WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rhinolophus ferrumequinum AWHA00000000.1 (AWHA01) 80 0 15 4 21 25 5 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rhinolophus ferrumequinum V29 iglv AWHA01020209.1 2094 SLAQAGLTQEASVSGSVGQKVTLSCTGNSNNVGQYGAGWYQVIPGAAPKTVMLGTSRPSGIPGRFSGSKSGNTASLIIMGLQPEDEADYYCSAWDYSLS
Rhinolophus ferrumequinum V41 trbv AWHA01027092.1 1642 LLDTAVFQTPKYLITQAGNEKSLKCEQKLGHDTMYWYKQDSKQLLKVMFTYNNKELILNETVPRRFSPNSPDKAHLNLHINSLEPGDSAVYFCASSQ
Rhinolophus ferrumequinum V69 trbv AWHA01050217.1 634 VSAQTIHQWPPTRVQAVDSPLSLNCTVKGTSSPNLYWYRQAAGGALQLLFYSISIGDVASEGDQNWNASRPQDGHFILSTEKLLLSHSGFYLCAWS
Rhinolophus ferrumequinum V77 trav AWHA01056402.1 8598 TLSLAETNQPSFIESYEGQEVNIACNHTNIVANEYIFWYPQFPNQGPQFIIQGYKTNTTNEVASLFIPADRKSSMLSMPYASLRDTAVYYCIVSA
Rhinolophus ferrumequinum V80 trdv AWHA01060294.1 422 FSMAQKVTQAQTTVTVQEGGAVTLDCTYETRWAVYTLYWYKQLPSGQMVFLIYQDYNRGNTKKNRYSVNFQKAKKFISLTISPLQLADSAKYFCALWD
Rhinolophus ferrumequinum V94 iglv AWHA01076448.1 3986 SLSQPVLTQQPSASASPGASAKLTCTLSSGYSGYSVDWYQQGPGKGPRFLMRVGPSGVVGSKGDGVPDRFSGSGSGLDRYLTIQNTQAEDEADYYCGA
Rhinolophus ferrumequinum V110 iglv AWHA01088072.1 783 SLSQPVLTQPPSLSASPGASARLTCTLSSGVVVGGYVIAWYQQKSGSPPQYLLGFKSDSDKVQGSGVPSRFSGSKDTSANAGLLLISGLQPEDEAEYYCAA
Rhinolophus ferrumequinum V111 iglv AWHA01088072.1 10463 SWAQSVLTQPPSVSGAPGQSVTISCTGSSSNIGIVGVSWYQQFPGKAPKLLIYYNNKRPSGVPDRFSGSKSGNSGTLTISGLRAEDEADYYCQSFDTSLG
Rhinolophus ferrumequinum V127 trav AWHA01102029.1 2115 VNGQELKQFPQFLLLQEGENFTTYCNSSTTLNRIQWYKQSPGGSPVLLMMLVKSGDVLEQERLRARFGETRKDSSLHIVGAQTADVGTYFCAW
Rhinolophus ferrumequinum V133 trdv AWHA01105767.1 413 FSMAQKVTQAQRTITVHQGGAVTLDCTYETRWAVYTLYWYEQLPSRQMVFLIYQDYNKGNAKQDRYSVNFQEAKKFISLTISRLQLADSAKYFCVLWD
Rhinolophus ferrumequinum V149 trdv AWHA01116529.1 639 VSLDIILEPVAKTLTVLAGNTATIYCSITGADLKNYQMSWYKKNEDNSLTLVYRQSNSSSDNLRSNFKGKIDALKSQYILDIPKATIKDAGTYYCGSD
Rhinolophus ferrumequinum V171 iglv AWHA01131962.1 1691 SSSQAVVTQEPSLAVSPGGTVTLTCGSSTGAVTNGHYPYWFQQKSGQVPRTLIYNTNNKLSWTPERFSGSIIGGKAALTLSGAQPEDEAEYYCWLGYSGA
Rhinolophus ferrumequinum V179 trbv AWHA01141953.1 1489 LVDAGVTQNPKFQILKTGQKVTLTCDQNMSHNYMCWYRQDPGHGLRLIHYSIAAGTTNEGDVPEGYNVSRSNTENFPLTLKSATPSQTSVYFCASSY
Rhinolophus ferrumequinum V193 iglv AWHA01153926.1 4348 SVASYELTQSPSLSVALGETARITCTGDLLDKIYTYWYQQKPGQAPVQVIYEDSKRPSGIPDRFSGSSSGKTATLTISGARAEDEADYYCQSADSSDG
