVHTVSPGQQAVLNCNIERYDRNSVRWYKQVPGEAPQYVLRFHHSDSSLSFGTGFSSDRFNSKSSSNIDYQFIIKQAETGDSAVYYCQTYDDSAS
Oreochromis niloticus V180 iglv MKQE01000018.1 15080618 VSGVTVVTQKPPVVSVRKGETATMDCNLGTVDTFVFWYKQIPGGVPQYVMCFHYGSTRPCYGSGFSSPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQIL
Oreochromis niloticus V179 iglv MKQE01000018.1 15075106 VSGVTVVTQKPVLSVRKGETATMDCNLGTVTDAAYWYKQIPGGVPQFVLKMYHSYSSPSYGSGFSSPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQTWDSNAAV
Oreochromis niloticus V178 igkv MKQE01000018.1 15055972 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTNYAAAWHKQIPGGSPQFVLYFYHSDSSPGYGSGFSSPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQTWDGSANSGV
Oreochromis niloticus V177 igkv MKQE01000018.1 15055972 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTNYAAAWHKQIPGGSPQFVLYFYHSDSSPGYGSGFSSPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQTWDGSANSGV
Oreochromis niloticus V176 igkv MKQE01000018.1 15048752 IVLTQTPAVHTVSPGQQAVLNCNIERDDGNYVRWYKQVPGEAPQYVLRFLHSSSSLEFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTWDDSANAAV
Oreochromis niloticus V175 iglv MKQE01000018.1 15029356 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTGSGARWHKQIPGGVPQFVLWFYRGNSSPTYGSGFSSPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCETWDSSVKEEV
Oreochromis niloticus V174 iglv MKQE01000018.1 15029356 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTGSGARWHKQIPGGVPQFVLWFYRGNSSPTYGSGFSSPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCETWDSSVKEEV
Oreochromis niloticus V173 igkv MKQE01000018.1 15020616 VDAVIVLTQTPAVHTVSPGQQAVLNCNIERYDGNSVRWYKQVPGVVPQYVLRFRHSDSSLSFGTGFSSDRFNSKSSSNIDYQFIIKQAETGDSAVYYCQTYDNSAS
Oreochromis niloticus V172 igkv MKQE01000018.1 15014890 VDAVIVLTQTPAVHTVSSGQQAVLNCNIERYDGNYINWYKQVPGEAPQYVLRFHYSDTSLSFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTYDDSAS
Oreochromis niloticus V171 trav MKQE01000018.1 15007338 VSGVTVLTQKPVLSVRKGETATMDCNLGTSTNIVAWYKRIPGGSPQYVLRMHHHWSSPDYGSGFSAPKFTSTHQSTTDYRLIIKNVKEGDSAVYY
Oreochromis niloticus V170 trav MKQE01000018.1 14996882 VSGVTVLAQKPPVLSVRKGETATMDCNLGTVTNTVYWYKQIPGGVPQFVLYFYHSSSSPTYGSGFSAPKFTSTHQSTSDYRLIIKNVEEGDSAVYYCKTWDSNDAV
Oreochromis niloticus V169 iglv MKQE01000018.1 14995250 VSGVTVLTQKPPVLSVRKGETATMDCNLGTGTNAAAWHKQIPGGSPQHVVRFYHGWSSPSYGSGFSSPKFTSTHQSTKDYRLIIKNVEEGDSAVYYCQTWDSSVSENV
Oreochromis niloticus V168 iglv MKQE01000018.1 14995250 VSGVTVLTQKPPVLSVRKGETATMDCNLGTGTNAAAWHKQIPGGSPQHVVRFYHGWSSPSYGSGFSSPKFTSTHQSTKDYRLIIKNVEEGDSAVYYCQTWDSSVSENV
Oreochromis niloticus V167 iglv MKQE01000018.1 14983384 VTVVTQKPPVVPVSKGETATMDCNLGTVTNYAAWWYKQIPGGVPQHVVRFHLSWGSPSYGPGFSSPKFTCTHQSTTDYRLIIRNVEEGDSAVYYCKTW
Oreochromis niloticus V166 iglv MKQE01000018.1 14974809 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVDNTVRWYKQIPGGVPQYVLRFYHSWGSPTYGSGFSSSKFTSNHQSTTDYCLIINNVEERDSAVYYCQTWDSSVSEYA
Oreochromis niloticus V165 iglv MKQE01000018.1 14974809 VSGVTVLTQKPPVLSVRKGETATMDCNLGTVDNTVRWYKQIPGGVPQYVLRFYHSWGSPTYGSGFSSSKFTSNHQSTTDYCLIINNVEERDSAVYYCQTWDSSVSEYA
Oreochromis niloticus V164 iglv MKQE01000018.1 14970573 VSGVTVVTQKPVLSVSKGETATMDCNLGTVTDVAVFWYKQIPGGVPQYVLRFYHSWGSPKYGSGFSSPKFTSTHQSTTDYRLIVKNVEEGDSAVYYCKTWDNSVDEYA
Oreochromis niloticus V163 trav MKQE01000018.1 14963759 VDVVIVLTQTPAVHTVSPGQEVVLNCNIERYDRNSVRWYKQVPGEAPQYVLRFLHSSSSLSFGTGFSSDRFNSKSSSNIDYQFIIKQAETGDSAVYYCHTYDDSAS
Oreochromis niloticus V162 igkv MKQE01000018.1 14958988 VDAVIVLTQTPAVHTVSSGQQAVLNCNIERYDGNYINWYKQVPGEAPQYVLRFHYSDTSLSFGTGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYYCQTYDDSAS
Oreochromis niloticus V198 ighv MKQE01000018.1 18914556 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFISYYMNWVRQAPGKGLEWIATLDNGSGSSKSYSQSVQGRFTISRDNSKQQLYLKMNSLKTEDSAVYYCA
Oreochromis niloticus V197 ighv MKQE01000018.1 18914556 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFISYYMNWVRQAPGKGLEWIATLDNGSGSSKSYSQSVQGRFTISRDNSKQQLYLKMNSLKTEDSAVYYCA
Oreochromis niloticus V196 ighv MKQE01000018.1 18907832 VDGQTLTESEPAIKRPGESHTLTCTASGFTFRDYYMAWVRQAPGKGLEWVAADTGGSTKYYSQSVRGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARD
Oreochromis niloticus V195 ighv MKQE01000018.1 18845058 VNCEQLTQPPSVILQPGQRLTITCQVSYSLGYLTAWIRQPAGKGLEWIGMKNTGGSYYKDSLKSKFNIDLDTSSNTVTLNGQNMQPEDSAVYYCARE
Oreochromis niloticus V194 ighv MKQE01000018.1 18845058 VNCEQLTQPPSVILQPGQRLTITCQVSYSLGYLTAWIRQPAGKGLEWIGMKNTGGSYYKDSLKSKFNIDLDTSSNTVTLNGQNMQPEDSAVYYCARE
Oreochromis niloticus V193 ighv MKQE01000018.1 18810028 VKCQQLTQPEFVTVQPGQRLTITCQVSYSLSYYRTAWIRQPAEKGLEFIGSAHYGYSTGYKDSLKNKFTINLDTSSKTMTLNGQNMQPEDTAVYYCARV
Oreochromis niloticus V235 ighv MKQE01000018.1 19994080 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFSSYEMVWVRQAPGKGPEWIAFISTSTSSYATYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus V234 ighv MKQE01000018.1 19991557 VDGQTLTQSEPDLIKRPGESHILTCTASGFTFRDYWMVWVRQAPGKGPEWIALIRISTQSYATSYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus V233 ighv MKQE01000018.1 19985630 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYRMAWVRQAPGKGPEWIAYISTSDYSYATSYSQSVQGRFTISRDDSSSKLHQQINSLKTEDTAVYYCAR
Oreochromis niloticus V232 ighv MKQE01000018.1 19977797 WSEIKLEQSASEVKRPGERVKLSCIISGYTPTDYYLHWIQQRPGRALEWIGRMNTGSNSARYASSFQSRFIMTEEDSSSKQYLEIKSLTAEDSAVYFCARQ
Oreochromis niloticus V231 ighv MKQE01000018.1 19971092 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSGYWSHWIRQPAGKGLEWIGMAATGSTTRYKDSLKSKFSISTDSSSNTVTLTGQNLQPDDTAVYYCAM
Oreochromis niloticus V230 ighv MKQE01000018.1 19952219 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSDYWMQWVRQAPGKALEWVAYISGNSAYIHYSQSVQGRFTISRDNTRQQVYLQMNSLKTEDSAVYYCAREPK
Oreochromis niloticus V229 ighv MKQE01000018.1 19943972 HAQTVTQSEPVVKKPGESHRLTCTASGLSFSSNWMAWIRQANGKGLEWIATEANGGTNYYSQSVQGRFTVSRDNSREQLFLQMNSLKTEDSAVYYCARE
Oreochromis niloticus V228 ighv MKQE01000018.1 19940904 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSYRMVWVREAPGKGLEWIAFIHTGSSHIYYSQSVQGRFTISRHDSSSKLFLQMNSLKTEDTAVYYCARC
Oreochromis niloticus V227 ighv MKQE01000018.1 19938059 VKCEQLTQSGPVTLQPDQRLTINCQVTYSISTYWTVWIRQPAGKGLEWVGGSGVGHSTLYKDSLKNKFSISLDSSSKTVTLNGQNLQPEDTAVYYCARK
Oreochromis niloticus V226 ighv MKQE01000018.1 19936159 VKCEQLTQPKSETVQPGQRLTITCQVTYSLSTSWTGWIRQPAGKGLEWIGSRYTGEAAYKDSLKNKFSIDLDTSSKTVTLIGQNMQPDDTGMYYCAKDAQ
Oreochromis niloticus V225 ighv MKQE01000018.1 19916521 VKCEQLSQPDTVTVQPSQSLTITCQVSYSVGNYHTAWIRQPEGKGLEFIQSARVGYSTYYNDLLKNKFSISLDSSSNTVTLNGQNEQPEDTAVYYCA
Oreochromis niloticus V224 ighv MKQE01000018.1 19905205 VKRPGETLSLSCRGSGFTFSCCSMHWIRQPAEKGLEWMGRVYSDASRTDYSSSLQGRIEVTRDNSNSMTYLRLSDLKPEDSAVYYCAKHTVFK
Oreochromis niloticus V223 ighv MKQE01000018.1 19900054 VKCEQVTQPASVIVQPGQPLTITCQVSYSLGSYRTAWIRQPAGKGLEWIGMKYTGDSFYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus V222 ighv MKQE01000018.1 19882843 VKCEQLTQPDSLSVLSGHPLTITCKLSYSVRSYWTHWNRQAPGKGLEWIGRAASGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQPEDSAVYYCARD
Oreochromis niloticus V221 ighv MKQE01000018.1 19868308 VKCEQLTQPEFVTVQPGQRLTITCQVSYSLSSYRTSWIRQPAGKGLEWIGSVRDGYSTYYKDSLKNKFTINLDTSSKTVTLNGQNMQAEDTAVYYCARE
Oreochromis niloticus V220 ighv MKQE01000018.1 19836545 VKCEQLTQPEFVTVQPGQRLTITCQVSYSLSSWRTSWIRQPAGKGLEWIGGAHYGYPTFYKDSLKNKFTINLDTSSKTVTLNGQNMQPEDTAVYYCARG
Oreochromis niloticus V219 ighv MKQE01000018.1 19129047 IDGQTLTQSEPVVKKPGESHRLTCTTSGLPFSSWWMAWIRQAPGKGLEWIVSNTNRGTNYYSQSVRGRFTASRDNSREQLFLQINNLKTEDSAVYYCARD
Oreochromis niloticus V218 ighv MKQE01000018.1 19090788 QTLTESESVVKRPGDSHRLTCTYSGFGGDYSNAWIRQAAGKGLEWIAWISSGSSTYYSQSFRGRFTISRDNSRKQVYLQMNSLMTEDSAVYYCARE
Oreochromis niloticus V217 trav MKQE01000018.1 19061193 VKCEQLTQPASVTVHPGDRLTITCQASYSLSSARTFWIRQPAGKELECIGSVHIGHSTWYKDSLQNKFSIDIDCSNRTVTLIGQNVQPEDSAVYYCARE
Oreochromis niloticus V216 ighv MKQE01000018.1 19040352 VQCEQLTQKASETVQPGQRLTITCQVSYSVTSRWTAWIRQPAGKGLEWIGSRVGATLAYKDSLKNTFSISLDSSSNTVTLTGQNMQPEDTAVYYCARD
Oreochromis niloticus V215 ighv MKQE01000018.1 19035089 VKCEQLTQPTSVTVQPGHRLTITCQVSYALSSYWTGWIRQAAGKGLEWIGSRYTGGSAYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus V214 ighv MKQE01000018.1 19029514 VQCEQLTQPAYVTKQPGQRLSITCQVSYSVGSYFTAWIKQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSNTVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus V213 ighv MKQE01000018.1 19025883 VDGQTLTQSEPVVKRPGESHTLTCTASGFSFSGYWMGWVRQAPGKGLEWVATLDSGSGSSKYYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARE
Oreochromis niloticus V212 ighv MKQE01000018.1 19004045 TEGQTLTQSESVVKQPGQSHRLTCTYSGFSGDDHYAWIRQAAGKGLEWIAWIQYNGGSTYYSQSFRGRFTISRDNSRKQVYLEMSSLTTEDSAVYYCARE
Oreochromis niloticus V210 ighv MKQE01000018.1 18982989 VDGQTLTESEPVIKRPGESHTLTCTASGFTFSSYDMHWVRQTPGKGLEWVAEVSTGSSKYYSQSVQGRFTISRDNSKQQVYLEMNSLKTEDSAVYYCARE
Oreochromis niloticus V209 ighv MKQE01000018.1 18982037 VKCEQLTQPDSLSVLLGHPLTITCKVSYSVRSYWTHWNRQAPGKGLEWIGRAASGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQPEDSAVYYCARD
Oreochromis niloticus V208 ighv MKQE01000018.1 18982037 VKCEQLTQPDSLSVLLGHPLTITCKVSYSVRSYWTHWNRQAPGKGLEWIGRAASGSTPHYSPLLRNKFSISTDSSRNTVILTGQNVQPEDSAVYYCARD
Oreochromis niloticus V207 ighv MKQE01000018.1 18969733 VKCEQLTQPASVTVQPGHRLTITCQVSYALSSYWTGWIRQPAGKGLEWIGSRYTGGSAYKDSLKNKFSIDLDTSSKRVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus V206 ighv MKQE01000018.1 18955645 VQCEQLTQPAYVTKQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGSKYTGASYYKDSLKSKFSIDLDSSSKTVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus V205 ighv MKQE01000018.1 18951027 VDGQTLTQSEPAIKRPGESHTLTCTASGFSFSGYWMAWVRQAAGKTLEWVATLDSGSGSSKYYSQSVQGRFTISRDNSKQQLYLQMNSLRTEDSAVYYCARE
Oreochromis niloticus V204 ighv MKQE01000018.1 18947344 VDGQTLTESEPAIKSPGESHTLTCTASGFTFRDYYMAWVRQAPGKRLEWVAYISSGSGSTKFYSQSVQGRFTISRDNSRQQLYLQMNSLRTEDSAVYYCARD