Rhinolophus ferrumequinum V200 trav AWHA01159095.1 1759 VSGGDNVEQSPPTLSVQEGNSCAMNCSYSNSALDYFLWYKQEAGKGPQFIINIRSHQVKTEDGRFTVLLNKTVKQFSLHIEATQPGDSAAYFCAAS
Rhinolophus ferrumequinum V203 trdv AWHA01161188.1 2854 SSVAQKVTQDPPATSMQEGAAVTLNCWYETSETEYFTAFWYKQLASGEISFLLYQDSYGQNEKKGRYSTNVEKAAKSISLTLAPLQLEDSAKYFCALWE
Rhinolophus ferrumequinum V237 trgv AWHA01187986.1 931 GCGLSKLEQSQISISTEVKKSTDIHCKITSTDFVNDTIHWYRQKPNQALEHLIYVTSTKIRALTHKHRNKKFEARKNSQILTSILTINFIEKEDVAVYYCAGWAI
Rhinolophus ferrumequinum V239 trbv AWHA01189466.1 1932 SVFTGDAGGKVSQSPRHRVTEKGQNVTLRCDPISGHVGLYWYRQTLGQGPEFLMDFRGKETGDTSRMPKDRFVVKRPQGSHSTLEIQHAEQRDSAMYLCASSL
Rhinolophus ferrumequinum V240 trbv AWHA01189466.1 5144 PVNAAITQTPRYHIIQTGKMMILECSQHMNHFAMFWYRQDPGQGPRLIYYSRTVSSISKGDVTEGYSVSRDNNEHFPLTLESASTNQTSVYLCASSE
Rhinolophus ferrumequinum V241 trbv AWHA01189467.1 11617 LTEGGVVQSPRHKITGKGQAVTFWCDPISNHQTLYWYRQTLGQGLGLLIRFENEAVIDDSQLPKNRFFAERLEGTDSTLKIQRAELGDSAVYFCASSL
Rhinolophus ferrumequinum V242 trbv AWHA01189469.1 2006 PTDAAGVTQTPRHKVTRMGQAVTLSCEPMSGHTYLYWYRQTSVQGPEFLIYFSSQQPVDDSGMPKTRFLAQMSNKSCSTLKIEPTEPGDSAVYLCASSL
Rhinolophus ferrumequinum V263 trav AWHA01210320.1 2502 RTHGVSVSQTEGPVTLSEGSSLNVNCSYEEIQYPTLFWYVQYPGEGPQLLLKAVVDGEKGRNKGFEATYLKEPRSFHLEKASIHMSDSAMYYCALS
Rhinolophus ferrumequinum V277 trdv AWHA01225074.1 1851 SNVAQQVTQPQPEMSVWEAETVTLACTYSTSNSDYYLFWYKQPPSGEMIFIIRQEAYKLQNATENRFSVNFQKASKSFSLRISDCQLEDAAMYFCALSE
Rhinolophus ferrumequinum V281 iglv AWHA01227573.1 1185 SWAQTPLTQPPSVSGTPGTSVTISCAGSSNDVGGYNYVSWYQQHPGTAPKLLIYDVSKRPSGIPDRFSGSKSGSTASLTISGLQPEDEADYYCC
Rhinolophus ferrumequinum V282 iglv AWHA01227573.1 13272 VSSQPVVTQEPSLTVMPGLTVTLTCSMSTGPVTTGNIPGWFLKKPGQPPQQLIYQTDKRPASVPNRFSGSILGGRAALTIAGAQPEDEAEYFCIVWYN
Rhinolophus ferrumequinum V283 iglv AWHA01227574.1 2106 SVVSNELTQPPSVSVTPGQTARVTCSGDAIEEGYDVHWYQQKPGQAPVLVIYDSTNRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDAINDK
Rhinolophus ferrumequinum V324 trav AWHA01260025.1 269 IMGDAKSTQPDAMESTEGKPMHLPCNHSEITGSEYIIWYRQIPHQGPEHVIESVRDNKTNGMATLIIPTDRKSSTLILPQVTLRDTAVYYCIVRD
Rhinolophus ferrumequinum V335 trdv AWHA01281235.1 1839 FSMAEKVTQAQTTVTVQEGGAVTLDCTYETEWIVYPLYWYKQLSSGEMVFLLYQNYNEENVKQDRYSVNFQKAKKFISFTISPLQLADSAKYLCALD
Rhinolophus ferrumequinum V336 igkv AWHA01282881.1 3950 ASGNTVLTQAPVLLSVSLRESASITCRANQSISDYLSWYQQKPGQAPKILIYDADDRSPGVSNRFTGIQSGTEFILTISKVEADDVASYYCQQGYTVP