Oreochromis niloticus V203 ighv MKQE01000018.1 18930351 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGYWTAWIRHPAGKGLEWIGVKSTGSSYYKDSLKTKFSIDLDTSSNTVTLNGQNMQPEDSAVYYCARV
Oreochromis niloticus V202 ighv MKQE01000018.1 18930351 VNCEQLTQSPSVILQPGQRLTITCQVSYSLGYWTAWIRHPAGKGLEWIGVKSTGSSYYKDSLKTKFSIDLDTSSNTVTLNGQNMQPEDSAVYYCARV
Oreochromis niloticus V201 ighv MKQE01000018.1 18927799 QTLTESESVIKRPGDSHRLTCRYSGFSSGIHVAWIRQAAGKGLEWIAWIYWDGSDIYYSQSFRGRFTISRDNNRKQVYLQMNSLTTEDSAVYYCANE
Oreochromis niloticus V200 trav MKQE01000018.1 18923534 KRPGETLSLSCRGSGFTFNCCTMSWIRQKPGRALEWMGIGFSSSSRNRYVSSLSGRIEISRDDSNSMVHLRLSSLKPEDSAVYYCAKHTQ
Oreochromis niloticus V199 ighv MKQE01000018.1 18917997 VQCEQLTQPAYVTKQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGSKFTGASYYKDSLKSKFSIDLDSSSNRVTLNGQNMQPEDTAVYYCARD
Oreochromis niloticus V273 ighv MKQE01000018.1 20348306 VDGQTLTESESVVKRPGESHRLTCTASGFTFRDHWMVWVRQAPGKGPEWIAFIDTSTYSYATSYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARG
Oreochromis niloticus V272 ighv MKQE01000018.1 20334764 VWSEVKLEQSPSEVKRPGERVKMSCIISGYTLTQHYLHWIRQRPGRALEWIGRMDTGKNSAIYGSTFQSRFVMTEEDSSSKQYLEINSLTAEDSAVYFCARR
Oreochromis niloticus V271 ighv MKQE01000018.1 20308408 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYDMVWIRQAPGKGLEWIAYINYNSAYIYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARQ
Oreochromis niloticus V270 ighv MKQE01000018.1 20306345 VDGQTLTQSEPVVKRPGDSHTLTCTGSGFSFSGYWMHWVRQAPGKGLEWVAGISEASGYIHYSQSVQGWFTISRDNSKQQVYLQMNRLKTEDSAAYYCARR
Oreochromis niloticus V269 ighv MKQE01000018.1 20302527 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSNAMVWIRQAPGKGLEWIAYINSNSAYIYYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCAR
Oreochromis niloticus V268 ighv MKQE01000018.1 20299112 VDGQTLTQSEPAVKRPGESHRLTCTASGYNFGSYSLVWVRQAPGKGLEWIAYIYWGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Oreochromis niloticus V267 ighv MKQE01000018.1 20294947 VYSIDHIQPSSLLVQPGQSLTITCQVSGYSLTDSGYGTGWIRQREGKLLDWIFYIWYDGNTYQNDALKNKFSMSRDTSTQTVTITGQHLQPEDTAVYYCARYLTVIQ
Oreochromis niloticus V266 ighv MKQE01000018.1 20294947 VYSIDHIQPSSLLVQPGQSLTITCQVSGYSLTDSGYGTGWIRQREGKLLDWIFYIWYDGNTYQNDALKNKFSMSRDTSTQTVTITGQHLQPEDTAVYYCARYLTVIQ
Oreochromis niloticus V265 ighv MKQE01000018.1 20289364 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALEWVASHYNSANIRYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCS
Oreochromis niloticus V264 ighv MKQE01000018.1 20280408 VYSVDLIQPDSMIVQPGQSLTITCRVSGYSLTDSNYATNWIRQRDGKQMDWIFTMWHDGSTSKNDALKNKFSMSRDTSARTVTITGQNLQPEDTAVYYCARM
Oreochromis niloticus V263 ighv MKQE01000018.1 20280408 VYSVDLIQPDSMIVQPGQSLTITCRVSGYSLTDSNYATNWIRQRDGKQMDWIFTMWHDGSTSKNDALKNKFSMSRDTSARTVTITGQNLQPEDTAVYYCARM
Oreochromis niloticus V262 ighv MKQE01000018.1 20268236 VYGVDLIQPDSMIVQPGQSLTVTCRVSGYSLTDSSYATSWIRQREGKQMDWIFTMWSGGSSTNNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V261 ighv MKQE01000018.1 20265881 VYSIDLIQPDSRVTQPGQSLTITCQVSGYSITSHGTVWIRQREGKQLEWILIIWRGGSIDKNDALINKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V260 ighv MKQE01000018.1 20265881 VYSIDLIQPDSRVTQPGQSLTITCQVSGYSITSHGTVWIRQREGKQLEWILIIWRGGSIDKNDALINKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V259 ighv MKQE01000018.1 20260144 VYCIDLNQPESRVVQPGQSMTITCRVSGYSLTDGNYGTCWIRQREGKQMDWINCIWSGGSSDNNDALKNKFSISRDTSAQTLTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V258 ighv MKQE01000018.1 20255942 VYSIDLIQPDSRVLQPGQPLTIVCQVSGYSLTDGSSATCWVRQRKGQHIDWINCMYYDGSTPNNDALKNKFSVNRDTSAQTVTITGQNLQPEDTAVYYCAR
Oreochromis niloticus V257 ighv MKQE01000018.1 20218521 VDGQTLTQSEPAVKRPGESHRLTCTASGYTFGRYSLVWVRQAPGKGLEWIAYIYYGDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCAQN
Oreochromis niloticus V256 ighv MKQE01000018.1 20212800 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSSYWMVWVRQAPGKALEWVASHYDSANIRYSQSVQGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCA
Oreochromis niloticus V255 ighv MKQE01000018.1 20206891 VKCEQLTQPASMLVQPGQRLTITCQVSYSLSTYYTAWIRQPAGKVLEWMSDDGTVKDSLKNKFSVELDSSSKTVTLKGQNLQPEDTAVYYCARRR
Oreochromis niloticus V254 ighv MKQE01000018.1 20198627 VWSEIKLEQSPSEVKRPGERVKMSCIISGYSLTSYNIHWIRQRPGGALEWIGWMNTGSNSATYSSSFQSRFIITEEDSSSRQYLEIKSLTAEDSAVYFCARQ
Oreochromis niloticus V253 ighv MKQE01000018.1 20188663 VWSEVKLEQSPSEVKGFGERVKMSCTLSGYTLTDHDIHWIRQRPGRALEWIGYMSTGYNSPGYGSSFQHRFIMTEEDSSRRQYLDINSLTAEDSAVYFCARQ
Oreochromis niloticus V252 ighv MKQE01000018.1 20182790 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFSSYEMVWVRQAPGKGPEWIAFISTSTHSYATHYSQSFQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus V251 ighv MKQE01000018.1 20157295 VDGQILTESEPVVKRPGESHRLTCTASGFTFSSYPMAWVRQAPGKGLEWVAYISTSSSPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARR
Oreochromis niloticus V250 ighv MKQE01000018.1 20152422 VWSEIKLEQSASEVKRPGERVKMSCIISGYSPTSYNIGWIRQRPGRALEWIGWMSTGSNSARYASSFQSRFIMTEEDSSRSQYLEIKSLTAEDSAVYFCARI
Oreochromis niloticus V249 ighv MKQE01000018.1 20147972 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYWMAWIRQAPGKGLEWIATDAGGSSKYYSQSVQGRFTVSRDNSREQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus V248 ighv MKQE01000018.1 20121528 VNGQTLTESEPAVKQPGQSHRLTCTTSGLSFSSYGMTWIRQAPGKGLEWIATISNGGSSTWYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus V246 ighv MKQE01000018.1 20065513 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSSYWMHWVREAPGKGLEWVATIQVTSTYYSQSVQGRFTISRDNTRQQVYLQMNSLKTEDSAVYYCAREPK
Oreochromis niloticus V245 ighv MKQE01000018.1 20064040 KSHKTRIPVVKRPGESHRLTCTGSGFTFSSHLMGWVRQAPGKGLEWVATIDVTSKYYAQSVQGRFTISRDNNRQQVYLDMNTLKTQDSAVYYCA
Oreochromis niloticus V244 ighv MKQE01000018.1 20061006 VDGQTLTQSEPDLIKRPGESHRLTCTASGFTFRDYWMVWVRQAPGKGLEWIAFIETSTYSYATFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARG
Oreochromis niloticus V243 ighv MKQE01000018.1 20057267 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYGMAWVRQAPGKGPEWIADISTSTYSYATSYSQSFRGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus V242 ighv MKQE01000018.1 20057267 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYGMAWVRQAPGKGPEWIADISTSTYSYATSYSQSFRGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus V241 ighv MKQE01000018.1 20054463 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYRMAWVREAPGKGPEWIAYIGTSDYSYATSYSQSVQGRFTISRDDSSSKLHQQINSLKTEDTAVYYCARR
Oreochromis niloticus V240 ighv MKQE01000018.1 20046991 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYRMVWVRQAPGKGLEWIAYISTSSSPIHYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARC
Oreochromis niloticus V239 ighv MKQE01000018.1 20031581 VNGQTLTESEPAVKQPGESHRLTCTTSGISFSSYSMAWIRQAPGKGLEWIALISSSGASIYYSQSVRGRFTISRDNGREQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus V238 ighv MKQE01000018.1 20009744 VKCEQLTQPASMLVQPGQRLTITCQVSYSVSDYYTAWIRQPAGKALEWMSQDTAVKDSLKNKFSVELDSSSDTVTLKGQNLQPEDTAVYYCARD
Oreochromis niloticus V237 ighv MKQE01000018.1 20003784 VDGQTLTESEPAVKRPGESHRLTCTASGFTFSSYYMAWVRQAPGKALEWIARITNSGSSTWYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARE
Oreochromis niloticus V311 ighv MKQE01000018.1 20632245 AAGQTLTESEPVVERPGESHRLICTASGFTFSSFWMGWIRQAPGKGLEWVAHIWANGNRAFYSQSVQGRFTISRDNNRQQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus V310 ighv MKQE01000018.1 20612921 VYSIDLIQPESMVVQPGQSLTITCQVSGYSLTSYATCWIRQRDGKQMDWINCMWTGGSTANNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V309 ighv MKQE01000018.1 20612921 VYSIDLIQPESMVVQPGQSLTITCQVSGYSLTSYATCWIRQRDGKQMDWINCMWTGGSTANNDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V308 trav MKQE01000018.1 20611208 VDGQILTESESMVQRPGESHRLTCTASGFTFCSYAMAWIKQAPGKGLGQLAWVDNGSGARKYYSQSVQAQFTISRDNKRQQVYLQMNSLRSDDSAVYYCAQY
Oreochromis niloticus V307 trav MKQE01000018.1 20606728 VYSIDLIQPDSRVLQPGQSLTIVCQVSGYSLTDNSYGTCWVRQRQRQQMDCINCMWASGNTANNDALKNKFSVSRDTSARTVTITGQNLQPEDTAVYHCARMHTVIQ
Oreochromis niloticus V306 ighv MKQE01000018.1 20604219 VYSIDLIQPDSRIVQPGQSLTITCQVSGYSVTSYGTAWIRQREGKPLEWINTIWSGGSTDNNNALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARD
Oreochromis niloticus V305 ighv MKQE01000018.1 20596377 VDCQTLTQSEPAVKRPGESHRLTCTGSGFTFSSYWIHWIRQAPGKGLEWIALIYTDSSKAFYSPSVQGRFIISRDNSKQQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus V304 ighv MKQE01000018.1 20591752 VYSIDFIQPDSLVVQPGRSLTITCQVTGYSLTDNDYATGWVRQREEKPMDWIFHQWGDNVYKNDALKNKFSFSRDTSAGTVTITGQNVQPEDTAVYYCVSLR
Oreochromis niloticus V303 ighv MKQE01000018.1 20591752 VYSIDFIQPDSLVVQPGRSLTITCQVTGYSLTDNDYATGWVRQREEKPMDWIFHQWGDNVYKNDALKNKFSFSRDTSAGTVTITGQNVQPEDTAVYYCVSLR
Oreochromis niloticus V302 ighv MKQE01000018.1 20557324 VDGQTLTESESVIKRPGESHRLTCTGSGFTFSSYLMAWVRQAPGKGLEWLASHYDSSNIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus V301 ighv MKQE01000018.1 20557324 VDGQTLTESESVIKRPGESHRLTCTGSGFTFSSYLMAWVRQAPGKGLEWLASHYDSSNIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARD
Oreochromis niloticus V300 ighv MKQE01000018.1 20553978 VYSIDLIQPDSRIVQPGQSLTITCHISGYSLTDGSYATCWVRQREGNPLEWINLIWASGSTANNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARRY
Oreochromis niloticus V299 ighv MKQE01000018.1 20541694 VNCQTLTESEPVDKRPGESHKLTCTTSGFTFSSYSMDWIRQAPGKGLEWIAYISSGGGSNTYYSQSVQGRFTISRDNSKQQLYLQMNNLKTEDSAVYYCARE
Oreochromis niloticus V298 ighv MKQE01000018.1 20498603 VYSIDLIQPDSRIVQPGQSLTITCQGSGLSVTNYGRGWVRQREGNPLEWINLIWTGGGINKNDALKNKFSISRDYSGQTVTLTGQNLQPEDTAVYYCA
Oreochromis niloticus V297 ighv MKQE01000018.1 20468634 VDGQTLTESEPAVKSPGESHRLTCTASGFTFSSYQMGWIRQAAGKGLEWIAFIYTDSSGIFYSQSVRGRFTISRDNSRQQLYLQMNSLKIEDSAVYYCARD
Oreochromis niloticus V296 ighv MKQE01000018.1 20463206 VDGQTLTQSEPTVKRPGESHRLTCTASGYTFGSYSLVWVRQAPGKGLEWIAYIFWSDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Oreochromis niloticus V295 ighv MKQE01000018.1 20459975 VYSIDHIQPSSLVVQPGQSLTITCQVSGYSLTDSGYGTGWIRQREGKLLDWIFYIWYDGNTYQNDALKNKFSMSRDTSAQTVTITGQHLQPEDTAVYYCARYLTVIQ
Oreochromis niloticus V294 ighv MKQE01000018.1 20456194 VYSIDHIQPSSLVVQPGQSLTITCQVSGYSLSDSGHGTGWIRQGEEKPLEWIFYIWYNGGTYQNDALKNKFSISRDTSAQTVTITGQHLQPEDTAVYYCVC
Oreochromis niloticus V293 ighv MKQE01000018.1 20454665 VDGQTLSESEPVVKRPGESHTLTCTASGFTFSDYWMIWVRQAPGKALEWVASHYNSANIHYSQSVQGRFTISRDNSKQQVYLQMNSLKPEDSAVYYCTRE
Oreochromis niloticus V292 ighv MKQE01000018.1 20452693 VYSIDLIQPNSLVVQPGQPLTITCQVSGYSLTDSGYAAAWIRQREGKSMEWIFHTWYDGSSNKNDALKNKFSISRDSSAQTVTITGQNLQPEDTAVYYCARCY
Oreochromis niloticus V291 ighv MKQE01000018.1 20452693 VYSIDLIQPNSLVVQPGQPLTITCQVSGYSLTDSGYAAAWIRQREGKSMEWIFHTWYDGSSNKNDALKNKFSISRDSSAQTVTITGQNLQPEDTAVYYCARCY
Oreochromis niloticus V290 ighv MKQE01000018.1 20446167 VYSIELIQPDSRVMQPGQSMTITCQVSGYSLTDSGYGTCWIRQKQGKQMDCINCMWSNGSTDKNDALKNKFSITRDTSAQTVTITGQNLQPEDTAVYYCARG
Oreochromis niloticus V289 ighv MKQE01000018.1 20438185 VYGVDLIQPDSLIVQPGQSLTITCRVSGYSLTSSSYATNWIRQRDGKQMDWIFTMGYDGSTSKNDALKNKFSMSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V288 ighv MKQE01000018.1 20438185 VYGVDLIQPDSLIVQPGQSLTITCRVSGYSLTSSSYATNWIRQRDGKQMDWIFTMGYDGSTSKNDALKNKFSMSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V286 ighv MKQE01000018.1 20430711 VYSIDLIRPESRAVQPGQSLTITCQVSGYSITSYPTAWIRQREGKQLEWILIIWSGGSTDENDALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V285 ighv MKQE01000018.1 20421500 VDGQTLTESESVIKRPGESHRLTCTASGFTFSSYWMTWVRQAPGKGLEWIASIYDSSSIYYSQSFRGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARG
Oreochromis niloticus V284 ighv MKQE01000018.1 20419484 VYGVDLIQPDSMIVQPGQSLTVTCRVSGYSLTDSSYATSWIRQREGKQMDWILTMWSGGSTTNNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V283 ighv MKQE01000018.1 20419484 VYGVDLIQPDSMIVQPGQSLTVTCRVSGYSLTDSSYATSWIRQREGKQMDWILTMWSGGSTTNNDALKNKFSISRDTSAQTVTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V282 ighv MKQE01000018.1 20414763 VYSIDLNQPESRVVQPGQSMTITCRVSGYSLTDSSYGTCWVRQRQRQQMDWINCMWSGGSTDNNDALKNKFSLSRDTSAETLTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V281 ighv MKQE01000018.1 20414763 VYSIDLNQPESRVVQPGQSMTITCRVSGYSLTDSSYGTCWVRQRQRQQMDWINCMWSGGSTDNNDALKNKFSLSRDTSAETLTITGQNLQPEDTAVYYCARY
Oreochromis niloticus V280 ighv MKQE01000018.1 20410664 VYSIDLIQPDSRVLQPGQPLTIICQVSGYSLTDGSYGTCWVRQRQRQKMDWINCMCYNGNTANNNALKNKFSVSRDTSARTLTITGQNLQPEDTAVYYCAR
Oreochromis niloticus V279 trdv MKQE01000018.1 20399616 VWSEFKLEQSPSQVKRPGEKVKMSCIISGYSSTNYNINWIRQRPGRALEWIGRMTTWSNSAFYGSSFQSRVIITGEDVPSSTHYLEIKSLTAEDSAIYFCARQ
Oreochromis niloticus V278 ighv MKQE01000018.1 20378648 VECEQLNQPASVTVQPGQRLTITCQVSYSVSGYWTHWIRQPAGKRLEWIGMAATGYTTYYKDSLKSKFSISTDSSSKTVTLTGQNVQPDDTAVYYCARN
Oreochromis niloticus V277 ighv MKQE01000018.1 20375779 VKCEQLNQPASVTVQPGHRLTITCQVSYSVSSYLTAWIRHPAGKGLEWIGMALGSSTEYKDSLKSKFSISTDSSSNTVTLTGQNVQPDDTAVYYCARD
Oreochromis niloticus V276 ighv MKQE01000018.1 20368782 VDGQTLTQSEPVVKNPGNSHRLTCTASGFTFSNYWMHWIRQAPGKGLEWIAIIRTSTHSYATYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCA
Oreochromis niloticus V275 ighv MKQE01000018.1 20362180 VNGQTLTESEPVTKRPGESHRLTCTVSGFTLSSYYMAWVRQAPGKALEWIAYIGTYSSPIRYSQSVQGRFTISRDDSSSKIYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus V349 trdv MKQE01000023.1 23891822 LTAGDSITPERTEVTETEAKSVKLTCNYQTSDSDPWLYWYRHDSDLQAPQFILWKGAKDSSGYEYIPDKRYESETSSTSTDLTITALTLADTALYYCALE
Oreochromis niloticus V348 trav MKQE01000023.1 23866260 SSEDLLTPSKDVVMSLEGNTVTLSCKYSGSETYFFWYKQKPNSHPDFLIAYHSDKTERMKFIHDDQKKEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V347 trav MKQE01000023.1 23863115 DKVIQEQRDVIAAEGDTVTLHCKYETTSTYAYLFWYKQEVNKFPKYVLRRDTASEDNAQEFPKNRFDAELRDKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V346 trdv MKQE01000023.1 23857923 LTAGDSITPQQTEVTETEGKSVTLTCSYQTTADGVELHWYRHDSNVQAPQFILWKDARSWSGEYIPDNRYKSETSPTTTDLTITVLTLADTALYYCALQ
Oreochromis niloticus V345 trav MKQE01000023.1 23822967 DKVIQEEGDVIAAEGDIVTLRCKYETSYPSPTLFWYKQEVDSYPKYMLKSFSETTDKSEEFNNDKFDAKINKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V344 trdv MKQE01000023.1 23815095 LTAGDSITPQQTEVTETEGKSVKLTCSYETTTGYARLFWYRHHSDLQAPQFILWKEGQGGSSEYIPDNRYKTKRSRSSTDLTITALTLADTALYYCALQ
Oreochromis niloticus V343 trav MKQE01000023.1 23814326 DKVIQEQGDVIAAEGDTVTLRCTFETSYTNPTLIWYKQEVNSYPKYMLKTFSETTDKSEEFKNDRFDAKIKKTENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V342 trav MKQE01000023.1 23810905 DKVIQEQGDVIAAEGDTVTLGCRFETSDSSPYLFWYKQEVNSYPNYMLRCFSKSTVKAEEFNNDRFDAKINKNEKSVSLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V341 trdv MKQE01000023.1 23798255 LTAGDSITPQQTEVTETEGKSVKLTCSYQTSADGFSLDWYRHDSDLQAPQFILWKAEGSWSGEYIPDKRYESETSSTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V340 trdv MKQE01000023.1 23776271 LTAGDSITPQRTEVTETEGKSVKLTCNYQISGGRYVHWYKHHSDLQAPQFILWRISGGGDQYAPDKRYESETSSTTTNLTITALTLADTALYYCALE
Oreochromis niloticus V339 trav MKQE01000023.1 23760766 QKDNVLQAKGEETAAAGGTVTLGCQYNTSGDNHYLYWYKQDGHKSPKFILSRFRIGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V338 trav MKQE01000023.1 23717381 SSEDLLTPSKDVVMSLEGDTVTLSCKYSGSDTYFFWYKLKPNSHPDFLIAYYSDKTERMKFIHDDQKKEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V337 trav MKQE01000023.1 23687472 CKGEDKVTQEQGDVIAAEGDTVILGCRFETSDSSPYLFWYKQEVNSYPKYMLQSISTSTVKAAEFNNDRFDAKINQKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V336 trav MKQE01000023.1 23658424 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVRNLYWYHQKSGSRPQLLMEEHSEKIEKLKFRKDQDKSEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V335 trdv MKQE01000023.1 23619251 LTARDSITPEQTEVTETEGKSVKLTCSYETDEEYVRLHWYRHHSDLQAPQFILWKGAKDSSGDEYIPDNRYESETSSTSSNLTITALTLADTALYYCALE
Oreochromis niloticus V334 trav MKQE01000023.1 23616396 DKVIQEQGDVIAAEGDTVTLGCRFETTDNFPRLFWYKQKVGSFPEFILRRFSGSTEHEDSERSRFTATLKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V333 trav MKQE01000023.1 23606916 DKVIQEQGDVIAAEGDTVTLGCTFETSYPGPTLIWYKQEVNSYPKYMLKCVSESTVKAAEFNDDRFDAKINKTEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V332 trdv MKQE01000023.1 23574813 LTAGDSITPQQTEVTETEGESVTLTCNYETSYTHPKLHWYRQHSDLQAPQFILWKGGKQQTAQYIPDNRYGSETSDRSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V331 trav MKQE01000023.1 23574066 SSEDLLTPSKDAVMSLEGDTVTLSCNYSGSVSYFFWYKQKSSLPPQFLINEYSEQTEKLKFRKDQDKSEFYLEISSAAVTDSAVYYCAVRPTVTG
Oreochromis niloticus V330 trav MKQE01000023.1 23565534 SSEDLLTPSKDAVMSLEGDTVTLSCKYSGSDTYFFWYKQKPNSHPDFLIAYYSDKTERMKFIHDNQKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V329 trdv MKQE01000023.1 23550931 LTAGDSITPEQTEVTETEGKSVKLTCNYETTSEYVRLHWYRHHSDLQAPQFILWKEARSWSDKYIPDNRYGSQTSRTSTKLTITALTLADTALYYCALQ
Oreochromis niloticus V328 trav MKQE01000023.1 23550165 DKVIQEQGDVIAAEGDTVTLGCRYETSYAATLIWYKQEANSYPKYMLHCVSETTVKAEEFKNDRFDAKINEKQQSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V327 trav MKQE01000023.1 23531839 CKGEDKVIQEQGDVIAAEGDTITLYCKYETTDAYPYLFWYKQEVNSYPKYMLKSFSETTDKSEEFNNDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V326 trdv MKQE01000023.1 23514700 LTAGDSITPQQTEVTETEGKSVTLTCNYQTDSGYPLLYWYRHHSYLQVPRFILYKGGKLETAQYIPDDRYGSQTSPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V325 trav MKQE01000023.1 23500862 KVIQEQGDVIAAEGVTVTLGCRFETSDASPTLFWYKQKKNGSPKLLVQRFFLSADNSEAKDRFDAKVDKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V324 ighv MKQE01000018.1 26473057 VKCEQLTQPLSVIVQPGQRLTITCQVSYSLGYWTAWIRQPAGKGLEWIGMKHTSASYYKDSLKNKFSIDLDTSSNTVTLNGQNMQPEDTAVYYCARE
Oreochromis niloticus V323 ighv MKQE01000018.1 26446758 KRPGETLSLSCRGSGFTFTCCTMHWVRQQPGKALEWMGIGFSSSNSNTYVSSLSGRIQISRDDSNSMVHLRLSNLKPEDSAVYYCAKDTQWFK
Oreochromis niloticus V322 ighv MKQE01000018.1 26446713 VTGQSMESIPSSPVVKRPGETLSLSCRGSGFTFTCCTMHWVRQQPGKALEWMGIGFSSSNSNTYVSSLSGRIQISRDDSNSMVHLRLSNLKPEDSAVYYCAK
Oreochromis niloticus V321 ighv MKQE01000018.1 26443575 LNGQAMESIPSTPVLKKPQEAVSLSCRGSGFSFGSFGMNWIRQPAGKALEWLGLIWSHGSRTAYASSVEGRIEITKDNSNSMVYLRLSSLKPEDSAVYYCA
Oreochromis niloticus V320 ighv MKQE01000018.1 26430507 VTGQSLESVPSSPVMKRPGETLSLSCRGSGSEFTCCGMHWIRQQPGKTLEWIGVGHRPSSNNRYANSLSGRIEVSRDDSNYIVYLRLSSLKPEDSAVYYCAR
Oreochromis niloticus V319 ighv MKQE01000018.1 25360941 QTLTEFESVVKRPGDSHRLTCTYSGFSYDIAAAWVRQAAGKGLEWNASIYSGGSIYYSQSFRGPFTISRDNSRKQVYLQMNSLTAEDSAVYYCSNVFGDVCY
Oreochromis niloticus V318 ighv MKQE01000018.1 20769811 VDSQTITQSESVVKRPAESHKLTCTGSDIDFSSSWMAWIRQAPGKGLEWIAIIEFDSDNIFYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus V317 ighv MKQE01000018.1 20760348 VYSIDLLQPDSSIVQPGQTLTITCQVSGYSLTDNTYATGWVRQREGKPMDWIFHQWGGGDFYKNDALKNKFSYSRDTSARTVTITGQNLQTEDTAVYYCVRR
Oreochromis niloticus V316 ighv MKQE01000018.1 20724479 VDSQTITQSESVVKKPAESHKLTCTGSDISFSSRWMAWIRQAPGKGLEWIAIIEYDSDRIFYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus V315 ighv MKQE01000018.1 20672170 VYSIDLIQPDARSVQPGQSLTITCQVSGYSMTDNSYATGWIRQREGKAMDWIFYQWGGGTLRQNDALKNKFSYSRDTSAGTATITGQNLQTEDTAVYYCVRY
Oreochromis niloticus V314 ighv MKQE01000018.1 20668489 VHSIDLIQPDSTMVQPAQSLTITCQNSGYSLTDDSYATGWTRQREGKPMDWIFYQWGTSGLWQNNALKDKFSYSRDTSARTVTITGQNLQTEDTAVYYCVRYRRVIQ
Oreochromis niloticus V313 ighv MKQE01000018.1 20638492 VDSQTVTQSESVVKRPAESHKLTCTGSDIDFSSYWMAWIRQAPGKGLEWIAIIEDDSDSIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDTAVYYCARE
Oreochromis niloticus V387 igkv MKQE01000557.1 23828 QITVTQPGAESSAVGGSVSIKCRTSQDVYVYSSSHLLAWYQQKDGGVPKLLIYRASTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKSYHVINSQGV
Oreochromis niloticus V386 ighv MKQE01000407.1 53350 RTITESEPAVKRPGELHRLMCTTSGFNFGSSVWSWIRQAPGKGLEWIAFIHKASTPIHYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARV
Oreochromis niloticus V385 ighv MKQE01000407.1 42080 VYSIDLIQPDSRVLQPGQPLTIVCQVSGYSLTDNSYATCWVRQRQRQQMDWINCMGYDGSSSNNNALKNKFSVSRDTSAQTVTITGQNLQPEDTAVYYCAR
Oreochromis niloticus V384 ighv MKQE01000407.1 20268 VDGQTLTQSEPAVKRPGESHRLTCTASGYTFGDYSLVWVRQAPGKQLEWIAYIYWRDGSTSYSQSVQGRFTISKDNSKQQLYLQMNSLKTEDSAVYYCARN
Oreochromis niloticus V383 ighv MKQE01000407.1 15794 VYSIDLIQPDSRIVQPGQSLTITCQGSGLSVTNYGRGWVREREGNPLEWINLIWTGGGINKNDALKNKFSISRDYSGQTVTLTGQNLQPEDTAVYYCA
Oreochromis niloticus V382 ighv MKQE01000407.1 8030 GDSQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMAWVRQAPGKALEWVANIRYDSAYIYYSQSVQGRFTISRDNSKQQLYLQMNSLNTEDSAVYYCARD
Oreochromis niloticus V381 ighv MKQE01000407.1 4820 VNCQTLTESEPVDKRPGESHKLTCTTSGFTFSSYSMDWIRQAPGKGLEWIAYISSGGGSNTYYSQSVQGRFTISRDNSKQQLYLQMNNLKTEDSAVYYCARE
Oreochromis niloticus V380 trgv MKQE01000225.1 57821 QLIQDDLTLTRRVGESVSFSCGGTDQCSSSYRYWYQKKENETFRIILRINKNNGDIYSGYGHPQKDDFSALNKQNGCELKIEKVKRDHSATYYCSCYKSA
Oreochromis niloticus V379 trgv MKQE01000193.1 46046 QLIQDDLTLTRRVGESVSFSCGGINQCYYNDIFWYQKKEKETFRVILYIDKSSGYIEKGYGHPQKNDFSAQNKQNGCELKIKKIKLDHSATYYCNCYMYG
Oreochromis niloticus V378 igkv MKQE01000128.1 215428 QITVTQPGAVSSAVGGDVRIECKVSEDVYDSIFLAWYQQKDGGFPKHLIYSASTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHVINSQRV
Oreochromis niloticus V377 trgv MKQE01000121.1 61890 EQLIQDDLTLTRRVGESVSFSCGEINKCDGSYVFWYQKKEYETFKAILDIHKTNGNIDNSYNHPQKDDFSAQNKQNGCELKIKKIKRDHSATYYCSCAKSA
Oreochromis niloticus V376 igkv MKQE01000092.1 341849 SRGQITVTQPGAVSSAVGGSVSIKCTTSQNVYNNNYLAWYQQKDEGVPKLLIYLASTRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V375 igkv MKQE01000092.1 337975 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVSGSSHCLAWYQQKDGNPPKRLITYASTRDSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V374 igkv MKQE01000092.1 315429 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVRVWNNYHLLAWYQQRDGGVPKLLIYYASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V373 igkv MKQE01000092.1 284188 SRGQITVTQPGAVSSAVGGTVSIKCRTSQNVYVYNNNHRLAWYQKEDGGVPKLFIHSATTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V372 igkv MKQE01000092.1 269906 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVAVWNNNHLLSWYQQKDGGDHKLLIYFASTRYSGTSDHFTGSGSNSDFTLTISGVQAEDAAVYYCVG
Oreochromis niloticus V371 igkv MKQE01000092.1 261661 SRGQITVTQPGAVSSAVGGSVNIKCRTSQDVYVHSNNHRLAWYQQRDGGVPKLLIYYISTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V370 igkv MKQE01000092.1 245884 SRGQITVTQPGAVSSAVGGTVSIKCRTSQNVYVSGSNHYLAWYQQKDGETPKMLIYGASTRVSGIPAGFTGSGSNSDFTLTISGVQAEDAAVYYCSSEHNPNSQWV
Oreochromis niloticus V369 igkv MKQE01000092.1 225286 SRGQITVTQPGAVSSAVGGSVNIKCRTSQNVYVYNNNHYFAWYQQKDGGVPKLLIYLASTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSLHNINSQWV
Oreochromis niloticus V368 igkv MKQE01000092.1 214254 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVHVSGSSHCLAWYQQKDGETPKRLIYHASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQG
Oreochromis niloticus V367 igkv MKQE01000092.1 195198 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVNVWNNKHLLAWYQQKDRASPKLLIYQSSTRASGISVRFRGSGSNSDFTLAIIGAQAEDTAVYYCLS
Oreochromis niloticus V366 igkv MKQE01000092.1 173539 SRGQITVTQPGAVSSAVGGSVNIKCRTSQNVHVYSNYHCLAWYQQRDGQPPKRLIYFASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINSQYV
Oreochromis niloticus V365 igkv MKQE01000092.1 163115 QITVTQPGAVSSAVGGTVSIKCRTSQDVYVSGSSHCLAWYQQKDGGVPKLLIYYASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQG
Oreochromis niloticus V363 igkv MKQE01000092.1 139740 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVHVYNNNHHLAWYQQRDGGVPKLLIYYASSRYSGIPARFTGSGSNSDFTLTISGVQAEDATVYYCQS
Oreochromis niloticus V362 igkv MKQE01000092.1 135495 SRGQITVTQPGAVSSAVGGDVRIKCRTSQDVYVYSNYHYLAWYQQKDGETPKLLIKRSHERISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V361 igkv MKQE01000092.1 119191 SRGQITVTQPGAESSAVGGSVNIKCRTSHNVHVSGSTHFLAWYQQKDGETPKRLIYYASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V360 igkv MKQE01000092.1 93979 QITVTQPGAVSSAVGGSVTIKCRTSQNVYVWKSYHLLAWYQQRDGSPLKLLIYYASTRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSYQVINSQYV
Oreochromis niloticus V359 igkv MKQE01000092.1 77953 SRGQFTVTQPGAVSSAVGDTVTIKCRTGQNVHVWNNNHRLAWYQKEDGGVPKLLIHSASTQQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V358 igkv MKQE01000092.1 68413 SRGQITVTQPGAVSSAVGGSATIKCTTGQNVYSSNLLSWYQQKDGGVPKLLIYTATTRASGIPARFTGSGSNKDFTLTISQIQAEDAAVYYCMGAFHSSYWEP
Oreochromis niloticus V357 igkv MKQE01000092.1 64900 QITVTQPGAVSSAVGGSVSIKCRTSQNVHVYNNYHLLAWYQQKDGGVPKRLIYYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHDINSQRV
Oreochromis niloticus V356 igkv MKQE01000092.1 49433 SRGQITVTQPGAVSSAVGGSVSIKCTTSQNVHVSGSSHCLAWYQQKDGETPKRLIYHASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V355 igkv MKQE01000092.1 11974 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVHVYSNNQYLAWYQQKDGGIPKLLIYFASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V354 igkv MKQE01000092.1 9425 QITVTQPGAVSSAVGGSVSIKCRTSQDVFVWNNYHLLAWYQQRDGSPLKLLIYFASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSRHDVNSQAV
Oreochromis niloticus V353 igkv MKQE01000092.1 4333 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVYSNNHILAWYQQSDGDVPKLLIKRAYERISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V352 ighv MKQE01000023.1 24875034 VKCEQLTQPASVIVQPGQRLTITCQVSYSLSGYYTAWIRQPAGKGLEWIGMKYTGDSYYKDSLKSKFSIDLETSSKTVTLNGQNMQPEDTAVYYCAKKSK
Oreochromis niloticus V351 trdv MKQE01000023.1 23942384 LTAGDSITPQQTEVTKTEGELVTLTCSYETTSSYPWLYWYRHHSDLQAPQFILWKGAKSDSHRQYIPDNRYKTQTSDRSTTLTITALTLADTALYYCALQ
Oreochromis niloticus V426 trav MKQE01000010.1 12883751 CKGEDKVIQEQGDVIAAEGDTVTLNCKYEATSTYATYLFWYKQEVNNFPKYVLRRDSTGAAENAQEFPKDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V425 trav MKQE01000010.1 13393556 SSEDLLTPSKDAVMSLEGDTVTLSCNYSGYVQALFWYHQKSGSRPQLLMAEHSAQTEKLKFIHEREKKEFHLEISSAAVTDSAVYYCAVRPTVTG
Oreochromis niloticus V424 trav MKQE01000010.1 13404258 SSEDLLTPSKDVVMSLEGDTVTLSCKYSAVVQTLFWYHQKSGSRPQLLMADYSPQTEKLKFIHEREKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V423 trav MKQE01000010.1 13423180 QKDNVLQAKGEETAAAGGTVTLHCLYNTSSLTGTSLFWYKQDGNNSPTFILSRVSRDDGNTEDEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V422 trav MKQE01000010.1 13437976 SSEDLLTPSKDVVMSLEGDTVTLSCNYSAVVQTLFWYHQKSGSRPQLLMADYSPQTEKLKFIHEKEKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V421 trdv MKQE01000010.1 13439832 LTAGDSITPQQPEVTETEGKSVTLTCSYQTDADRLYLHWYRHHSELQAPQFILYKGAGSWSGEYIPDNRYRSETSPTSTTLTITALTLADTALYYCALQ
Oreochromis niloticus V420 trav MKQE01000010.1 13470270 SSEDLLTPSKDVVMSLEGDTVTLSCKYSAVVQTLFWYHQKSGSRPQLLMADYSPQTEKLKFIHEREKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V418 trav MKQE01000010.1 13505674 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGYVQALFWYHQKSGSRPQLLMEEHSAQTEKLKFIHEKEKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V417 trdv MKQE01000010.1 13507676 LTAGDSITPERAEVTETEGKSVTLRCNYQTDAGGAYLHWYRHDSDLQAPQFILWKGAKSDSDRQYIPDKRYKSETSSTSTNLTITALTLADTALYYCALE
Oreochromis niloticus V416 trdv MKQE01000010.1 13508453 VICEELTALDTQKSSLEGSTVTLSCSYSKPVVGTYYFFWYQQYPGKPPKFLISHSDKGQLTSDPVSRLSVKVNETLMTLQISSAAVTDSAVYYCAVK
Oreochromis niloticus V415 trav MKQE01000010.1 13522246 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVYSLFWYHQKSGSRPQLLMEEHSAQTEKLKFIHEKEKKEFHLVISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V414 trdv MKQE01000010.1 13524390 LTAGDSITPERAEVTETEGKSVTLTCSYQISGTPGVHWYRHHSDLQAPQFILWKGARGSTTQYIPDNRYQSTTSDTSTNLTITALTLADTALYYCALE
Oreochromis niloticus V413 trav MKQE01000010.1 13561912 DKVIQEQGDVIAAEGDTVTLGCTFTSQTTPTLFWYKQEVNAYPKYILRKFLSGATDKAPEFQEDRFDAKINETSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V412 trdv MKQE01000010.1 13564853 LTAGDSITPQRTEVTETEGESVTLTCSYQTSASGAELHWYRHDSDLQAPQFILWKGGKRETGQYIPDNRYQSTTTDRSTTLSITALTLADTALYYCALQ
Oreochromis niloticus V411 trav MKQE01000010.1 13584284 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVRNLYWYHQKSGSRPQLLMAEHSAQTEKLKFIHDREKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V410 trdv MKQE01000010.1 13586171 LTAGDSITPQQTEVTETEGKSVKLTCSYETDAGGAWLYWYRHDSDLQAPQFILFKGARSWSGIDYIPNNRYDSETSSTSTNLTITALTLADTALYYCALE
Oreochromis niloticus V409 trav MKQE01000010.1 13602434 QKDNVLQAKGEETAAAGGSVTLHCLYNSSSLTGTSLFWYKQDGNNSPKFILMHYSGNQGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V408 trdv MKQE01000010.1 13617105 LTAGDSITPQQTEVTETEGKSVKLTCSYETDAGGVYLHWYKHHSDLQAPQFILYKGARSWSGIDYIPNNRYKSETSSTTTDLTITALTLADTALYYCALE
Oreochromis niloticus V407 trav MKQE01000010.1 13617867 SSVDLLTPSKDAVMSLEGETVTVSCNYSGSVSYFFWYKQKSSSHPQFLINEYSEQTEKLKFRKDQDKSEFYLQISSAAVTDSAVYYCAVRPTVTG
Oreochromis niloticus V406 trdv MKQE01000010.1 13638584 LTAGDSITPQQTEVTETEGKSVTLTCSYQTSDSTPLLYWYRHHFDVQAPQFILWKGARSWSGNEYIPDNGYKSETSPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V405 trav MKQE01000010.1 13639346 SSEDLLTPSKDVVMSLEGDTVTVSCNYSGSVYSLFWYHQKSGSRPQLLMEEHSAQTEKLKFIHDKEKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V404 trdv MKQE01000010.1 13662683 LTAGDSITPQQTEVTETEGKSVTLTCSYQTSASVADLHWYRHDSELQAPQFILRKGAKDYSGYEYIPDKRYRSETSSTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V403 trav MKQE01000010.1 13663454 QKDNVLQAKGEETAAAGGTVTLHCLYNSSGTNNYLFWYKQDGNNSPKFILMRISRDDGKTAEEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V402 trdv MKQE01000010.1 13687447 LTAGDSITPQQTEVTETEGKSVTLTCSYQTSASVADLHWYRHDSELQAPQFILRKGAKDYSGYEYIPDKRYRSETSSTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V401 trav MKQE01000010.1 13731131 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGYVQYLFWYHQKSGSRPQLLMEEHSAQTEKLKFIHEKEKQEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V400 trdv MKQE01000010.1 13733168 LTAGDSITPQQTEVTETEGKSVTLRCNYQTSDSYPILHWYRHDSDLQAPQFILKKGAKDYSGYEYIPDKRYKSETTDTTTDLTITALTLADTALYYCALQ
Oreochromis niloticus V399 trav MKQE01000010.1 13745963 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVLNLYWYHQKSGSRPQLLMAEHSAQTEKLKFIHDREKKEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V398 trdv MKQE01000010.1 13747833 LTAGDSITPQQTEVTETEGESVTLTCNYQTSDSSLLLHWYRHHSDLQAPQFILRKGAGSWSGIDYIPNNRYNSETSPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V397 trav MKQE01000010.1 13766903 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVLNLYWYHQKSGSHPQLLMAEHSAQTEKLKFIHDREKKEFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V396 trdv MKQE01000010.1 13774243 LTAGDSITPQQTEVTKTEGKSVKLTCSYQTTASGPWLYWYRHHSDLQAPQFILRKGAKSQRGNDYIPDDRYDSETSSTSTDLTITALTLADTALYYCALE
Oreochromis niloticus V395 trav MKQE01000010.1 13825313 SSEDLLTPSKDVVMSLEGDTVTLSCKYSGYVQTLFWYHQKSGSRPQLLMAEHSAQTEKLKFIHDKEKKQFHLEISSAAVTDSAVYYCALQPTVTG
Oreochromis niloticus V394 trdv MKQE01000010.1 13826536 LTAGDSITPQQTEVTETEGESVTLTCSYETTADGAALHWYRHDSDLQAPQFILWKVGKGGSAEYIPDNRYKSETSPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V393 trav MKQE01000010.1 13836772 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVLNLYWYHQKSGSRPQLLMAEHSAQTEKLKFIHEKEQKEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V392 trdv MKQE01000010.1 13838613 LTAGDSITPQQTEVTETEGESVTLTCDYETSYSGIYLHWYRHDSDLQAPQFILRKGAKGYSGEYIPDKRYKTQTSPTSTTLTITALTLADTALYYCALE
Oreochromis niloticus V391 trav MKQE01000010.1 13839387 QKDNVLQAKGEETAAAGGTVTLHCQYESSGTSNYLFWYKQDGNNSPKFILSRVSRDDGKTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V390 trav MKQE01000010.1 35932746 QKDNVLQAKGEETAAAGGTVTLHCLYNTSSLSNYYLFWYKQDGNNSPKFLLSRFKVGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V389 trav MKQE01000010.1 35946032 DKVIQEQRDVIAAEGDTVTLYCKYETTSAFPYLFWYKQDVNDYPKYVLRRDASGTENAQEFPKHRFDAELNKTSVSLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V465 igkv MKQE01000014.1 33888037 SRGQITVTQPGAVSSAVGGTVSIKCRTSQDVYSSSYLFWYQQKDGGVPKLFIKYTSQRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V464 igkv MKQE01000014.1 33890419 SRGQITVTQPGAVSSAVGGTVSIKCRTSQDVYNNNYLAWYQQKDGGVPKLLIYFASTRYSGTSDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V463 igkv MKQE01000014.1 33909408 SRGQITVTQPGAVSSAVGGTVSIKCRTSQNVYGNDRLAWYQQKDGGVPKLLIYYASSRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V462 igkv MKQE01000014.1 33943022 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVYSNNHYLSWYQQKDGGVPKLLIYKSSTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V461 igkv MKQE01000014.1 33955520 SSGEQVLTQTPKAQSVVPGQTVSVRCKASSSVSSNLNWYLQKDGESPKLLIYSATNRQSGISDRFSGSGSRTDFTLTISRVQADDAGVYYC
Oreochromis niloticus V460 igkv MKQE01000014.1 34009100 SSAEIILTQTPKAQSVVPGQTVSIRCKSSTSIGDDIDWYLQKSGKAPKLLIYDTTARQSGVPDRFWSTAVQTDFTLIISGVQTEDAGVYYCQ
Oreochromis niloticus V459 igkv MKQE01000014.1 34010740 SRGQITVTQPGAVSSAVGGSVNIKCRTSQDVHGNNHLSWYQQKDGGVPKRLIYYTSNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAIYYCQS
Oreochromis niloticus V457 igkv MKQE01000014.1 34052335 SRGQITVTQPGAVSSAVGGTVIIKCRTSQNIYSNYLAWYQQKDGGVPKLLIYSASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus V456 igkv MKQE01000014.1 34062580 QITVTQSGAVSSAVGGSVSIKCRTSQNVYVSGRTHFLAWFQQKDGGVPKLLIYYASRRDSGIPARFTGSGWNSDFTLTISGVQAEDAAVYYCQSYHEINSQRV
Oreochromis niloticus V455 igkv MKQE01000014.1 34072358 QITVTQPGAVSSAVGGSVNMDCKISHTVINSDSVEWYQHKQGGPPKLLIYWSNRRASSISSRFTGSGSDKDFTLTISGVQAEDAAVYYCKG
Oreochromis niloticus V454 igkv MKQE01000014.1 34077557 SRGQITVTQPGAVSSAVGGTVSIKCRTSQDVYYSSPYHLLAWYQQKDGEVPKLLIYLASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHEINYQGM
Oreochromis niloticus V453 igkv MKQE01000014.1 34093366 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVRVWSNYHLLAWYQQKDGGVPKLLIYYANTRQSGIPTRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V452 igkv MKQE01000014.1 34095610 SSGEQVLTQSPGSQSVVLGQTVSVRCKASSSVNNYLNWYLQKDGESPKLLIYYATNRQSGVSDRFSGSGSGTDFTLTISRVQAEDAGVYYCHQSNSWP
Oreochromis niloticus V451 igkv MKQE01000014.1 34115779 SRGQITVTQPGAVSSAVGRTVSIKCRTSQDVLGSTHLAWYQQKDGGVPKLLIYYASSRYSGIPARFTGSGSNTDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V450 igkv MKQE01000014.1 34120161 SRGQITVTQPGAVSSAVGRTVSIKCRTSQNVYGNNYLHWYQQKDGGVPKLLIYVASSRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V449 igkv MKQE01000014.1 34130455 SSGEKVLTQTPGSQSVVLGQTVSVRCKASSSVSGCLNWYLQKDGESPKLLIYSATSRQSGVSERFSGSGSGTDYTLTISRVQAEDAGVYYCQQCNSWP
Oreochromis niloticus V448 igkv MKQE01000014.1 34150421 SSAEIILTQTPTAQSVVPGQTVSIRCKSSTTIGDDINWYLQKSGKAPKLLIYDTTARQSGVPDRFRATAVQTDFTLIISGVQTEDAGVYYCQQRNSFP
Oreochromis niloticus V447 igkv MKQE01000014.1 34154635 SRGQITVTQPGAVSSAVGGSVSIKCGTSQNVYSSNYLAWYQQKDGGVPKLLIYVASSRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V446 igkv MKQE01000014.1 34428836 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYVSGSSHRLAWYQQKDGVLKMLIHSASTRLSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V445 igkv MKQE01000014.1 34458360 SRGQITVTQPGAVSAAVGGTVSIKCRTSQNVYVSSNYHHLAWYQQKDGGVPKLLIYYASTRYSGIPVRFTGSGSNSDFTLTISGVQAEDATVYYCQS
Oreochromis niloticus V444 igkv MKQE01000014.1 36336290 SAGQNVVVTQSASKSVQLGQTVNINCKVSTQVAHYSGSRYYLAWYHQKAGEAPKALIYLTSDRFSGISSRLSGSGAGNGLDFTLSISAVQADDAGVYYCQS
Oreochromis niloticus V443 igkv MKQE01000014.1 36351316 TQSPGAQSVVAGQSVSITCRTSSSVYSIYYKKNLLSWYLQKPGGAPKLLIYHATSRQSGVSDRFSGSGSKTDFTLSIRGVQAEDSGVYYCQS
Oreochromis niloticus V442 trdv MKQE01000010.1 12812506 LTAGDSITPQRTEVTETEGKSVILTCSYETSYTHPALHWYRHDSDLQAPQFILWKGAKDYSGYEYIPDKRYGSQTSPTTTNLTITALTLADTALYYCALE
Oreochromis niloticus V441 trdv MKQE01000010.1 12812506 LTAGDSITPQRTEVTETEGKSVILTCSYETSYTHPALHWYRHDSDLQAPQFILWKGAKDYSGYEYIPDKRYGSQTSPTTTNLTITALTLADTALYYCALE
Oreochromis niloticus V440 trav MKQE01000010.1 12832079 SSEDLLTPSKDVVMSLEGDTVTLSCKYSGYVQALFWYHQKSGSHPQLLMEEHSAQTEKLKFIHEKEKQEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V439 trdv MKQE01000010.1 12834108 LTAGDSITPQQTEVTKTEGESVKLTCNYQTRYSGIYLHWYRHHSDLQAPQFILWKYGKGSTAEYIPDKRYKTQTSPTTTDLTITALTLADTALYYCALE
Oreochromis niloticus V438 trav MKQE01000010.1 12840104 SSEDLLTPSKDVVMSLEGDTVTLSCKYSGSETYFFWYKQKPNSHPDFLIAYYSDKTERMKFIHDDQKKEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V437 trav MKQE01000010.1 12849092 SSEDLLTPSKDVVMSLEGDTVTLSCNYSGSVYSLFWYHQKSGSRPQLLMAEHSAQTAKLKFIHEKEKQEFHLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V436 trav MKQE01000010.1 12863098 DKVIQEQGDVIAAEGDTVTLGCRYETTRANPTLFWYKQEVNSYPKYMLKCFSETTDKSEEFNNDRFDAKINKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V435 trav MKQE01000010.1 12863098 DKVIQEQGDVIAAEGDTVTLGCRYETTRANPTLFWYKQEVNSYPKYMLKCFSETTDKSEEFNNDRFDAKINKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V434 trav MKQE01000010.1 12863098 DKVIQEQGDVIAAEGDTVTLGCRYETTRANPTLFWYKQEVNSYPKYMLKCFSETTDKSEEFNNDRFDAKINKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V433 trav MKQE01000010.1 12863098 DKVIQEQGDVIAAEGDTVTLGCRYETTRANPTLFWYKQEVNSYPKYMLKCFSETTDKSEEFNNDRFDAKINKKENSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V432 trav MKQE01000010.1 12879306 DKVIQEQGDGIAAEGVTVTLGCTFASQTTATLFWYKQEVNSYPKYILRKFLSGATDKAPEFQEDRFDAKINETSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V431 trav MKQE01000010.1 12879306 DKVIQEQGDGIAAEGVTVTLGCTFASQTTATLFWYKQEVNSYPKYILRKFLSGATDKAPEFQEDRFDAKINETSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V430 trdv MKQE01000010.1 12882974 LTAGDSITPQQTEVTETEGKSVTLRCDYQTSVSDIYLHWYRHDSDLQAPQFILKKGARSWSNRQYIPDKRYESETSDTLTNLTITALTLADTALYYCALQ
Oreochromis niloticus V429 trdv MKQE01000010.1 12882974 LTAGDSITPQQTEVTETEGKSVTLRCDYQTSVSDIYLHWYRHDSDLQAPQFILKKGARSWSNRQYIPDKRYESETSDTLTNLTITALTLADTALYYCALQ
Oreochromis niloticus V428 trav MKQE01000010.1 12883751 CKGEDKVIQEQGDVIAAEGDTVTLNCKYEATSTYATYLFWYKQEVNNFPKYVLRRDSTGAAENAQEFPKDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V504 igkv MKQE01000014.1 33211538 QYTLTQPGAVSSAVGDTVTIKCRTSYNVYSSNRLAWYQQKDGETPKLLIYRASTQVSGISDRFNASGLDSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V503 igkv MKQE01000014.1 33211538 QYTLTQPGAVSSAVGDTVTIKCRTSYNVYSSNRLAWYQQKDGETPKLLIYRASTQVSGISDRFNASGLDSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V502 igkv MKQE01000014.1 33218128 QYTLTQPGAVSSAVGDTVTIKCRTSYNVYSSNRLAWYQQKDGETPKLLIYRASTQVSGISDRFNASGLDSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V501 igkv MKQE01000014.1 33218128 QYTLTQPGAVSSAVGDTVTIKCRTSYNVYSSNRLAWYQQKDGETPKLLIYRASTQVSGISDRFNASGLDSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V500 igkv MKQE01000014.1 33240674 SRGQITVTQPGAVSSAVGGTVNIKCRTSPNVNLWNNNHLLAWYQKKDGGVPKLLIYDAGTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V499 igkv MKQE01000014.1 33252672 SRGQITVTQPGAVSSAVGGTVRIDCKVSEDVYGSSLLAWYQQKDGDPPKLLIYDANTRESGIPARFAGSGSDSDFILTISGVQAEDAAVYYCQSYHEINSQEV
Oreochromis niloticus V498 trav MKQE01000014.1 33274536 SKPQVPVTQPAAVSSTVGGSVNIKCTTGQDVIFWNNKNYLFWYQHKDGGTPKPLVYNINNRASGIPDRFTGSGSNKDFTLSISRITAEDAAVYYCMGAFDSRYW
Oreochromis niloticus V497 igkv MKQE01000014.1 33292462 QITVTQPGAVSSAVEGSVNMDCKISHTVINSDSVEWYQHKQGEPPKLLIYYSNQRVSGISSRFTGSGSDKDFTLTISGVQAEDAAVYYCKG
Oreochromis niloticus V496 igkv MKQE01000014.1 33302277 SRGQITVTQPGAVSSAVGGDVNITCRTSQDVFLSSVLHWYQQKDGDPPKLLIYLADTLESGIPDRFTGSGSDSDFTLTISGVQAEDAAVYYCQSVHEMNSQPV
Oreochromis niloticus V495 igkv MKQE01000014.1 33339624 SRGQITVTQPGAESSAVGGTVNIKCRTSQNVYYSYPYHRLAWYQQKDGEVPKLLIYYASSRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V494 igkv MKQE01000014.1 33348835 SRGQITVTQPGAVSSAVGGTVNIKCRTSQNVYDSKRLAWYQQKDGGVPKPLIYYSSTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSYH
Oreochromis niloticus V493 igkv MKQE01000014.1 33358173 SRGQITVTQPGAVSSAVGGTVNIKCRTSQDVYSSNCLAWYQQKDGGVPKLLIYYASSRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V491 igkv MKQE01000014.1 33380447 SRGQITVTQPGAVSSAVRGSVNIKCRTSQDVYSSSYLFWYQQKDGGVPKLFIKYTSQRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V490 igkv MKQE01000014.1 33393091 SRGQITVTQPGALSSAVGGSVSIKCSTSQNVYVSGRTHFLAWFQQKDGGVPKLLIYYASRRDSGIPARFTGTGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V489 igkv MKQE01000014.1 33400202 SRGQITVTQPGAVSSAVGDTVTIKCRTSQNVYNNNYLHWYQQKDGGVPKLLIYLASNRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V488 igkv MKQE01000014.1 33404498 QITVTQSGAVSSAVGDTVTIKCRTSQRVDSGDRLAWYQQKDGGVPKLFIYTASNRQSGIPDRFRGSGWNSDFTLTITGVQAEDAAVYYCQS
Oreochromis niloticus V487 igkv MKQE01000014.1 33443635 SRGQITVTQPGAVSSAVGGSVNIKCTTSQRVASGNRLAWYQQKDGGVPKLFIYTASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V486 igkv MKQE01000014.1 33452187 QITVTQPGAVSSAVGGSVNINCKTSHRVDDGDSQFWYQQKDAERPKLLTSYGNRKVSGISDRFTSSGSNSDFTLTISQIQAEDAAVYYCQGEFYVNSQDV
Oreochromis niloticus V485 igkv MKQE01000014.1 33454627 SRGQVTVTQPGAVSSAVGGTVNINCKTSHRVDDGEDQFWYQHRDGERPKLLTSYGNRKVSGIPDRFTSSGSNSDFTLTISGVQAEDAAVYYCQGEFNVNSQWV
Oreochromis niloticus V484 igkv MKQE01000014.1 33458012 SRGQITVTQPGAVSSAVGGTVNIKCRTSQDAYSNLAWYKQKDGESPKLLIYYASSRESGTPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHVINSQAV
Oreochromis niloticus V483 igkv MKQE01000014.1 33474195 QITVTQPGAVSSAVGDTITIKCRTSQNVFVQSSSHCLAWFQQKDEKPPKRLIYYTSTRYSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSAHLINSQAV
Oreochromis niloticus V482 igkv MKQE01000014.1 33481295 QYTLTQTGAVSSAVGESVNIKCTTSQNVYGSSYLSWYQQKDGGVPKLLIYSASYRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V481 igkv MKQE01000014.1 33483708 SRGQITVTQPGAVSSAVGGSVNIKCRTSQNVYSSNRLHWYQQKDGGVPKLVIYLASNRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V480 igkv MKQE01000014.1 33502764 SSGEIILTQTPGSQSVVLGQTVSVRCKASSSVSSYLHWYLQKDGESPKLLIYYATSRQSGISDRFSGSGSGTDYTLTISRVQAEDAGVYYCQQGY
Oreochromis niloticus V479 igkv MKQE01000014.1 33555099 SRGQYTVTQPGAVSSAVGGSVSIKCSTSQDVYSSNCLAWYQQKDGGVPKLLIYYASSRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V478 igkv MKQE01000014.1 33572147 SSGEIILTQTPGSQSVVLGQTVSVRCKASSSVSTCLHWYLQKDGESPKLLIYYATSRQSGVSERFSGSGSGTDYTLTTSRVQAEDAGVYYCQQCNSWP
Oreochromis niloticus V477 igkv MKQE01000014.1 33587035 SSAEIILTQTPKAQSVVPGQTVSFRCKSSTTIGDDINWYLQKSGKTPKLLIYDTTERQSGVPDRFRATAVQTDFTLIISGVQTEDAGVYYCQ
Oreochromis niloticus V476 igkv MKQE01000014.1 33593573 SRGQITVTQPGAVSSAVGGTVSIKCRTSQNVHGNNYLHWYQQKDGGVPKLLIYYASTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINSQYV
Oreochromis niloticus V475 igkv MKQE01000014.1 33600451 QITVTQSGAVSSAVGGSVNMKCRTSQDVYSSNCLAWYQQKDGEVPKLLITYASTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSAHVINSQYV
Oreochromis niloticus V474 igkv MKQE01000014.1 33643874 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYYSSPYHYLAWYQQKDGGVPKLLIYVASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V473 igkv MKQE01000014.1 33688136 SRGQITVTQPGAESSAAGGTVSNKCRTSQDVSNSNRLAWYQQKDGGVPKLLIYAASYRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCMGEFDSNSWEL
Oreochromis niloticus V472 igkv MKQE01000014.1 33695535 SRGQITVTQPGAESSAAGGTVSNKCRTSQDVSNSNRLAWYQQKDGGVPKLLIYAASYRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V471 igkv MKQE01000014.1 33743335 SRGQYTVTQPGAVSSAVGGTVSIKCRTSQDVFYSSYHYLHWYQQKDGGVPKLFIYQSSTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V470 igkv MKQE01000014.1 33772820 SRGQITVTQPGAVSSAAGGTVSIKCTTSQNVYNSNRLAWYQQKDGGLPKLLIYSASSRESGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V469 igkv MKQE01000014.1 33782276 SRGQITVTQPGAESSAVGGTVSIKCTTSQTVYVGSCLAWYQQKDGGVPKLLIYYASNRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V468 igkv MKQE01000014.1 33839402 SRGQITVTQPGAVSSAVGGTVNIKCRTSQNVYVYSSYHYLQWFQQRNGNVPKLLLKRAHERISGTPARFTGSGSHKDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus V467 igkv MKQE01000014.1 33849413 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYNNNNMYWYQQKDGVPKLLITYASTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus V542 trav MKQE01000018.1 1042430 QKDNVLQAKGEETAAAGGTVTLGCLYNSSNTNINLFWYKQDGNNSPKFLLSHFKVGEGKTEAGDRFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V541 trav MKQE01000018.1 1042430 QKDNVLQAKGEETAAAGGTVTLGCLYNSSNTNINLFWYKQDGNNSPKFLLSHFKVGEGKTEAGDRFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V540 trdv MKQE01000018.1 1051289 LTAGDSITPQQTEVTETEGESVKLTCSYQTSDSYIELHWYRHHSDLQAPQFILWKGARSWSNRQYIPDKRYGSETSDTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V539 trdv MKQE01000018.1 1051289 LTAGDSITPQQTEVTETEGESVKLTCSYQTSDSYIELHWYRHHSDLQAPQFILWKGARSWSNRQYIPDKRYGSETSDTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V538 trdv MKQE01000018.1 1057665 LTAGDSITPQQTEVTETEGESVTLTCSYETSDSDPWLYWYRHDSDLQAPQFILWKGAKSDSDRQYIPDNRYKTQTSDRSTDLTITALTLADTALYYCALE
Oreochromis niloticus V537 trav MKQE01000018.1 1058442 KVIQEQGDVIAAEGETVTLRCKYETSYPSPTLFWYKQEVDSYPKYMLKSFSETTDKSEEFNNDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V536 trav MKQE01000018.1 1058442 KVIQEQGDVIAAEGETVTLRCKYETSYPSPTLFWYKQEVDSYPKYMLKSFSETTDKSEEFNNDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V535 trav MKQE01000018.1 1105325 QKDNVLQAKGEETAAAGGTVTLDCLYNTSSSNHYLYWYKQDGNNSPKFLLSRFKVGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V534 trav MKQE01000018.1 1105325 QKDNVLQAKGEETAAAGGTVTLDCLYNTSSSNHYLYWYKQDGNNSPKFLLSRFKVGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V533 trdv MKQE01000018.1 1113041 LTAGDSITPQQTEVTETEGKSVKLTCNYQTTADGFSLDWYRHDSDLQAPQFILWKAEGSLSGEYIPDKRYESETSSTTTDLTITALTLADTALYYCALQ
Oreochromis niloticus V532 trav MKQE01000018.1 1132875 QKDNVLQTKGEETAAAGGTVTLHCLYNSSTTTAPSLFWYKQDGNNRPKFILSRVSRDDGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V531 trav MKQE01000018.1 1132875 QKDNVLQTKGEETAAAGGTVTLHCLYNSSTTTAPSLFWYKQDGNNRPKFILSRVSRDDGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V530 trav MKQE01000018.1 1132875 QKDNVLQTKGEETAAAGGTVTLHCLYNSSTTTAPSLFWYKQDGNNRPKFILSRVSRDDGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V529 trdv MKQE01000018.1 1142967 LTAGDSITPQQTEVTETEGKSVTLTCSYETSDSYIYLHWYRHDSDLQAPQFILWKREGSWSGEYIPNKRYKTQTSDTTTNLTITALTLADTALYYCALQ
Oreochromis niloticus V527 trav MKQE01000018.1 1159129 VTCDQLTPVKDEESSLEGSTVTLTCTYTKGAADYFFWYRQHPGKAPEFLISHLESGEIGIPPRSSRLSVGVRKDETKMNLQISSAAVTDSAVYYCAVQ
Oreochromis niloticus V526 trdv MKQE01000018.1 1171163 LTAGDSITPQQTEVTETEGESVTLTCSYETSDSSLLLYWYRHHSDLQAPQFILWKGARSWSGNEYIPDKRYKTQTSDRSTDLTITALTLADTALYYCALQ
Oreochromis niloticus V525 trav MKQE01000018.1 1172725 DKVIQEQGDVIAAEGDTVTLRCKYETSYPSPTLFWYKQEVDSYPKYMLKCFSEKTDKSEEFNNDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V524 trav MKQE01000018.1 1172725 DKVIQEQGDVIAAEGDTVTLRCKYETSYPSPTLFWYKQEVDSYPKYMLKCFSEKTDKSEEFNNDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V523 iglv MKQE01000018.1 15205522 VSGVTVVTQKPPVLSVREGETATMDCNLGTVTNSAARWYKQIPGGVPQYVLRFHRSYSSSYYGSGFSSPKFTSTHQSTTDYRLIVKNVEEGDSAVYYCKTWDSNDAV
Oreochromis niloticus V522 iglv MKQE01000018.1 15205522 VSGVTVVTQKPPVLSVREGETATMDCNLGTVTNSAARWYKQIPGGVPQYVLRFHRSYSSSYYGSGFSSPKFTSTHQSTTDYRLIVKNVEEGDSAVYYCKTWDSNDAV
Oreochromis niloticus V521 iglv MKQE01000018.1 15228730 VSGVTVVTQKPPVLSVSKGETATMDCNLGTVVNSARWYKQIPGGVPQYMLRMFHEWTSPKYSSGFSSPKFNSTHQSGSDYRLIINNVEEGDSAVYY
Oreochromis niloticus V520 trav MKQE01000018.1 15236335 VTGVTVLTQKPPVLSVSKGDTATMDCNLGTVNISNARWYKQIPGGSPQFVLRFYHTWGSPTYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCK
Oreochromis niloticus V519 trav MKQE01000018.1 15236335 VTGVTVLTQKPPVLSVSKGDTATMDCNLGTVNISNARWYKQIPGGSPQFVLRFYHTWGSPTYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCK
Oreochromis niloticus V518 trav MKQE01000018.1 15236335 VTGVTVLTQKPPVLSVSKGDTATMDCNLGTVNISNARWYKQIPGGSPQFVLRFYHTWGSPTYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCK
Oreochromis niloticus V517 iglv MKQE01000018.1 15242654 VSGVTVLTQKPPVLSVRKGETATMDCNLGTGTDVAVWYKQIPGGSPQYVLKMYHGWSSPGYGSGFSAPKFTSTHQSTTDYRLIIKNVEEGDSAVYYCQTWDGSVNENV
Oreochromis niloticus V516 iglv MKQE01000018.1 15248001 VSGVTVVTQKPVLSVSKGETATMDCNLGTVTDQSARWYKQIPGGVPQHVVRFYHGWSSPSYGSGFSAPKFTSTHQSTSDYRLIISNVEEGDSAVYY
Oreochromis niloticus V515 iglv MKQE01000018.1 15248001 VSGVTVVTQKPVLSVSKGETATMDCNLGTVTDQSARWYKQIPGGVPQHVVRFYHGWSSPSYGSGFSAPKFTSTHQSTSDYRLIISNVEEGDSAVYY
Oreochromis niloticus V514 trav MKQE01000018.1 15252971 VDAAKVLTQTPSVHTVSPGEEALLKCNIQRPESYYVSWYKQAPGSTPQFILRFYHSHSSPDYFGTGFSSDRFNSKASSNIDYQFIIKRAEAGDSAVYYC
Oreochromis niloticus V513 trav MKQE01000018.1 15252971 VDAAKVLTQTPSVHTVSPGEEALLKCNIQRPESYYVSWYKQAPGSTPQFILRFYHSHSSPDYFGTGFSSDRFNSKASSNIDYQFIIKRAEAGDSAVYYC
Oreochromis niloticus V512 ighv MKQE01000018.1 32473741 TESQTLTESQSVVKRPGDSHSLTCTYSGFGGDYNNTWIRQAAGKGLEWIAWIYYTGSDISYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus V511 ighv MKQE01000018.1 32473741 TESQTLTESQSVVKRPGDSHSLTCTYSGFGGDYNNTWIRQAAGKGLEWIAWIYYTGSDISYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Oreochromis niloticus V510 trgv MKQE01000017.1 47886993 LVTMAAELVQKDLTLTATPGKKVSFSCGTAQCSGSYVHWYQKKDDDKFRVILHINIRTGEVDSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCCCAQS
Oreochromis niloticus V509 trgv MKQE01000017.1 47942560 LVTMAAELMQKDLTLTATPGKKVSFSCGTAQCSGSYVHWYQKKDDDKFRVILHINIRTGEVDSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCCCAQS
Oreochromis niloticus V508 trgv MKQE01000017.1 48004566 LVTMAAELMQKDLTLTATPGKKVSFSCGTAQCSGSYVHWYQKKDNDKFRVILHINIRTGEVNSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCCCAQS
Oreochromis niloticus V507 trgv MKQE01000017.1 48044454 LVTMAAELMQKDLTLTATPGKKVSFSCGTAQCSGSYVHWYQKKDDDKFRVILDINIRTGEVDSDYNHAQKKDFSAVKNENSCELEINAVSLVHSAIYYCCCAQS
Oreochromis niloticus V506 igkv MKQE01000016.1 12230926 VIQSATVKQDTGVRFAAIGDNVTLQCFYESQVAMHFSWYRQFLGSQPKLLSTIYKYDKPSEVLHTLEKNPRFSVERKEGTNHLQISGVHLSDSATYYCGS
Oreochromis niloticus V580 trdv MKQE01000018.1 793533 LTAGDSITPEQTEVTETEGESVTLTCSYQTGYRNIELHWYRHHSDLQAPQFILWKGAKDNSRYEYIPDKRYGSETSDRSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V579 trav MKQE01000018.1 800696 VICEELTAINTQKSSLEDSTVTLSCSYSKPVVGTYYFFWYQQYPGKPPKFLISHSDKGQLISDPVIRLSVKVNETLMTLQISSAAVTDSAVYYCAVR
Oreochromis niloticus V578 trav MKQE01000018.1 834413 DKVIQEQGDVIAAEGDTVTLGCRFETSDPGPTLFWYKQKKNSSPKLLVQRFYLSADNSEAKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V577 trav MKQE01000018.1 834413 DKVIQEQGDVIAAEGDTVTLGCRFETSDPGPTLFWYKQKKNSSPKLLVQRFYLSADNSEAKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V576 trav MKQE01000018.1 834413 DKVIQEQGDVIAAEGDTVTLGCRFETSDPGPTLFWYKQKKNSSPKLLVQRFYLSADNSEAKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V575 trav MKQE01000018.1 842955 CKGEDKVIQEQGDVIAAAGDTVTLGCTYETSDSYSYLFWYKQELNDFPKYVLQRGTTGTADNAQEFPKDRFDAEVDKKEKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V574 trdv MKQE01000018.1 845789 LTAGDSITPERTEVTETEGKSVKLTCSYETSYTHPELHWYRHHSDLQAPQFILWKGARSLSDRQYIPDNRYKSETSPTSTNLTITALTLADTALYYCALE
Oreochromis niloticus V573 trav MKQE01000018.1 846566 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETSDPGPTLFWYKQKKNGSPKLLVQRFFSSADNSEAKDRFDAKINKKENSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V572 trav MKQE01000018.1 846566 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETSDPGPTLFWYKQKKNGSPKLLVQRFFSSADNSEAKDRFDAKINKKENSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V571 trav MKQE01000018.1 846566 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETSDPGPTLFWYKQKKNGSPKLLVQRFFSSADNSEAKDRFDAKINKKENSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V570 trdv MKQE01000018.1 862167 LTAGDSITPERTEVTETEGKSVTLTCNYQTSYSDIYLHWYRHHSDLHAPQFILKKGAKDYSRYEYIPDKRYGSQTSPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V569 trdv MKQE01000018.1 862167 LTAGDSITPERTEVTETEGKSVTLTCNYQTSYSDIYLHWYRHHSDLHAPQFILKKGAKDYSRYEYIPDKRYGSQTSPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V568 trav MKQE01000018.1 886629 QKDNVLQAKGEETAAAGDTVTLHCLYNSSISSGNSLFWYKQDGNNSPKFILSRVSGDDGNTAAEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V567 trav MKQE01000018.1 886629 QKDNVLQAKGEETAAAGDTVTLHCLYNSSISSGNSLFWYKQDGNNSPKFILSRVSGDDGNTAAEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V566 trav MKQE01000018.1 886629 QKDNVLQAKGEETAAAGDTVTLHCLYNSSISSGNSLFWYKQDGNNSPKFILSRVSGDDGNTAAEFKERFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V565 trdv MKQE01000018.1 906432 LTAGDSITPQRAEVTETEGESVKLTCSYETDASGAYLYWYRHHSDLQAPQFILWKGAGSVSSYNYIPDRRYKSETSSTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V564 trav MKQE01000018.1 907209 QKDNVLQAKGEETAAAGGTVTLGCLYNTSSSNHYLYWYKQDGNNSPKFILSRFKVGEGKTEAGDRFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V563 trav MKQE01000018.1 907209 QKDNVLQAKGEETAAAGGTVTLGCLYNTSSSNHYLYWYKQDGNNSPKFILSRFKVGEGKTEAGDRFSSTLDSSIRSAPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V562 trav MKQE01000018.1 911454 EDKVIQEQGDVTAAEGDTVTLDCRFETTRTGPTLFWYKKEVNAYPKYILRKFLSGATDKAPEFQEDRFDAKINETSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V561 trav MKQE01000018.1 911454 EDKVIQEQGDVTAAEGDTVTLDCRFETTRTGPTLFWYKKEVNAYPKYILRKFLSGATDKAPEFQEDRFDAKINETSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V560 trav MKQE01000018.1 911454 EDKVIQEQGDVTAAEGDTVTLDCRFETTRTGPTLFWYKKEVNAYPKYILRKFLSGATDKAPEFQEDRFDAKINETSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V559 trav MKQE01000018.1 962272 DKVIQEQGDVIAAEGDTVTLDCRYETSDSSPYLFWYKQEVNSYPKYMLHCFLRSAVKAEEFNNDRFDAKINKTQKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V558 trav MKQE01000018.1 962272 DKVIQEQGDVIAAEGDTVTLDCRYETSDSSPYLFWYKQEVNSYPKYMLHCFLRSAVKAEEFNNDRFDAKINKTQKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V557 trdv MKQE01000018.1 967225 LTAGDSITPQQTEVTETEGKSVTLTCSYQTDASGAYLYWYRHHSDFQAPQFILWKRARGSTTQYIPDNRYQSTTSDRSTTLTITALTLADTALYYCALQ
Oreochromis niloticus V556 trdv MKQE01000018.1 967225 LTAGDSITPQQTEVTETEGKSVTLTCSYQTDASGAYLYWYRHHSDFQAPQFILWKRARGSTTQYIPDNRYQSTTSDRSTTLTITALTLADTALYYCALQ
Oreochromis niloticus V555 trav MKQE01000018.1 967999 DKVIQEQGDVIAAEGDTVTLGCTFETSYTNPTLIWYKQEVNSYPKYMLKCFSETTDKSEEFNNDRFDAKVDKKKKSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V554 trav MKQE01000018.1 987901 DKVIQEQRDVIAAEGDTVTLGCRFETSDTSPTLFWYKQKKNGSPKLLVQRFYLSADNSEAKDRFDAEVDKKEKSVPLKIQKLHLSDSAVYYCALQPTVTG
Oreochromis niloticus V553 trav MKQE01000018.1 987901 DKVIQEQRDVIAAEGDTVTLGCRFETSDTSPTLFWYKQKKNGSPKLLVQRFYLSADNSEAKDRFDAEVDKKEKSVPLKIQKLHLSDSAVYYCALQPTVTG
Oreochromis niloticus V552 trav MKQE01000018.1 1003018 QKDNVLQAKGEETAAAGGTVTLGCQYESSGLTGTSLFWYKQDENNSPKFILSRVSGDDGNTAAEFKERFSSTLHSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V551 trav MKQE01000018.1 1003018 QKDNVLQAKGEETAAAGGTVTLGCQYESSGLTGTSLFWYKQDENNSPKFILSRVSGDDGNTAAEFKERFSSTLHSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V550 trdv MKQE01000018.1 1009347 LTAGDSITPQQAEVTETEGESVKLTCSYETDAGGAYLYWYRHDSDLQAPQFILWKGAKSDSDRQYIPDKRYKSETSSTSTDLTITALTLADTALYYCALQ
Oreochromis niloticus V549 trav MKQE01000018.1 1010861 LGSMNSIKQERAEEAVTEGGNINLTCTYDGSIYNIQWYRQYQRSRPEFLLSITEGGSVHEAVSGFSAHIDKTEKRADLEISSAAVTDSAVYYCAVR
Oreochromis niloticus V548 trav MKQE01000018.1 1013849 DKVIQEQGDVIAAEGDTVTLGCRYETSDPGPTLFWYKQDGNNSPKLILSRVSRNDGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V547 trav MKQE01000018.1 1013849 DKVIQEQGDVIAAEGDTVTLGCRYETSDPGPTLFWYKQDGNNSPKLILSRVSRNDGNTADEFKERFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V545 trav MKQE01000018.1 1030844 QKDNVLQAKGEETAAAGGTVTLGCLYNSSNTNINLFWYKQDGNNSPKFILSRFSGDDGDTAAEFKERFSSTLDSSNRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V544 trav MKQE01000018.1 1030844 QKDNVLQAKGEETAAAGGTVTLGCLYNSSNTNINLFWYKQDGNNSPKFILSRFSGDDGDTAAEFKERFSSTLDSSNRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V618 igkv MKQE01000058.1 163367 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVHVYNNNQLLAWYQQKDGGVPKRLIYYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Oreochromis niloticus V617 igkv MKQE01000058.1 224496 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVFVQSNSHCLAWFQQKDEKPPKRLICYTRIRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Oreochromis niloticus V616 igkv MKQE01000058.1 231094 SRGQITVTQPGAVSSAVGGSVNIKCRTSQNVINWDNNHRLAWYQQKDGNLPKLLIYYASTRQSGIPARFTGTGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V615 igkv MKQE01000058.1 251793 SRGQITVTQPGAESSAVGGSVNIKCRTSQNVYVYSNYHLLAWYQQKDGQPPKRLIYWSSTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V614 igkv MKQE01000058.1 264385 SRGQITVTQPGAVSSAVGDTVTIKCRTSQNVHVWNNNQLLAWYQQKDGGVPKMLIYYASTRYSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Oreochromis niloticus V613 igkv MKQE01000058.1 270619 QITVTQPGAVSSAVEGTVSIKCRTSQDVYVSGSSHCLAWYQQRDGNPPKRLIYAASTRYSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSLHNINSQWV
Oreochromis niloticus V612 igkv MKQE01000058.1 282797 SRGQITVTQPGAVSSAVGGSVNIKCRTSQNVHVSGSSHCLAWYQQKDGETPKRLIYYTSTRQSGTSDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V611 igkv MKQE01000058.1 292293 SRGQYTVTQPGAVSSAVGGSVSIKCRTSQNVHVWNNNHLLSWYQQRDGGVPKLLVYFASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V610 igkv MKQE01000058.1 330655 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYNNNYLSWYQQKDGGVPKLLIYHASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQG
Oreochromis niloticus V609 igkv MKQE01000058.1 351171 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVHVYSNNQRFSWYQQKDGGVPKLLIYRASTQVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCVG
Oreochromis niloticus V608 igkv MKQE01000058.1 360066 QITVTQPGAVSSAVGGTVNIKCRTSQNVHVWNNYRLLAWYQQRHGSPLKRLIYYASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Oreochromis niloticus V607 igkv MKQE01000058.1 366723 SRGQITDPQPGAVSSAVGGSVSIKCRTSQDVYVWNNNHLLAWYQQRDGGVPKLLIYFASSRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V606 igkv MKQE01000058.1 368130 SRGQITVTQPGAVSSAVGGTVSIKCRTSQDVYVYSNNHRLAWYQQKDGVLKMLIHSASTRESGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus V605 igkv MKQE01000058.1 392936 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVHVWNNNHLLAWYQQRDGGVPKLLIYHASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKSFHLINSQLV
Oreochromis niloticus V604 igkv MKQE01000058.1 395220 QITVTQPGAVSSAVGGSVSIKCRTSQNVFVWKSYHLLAWYQQRDGSPLKLLIYSASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V603 igkv MKQE01000058.1 400283 SRGQITVTQPGAVSSAVGGSVNIKCRTSQDVFVHSNNHILAWYQQSDGDVPKLVIKRAYERISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V602 igkv MKQE01000058.1 406240 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVYSNYHRLSWYQQKDGALKMLIHFATTRKSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus V601 igkv MKQE01000058.1 416367 QITVTQPGAVSSAVGGTVSIKCRTSQNVLVWNNYHLLAWYQQRDGNPPKRLIYYASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Oreochromis niloticus V600 igkv MKQE01000058.1 423634 SRGQITVTQPGAVSSAVGGSVNIKCRTSQDVINWDNNQRLAWYQQRDGKPPKMIINYTSTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V599 igkv MKQE01000058.1 437637 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVFVQSNSHCLAWFQQKDEKPPKRFIYYTSIRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V598 igkv MKQE01000058.1 445565 SRGQITVTQPGAVSSAVGGSVNIKCRTSQNVYVYNNYHLLAWYQQKDGQPPKRLIYWSSTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V597 igkv MKQE01000058.1 481768 SRGQITVTQPGAVSSAVGGSVNIKCTTSQNVYVSSNYHHLAWYQQKDGETPKLLIKRSHQRISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V596 igkv MKQE01000058.1 492056 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVHVWNNNHLLSWYQQKDGGVPKLLIYYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V595 igkv MKQE01000058.1 504247 SRGQITVTQPGAVSSAVGGTVNIKCRTSQDVHVYSNNQYLAWYQQKDGGIPKLLIYYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V594 igkv MKQE01000058.1 511826 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYVYSNNHILAWYQQSDGDVPKLLIKRAYERISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V593 igkv MKQE01000058.1 517779 SRGQITVTQPGAVSSAVGGTVSIKCRTSQDVDGNDLSWYQQKSGQPPKLFIYVASSRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V592 trdv MKQE01000020.1 39236121 LTAGDSITPEQAEVTETQGRSVTLTCNNQTNYTHPELHWYRHHSDLQAPQFILWKGARSRSGVQYIPDDRYDSEASSTSTNLTITALTLTDTALYYCALQ
Oreochromis niloticus V591 trav MKQE01000020.1 39241008 CKGEDKVIQEQGDVIATEGDTVTLECRYETSDTYPYLFWYKQEIYYFPKYVLQRDKGSENNALEFPKERFDAEFNDKAVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V590 trav MKQE01000018.1 741237 QKDNVLQAKGEETAAAGGTVTLGCLYNTSSLSNYYLFWYKQDGNNSPKFILSRFKVGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V589 trav MKQE01000018.1 741237 QKDNVLQAKGEETAAAGGTVTLGCLYNTSSLSNYYLFWYKQDGNNSPKFILSRFKVGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V588 trdv MKQE01000018.1 768668 LTAGDSITPQQTEVTKTEGESVKLTCNYQTSDSDPWLYWYRLSDLQAPQFILFKGAKDSSGDEYIPDNRYKSETSSTSTTLTITALTLADTALYYCALE
Oreochromis niloticus V587 trdv MKQE01000018.1 768668 LTAGDSITPQQTEVTKTEGESVKLTCNYQTSDSDPWLYWYRLSDLQAPQFILFKGAKDSSGDEYIPDNRYKSETSSTSTTLTITALTLADTALYYCALE
Oreochromis niloticus V586 trav MKQE01000018.1 775419 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETTTTGPTLFWYKQEANSYPKYMLHCFSTSTVKADEFNVDRFDSKINETSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V585 trav MKQE01000018.1 775419 CKGEDKVIQEQGDVIAAEGDTVTLGCRFETTTTGPTLFWYKQEANSYPKYMLHCFSTSTVKADEFNVDRFDSKINETSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V584 trdv MKQE01000018.1 784264 LTAGDSITPQQTEVTETEGESVTVTCSYQTSSSVAVLHWYRHHSGLQGPQFILWKQGKGGTAEYIPDNPYGSEISPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V583 trdv MKQE01000018.1 784264 LTAGDSITPQQTEVTETEGESVTVTCSYQTSSSVAVLHWYRHHSGLQGPQFILWKQGKGGTAEYIPDNPYGSEISPTSTNLTITALTLADTALYYCALQ
Oreochromis niloticus V632 igkv MKQE01000058.1 2312 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVYSNNHILAWYQQSDGDVPKLLIKRAYERISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V631 igkv MKQE01000058.1 8277 SRGQITVTQPGAVSSAVGGTVSIKCRTSQDVDGNDLSWYQQKSGQPPKLFIYVASSRASGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V630 igkv MKQE01000058.1 12576 QITVTQPGAMSSAVGGTVSIKCRTSQDVFVHSNSHCLAWFQQRDEKPPKRFIYYTSIRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V629 igkv MKQE01000058.1 17897 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVHVYNNNHHLAWYQQKDGGVPKLLIYYASTRYSGIPARFTGSGSNSDFTLTISGVHAEDAAVYYCLS
Oreochromis niloticus V628 igkv MKQE01000058.1 22128 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYDSKRLAWYQQADGDPPKRLIYFASIRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V627 igkv MKQE01000058.1 35827 SRGQITVTQPGAVSSAVGGTVSIKCRTSQNVYVHSNSHCLAWYQQKDGGVPKRLIYYASTRYSGIPARFTGTGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V626 igkv MKQE01000058.1 53529 SRGQITVTQPGAVSSAVGGSVNIKCRTSHNVHVSGSTHFLAWYQQKDGETPKRLIYYASTRYSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V625 igkv MKQE01000058.1 57603 SRGQITVTQPGAVSSAVGGSVTIKCRTSQDVYDSKRLAWYQQADGDPPKRLIYFASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V624 igkv MKQE01000058.1 65922 QITVTQPGAVSSAVGGSVTIKCRTSQNVYVWKSYHLLAWYQQRDGSPPKRLIHYTSTQQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHVINSQYV
Oreochromis niloticus V623 igkv MKQE01000058.1 105004 QFTVTQPGAVSSAVGDTVTIKCRTSQNVHVWNNNHRLAWYQKEDGGVPKLLIHSASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V622 igkv MKQE01000058.1 113507 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYFSSNYHRLAWYQQKDGGVPKCLIYYASTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V621 igkv MKQE01000058.1 132060 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVYVHSNSHCLAWYQQKDGRVPKLLIYFASTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Oreochromis niloticus V620 igkv MKQE01000058.1 138262 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVINWDNNHRLAWYQQKDGNLPKLLIYYASTRDSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V633 ighv MKQE01000687.1 11817 VKCEQLTQPEFVTVQPGQRLTITCQVSYSLSSWRTSWIRQPAGKGLEWIGGAHYGYPTFYKDSLKNKFTINLDTSSKTVTLNGQNMQPEDTAVYYCARG
Oreochromis niloticus V619 igkv MKQE01000058.1 152440 SRGQITVTQPGAVSSAMGGTVNIKCRTSQNVHVYSNNQYLAWYQQKDGGVPKLLIHFASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Oreochromis niloticus V582 trav MKQE01000018.1 785038 GNSLEDDITASSAEVFSSEGRTVTVSCNYSVKAQNLQWYRQDPGSAPQFLLLITDTSEPTVVRATPPNPRLTAALNKERNRVDLKISSAAVTDSAVYYCAVR
Oreochromis niloticus V581 trav MKQE01000018.1 785038 GNSLEDDITASSAEVFSSEGRTVTVSCNYSVKAQNLQWYRQDPGSAPQFLLLITDTSEPTVVRATPPNPRLTAALNKERNRVDLKISSAAVTDSAVYYCAVR
Oreochromis niloticus V546 trav MKQE01000018.1 1030844 QKDNVLQAKGEETAAAGGTVTLGCLYNSSNTNINLFWYKQDGNNSPKFILSRFSGDDGDTAAEFKERFSSTLDSSNRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V543 trdv MKQE01000018.1 1041656 LTAGDSITPQQTEVTETEGESVTLTCNYETDAGGALLHWYRHHSDLQAPQFILWKQGKGGTAEYIPDHRYDSETSSTTTDLTITALTLADTALYYCALQ
Oreochromis niloticus V528 trav MKQE01000018.1 1159129 VTCDQLTPVKDEESSLEGSTVTLTCTYTKGAADYFFWYRQHPGKAPEFLISHLESGEIGIPPRSSRLSVGVRKDETKMNLQISSAAVTDSAVYYCAVQ
Oreochromis niloticus V191 iglv MKQE01000018.1 15151904 VSGVTVVTQKPPVVSVRKGETATMDCNLGIVTNEPAWWYKQIPGGVPQYVVRFRHDWSTQYYGSGFSSPKFTCTHQSTTDYRLMIKNVEEEDSAVYYCKTW
Oreochromis niloticus V161 trav MKQE01000018.1 14952107 VSGVTVLTQKPVLSVRKGETATMDCNLGTVTNIVAWYKQTPGGSPQYVLRMHHHWSSPSYGSGFSAPKFTSTHQSTTDYSLIIKNVEEGDSAVYY
Oreochromis niloticus V154 iglv MKQE01000018.1 14888954 VSGVTVLTQKPVVSVRKGETATMDCNLGIVTNDATRWYKQIPGGVPQFVLRFRYDSSSPSYGSGFSSPKFTSTHQSRSDYRLIIKNVEEGDSAVYYCKTWDSSVSEYA
Oreochromis niloticus V123 trdv MKQE01000018.1 30351 LTAGDSITPQQTEVTETEGKSVTLTCSYQTPASSADLYWYRHDSDLQAPQFILAKQGKGGSGEYIPDKRYGSETSPTSTNLTITALTLADTALYYCALE
Oreochromis niloticus V112 igkv MKQE01000011.1 12594959 CSGQVTVTQPPVVTSTPGSTVTLTCKINRAVANCDGKPCLSWYQQKSGQTTKLLIKQGSITQSGTPSRFSGSGSSSDFSMTISGVQAEDAAVYYCFSDHGNFV
Oreochromis niloticus V85 trbv MKQE01000011.1 9170909 GISLGVRVHQSPSAAIRNAGDDVELICTHEKTDYRVMLWYQQSPGDAALKLIGYVDYSTIKYEGEFEKYCNITGDLSGNTAKKGSLFIAGLKESEHSAVYYCAARY
Oreochromis niloticus V56 trbv MKQE01000011.1 9099111 VPKSGVHQTPAALIKAPGEEIQIHCNHSNNKFDMIQWYKQSPGKNEMILLGYARFTFTAVEDAFENIYKVTGEGSRLSTFHIPKLRESVDSAMYFCAASA
Oreochromis niloticus V505 igkv MKQE01000016.1 12230926 VIQSATVKQDTGVRFAAIGDNVTLQCFYESQVAMHFSWYRQFLGSQPKLLSTIYKYDKPSEVLHTLEKNPRFSVERKEGTNHLQISGVHLSDSATYYCGS
Oreochromis niloticus V492 igkv MKQE01000014.1 33377007 SRGQITVTQPGAVSSAVGGTVNIKCRTSQDVINWDNNHRLAWYQQKDGNLPNLLIYFASTRVSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCKS
Oreochromis niloticus V466 igkv MKQE01000014.1 33878302 SRGQITVTQPGAVSSAVGGSVSIKCRTSQDVYVSSNYHYLAWYQQKDGETPKLLIKRSHERISGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSAHLINSQAV
Oreochromis niloticus V458 igkv MKQE01000014.1 34044519 SSGEIILTQTPGSQSVVPGQTVSVRCKASSSVSNNLHWYLQKDGESPKLLIYSATSRQSGISDRFSGSGSGTDYTLTVSRVQAEDAGVYYCQQGYSFP
Oreochromis niloticus V427 trav MKQE01000010.1 12883751 CKGEDKVIQEQGDVIAAEGDTVTLNCKYEATSTYATYLFWYKQEVNNFPKYVLRRDSTGAAENAQEFPKDRFDAKINKKEKSVPLKIQKLQLSDSAVYYCAVR
Oreochromis niloticus V419 trav MKQE01000010.1 13494334 QKDNVLQAKGEETAAAGGTVTLHCLYNTSSSNHYLYWYKQDGNNSPKFILSRFKVGEGKTEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ
Oreochromis niloticus V388 igkv MKQE01000557.1 34743 QITVTQPGAVSSAVGGSVTIKCRTSQNVFVWNSYHLLAWYQQRDGSPLKLLIYYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSRHDVNSQAV
Oreochromis niloticus V364 igkv MKQE01000092.1 145184 SRGQITVTQPGAVSSAVGGSVSIKCRTSQNVHVYNNNHRLAWYQQKDGGVPKLLIYYASTRQSGIPACFAGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINSQGV
Oreochromis niloticus V350 trdv MKQE01000023.1 23925003 LTAGDSITPQQTEVTETEGKSVKLTCDYQTTTGYARLFWYKHHSELQAPQFILWKEGQGGSAEYIPDKRYKSETSSTSTNLTITALTLADTALYYCALE
Oreochromis niloticus V312 ighv MKQE01000018.1 20636386 VYSIDLIQPESRSVQPGQSLTITCQVSGYSMTDDNYATGWIRQREGKAMDWISHQWGTSGLRQNDALKNKFSYSRDTSARTATITGQNLQTEDTAVYYCVRY
Oreochromis niloticus V287 ighv MKQE01000018.1 20433040 VYGVDLIQPDSMIVQPGQSLTITCRVSGYSLTSSSYATSWIRQRDGKQMDWIFTMWYDGSTSKNDALKNKFSMSRDTSAQTVTITGQNLQPEDTAVYYCARD
Oreochromis niloticus V274 ighv MKQE01000018.1 20353752 VDGQTLTQSEPVVKRPGESHRLTCTASGFTFSSYSMAWVRQAPGKGPEWITYISTSTYSYDTAYSQSFRGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Oreochromis niloticus V247 ighv MKQE01000018.1 20101495 VDGQTLTQSEPVVKNPGNSHRLTCTASGFTFSNYFMHWIRQAPGKGLEWIATIRTSGYSYATYYSQSVQGRFTISRDDSSSKLYLQMNNLKTEDTAVYYCARE
Oreochromis niloticus V236 ighv MKQE01000018.1 20000758 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSSYWTNWIRQPAGKGLEWIGMAAGSTTHYKDSLKSKFSISTDSSSKTVTLTGQNLQPEDTAVYYCARK
Oreochromis niloticus V211 ighv MKQE01000018.1 18989883 VKCEQLTQPGSLTVRPGDRPSPVHHLTITCQASYSLSSARTFWIRQPAGKELECIGSVHIGHSTRYKDSLQNKFSIDIDCSNRTVTLIGQNVQPEDSAVYYCARE
Oreochromis niloticus V192 igkv MKQE01000018.1 15171934 IVLTQTPAVHTVSSGQEVVLNCNIERYDRNSVRWYKQVPGEAPQYVLRFHHSDSSLSFGTGFSSDRFNSKSSSNIDYQFIIKQAETGDSAVYYCHTYDNSAS
Oreochromis niloticus V47 trbv MKQE01000011.1 9053032 ISLGIEIRQFPSAVIKKVNDDVQLLCTHDKSDYRVMLWYQRLPGETALKLVGYGYTQFKDDSVEEPFRESFKLEGDLNSDKKNGSLFINKLKAPEHTATYFCAASQ
Oreochromis niloticus V36 trbv MKQE01000011.1 9023148 VCVGIEVRQFPSEFITNVGSKVEIFCSHKKTDYRMMLWYQQLPGDTAMKLIGYLYYKDDKFEDQYKDHFNITGDLSGNTAKNGSLIVKVAQQEHSAVYYCAARE