Rhinolophus ferrumequinum V337 trav AWHA01284494.1 5222 AENKDQVFQPSSVVSSEEAVAEISCNHSISNAYEFFWYLHFPGLAPRLLVRGSRPSQQGRYHMTYERFSSSLLILQVQVADAATYYCALQDTE
Rhinolophus ferrumequinum V341 trdv AWHA01286525.1 471 NHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLIPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Rhinolophus ferrumequinum V345 iglv AWHA01288182.1 1954 SWAEFVLTQPPSVSGSPGQKVTISCTRSSGNIGGNYVYWYQQRTGSAPTTVIYKDNQRPSGVPDRFSGSIDSSSNSASLIISGLQPEDEADYYCQSY
Rhinolophus ferrumequinum V349 trdv AWHA01000252.1 15107 NGMLCDRVTQSSPEQTVASGRDVALFCTYDTRFSDPDLYWYRIRPDRSFQFILYRDSSHVIDADFIQGRFSIQHNQTQKSFHLVISLVTTEDRATYYCAMG
Rhinolophus ferrumequinum V363 trav AWHA01014473.1 4188 IAGQSVQQTAELTAMEGASVQINCSYQASGFNGLSWYQQHEGSSPIFISYNVLDGLESRGHHFSSFLSRSETYSYLLVKDLQMKDSASYLCAVR
Rhinolophus ferrumequinum V366 trav AWHA01017797.1 2237 VSGKNEVEQSPQYLSAQEGEFITINCSYSIGINTLHWLRQNPGGGLVTLFILSLEKKEKGRLRATINTKERYSSLYITASQSKDSAIYFCAIE
Rhinolophus ferrumequinum V369 igkv AWHA01019656.1 591 ARCDIQMTQSPSTLSASLGDRVTITCHASQNIGSNLAWHQQKPGTAPKLLIYAASSLQTGVPSRFSGQRSGTDFTLTISSLQPEDVATYYCQQYNSYP
Rhinolophus ferrumequinum V377 trgv AWHA01026874.1 1522 ATQISSNLERSHISITRQSGSFVVIPCDIVNQNTNYIHWYRYQEGMAPRRLLYYEFSSSQFVVDQGVNSEKYHVYEGTGRSCKFVLRNLEEKDSGVYYCAVWM
Rhinolophus ferrumequinum V382 trav AWHA01030849.1 3614 AHQMWSRVLSPCIFKEGKSTNFTCQFPSGSFYALHWYRWEPAKSPKILFVISSNGDEKEEGRVKATLDTKNGYSYLYIKGSQPEDSATYLCAF
Rhinolophus ferrumequinum V388 trgv AWHA01038800.1 2962 TSGDIRITQVITSITKKIGNTAFLECQIKRDTLTKRRYIHWYRQKPDRPLRRILYISSNENVVHERGVSEERYEARRQKSDLLASLRIHRVKEADAGLYYCACWD
Rhinolophus ferrumequinum V389 trgv AWHA01038800.1 1172 GDSKMRISQDQLSLTRTPDKTVHIRCKLSGVPLDNVIVHWYQQKEGELLRRILYGSTKSYKLDAPNPRLETDMKENGVFYLIINKVTKSDEGTYYCACWD
Rhinolophus ferrumequinum V391 trav AWHA01039914.1 3826 VNGQELKQFPQFLLLQEGENFTTYCNSSTIFNNIQWYKQSPGGSPVLLMKLVKSGDVLKQERLRARFGETRKDSSLHIVGAQTADEGTYFCAG
Rhinolophus ferrumequinum V410 trbv AWHA01050219.1 10853 LVNAEVTQTPRYLVKKMGEIVQMDCSQDMNHDRMFWYRQDPGLGLRLLHFSYGVDSNEIGDFPHGYSVSRNNTERFSLTMKSATTNQTSVYLCASSE
Rhinolophus ferrumequinum V411 trbv AWHA01050219.1 7380 TVFGTLVSQKPSRDICQRGTSVTIECQVDSQINFMFWYRQLPGGSLTLIATANQGSGATYESGFTKDKFPISRPNLMFSNLTVTNVRPEDSSFYFCSVG
Rhinolophus ferrumequinum V412 trbv AWHA01050221.1 12239 SMDTRVTQTPRNTITKTGNRIVLKCSQNKGDIYMYWYRQDPGLGLQLIYYSTGIHDNKPGEVSAGYNVSRDEQAKFSLILQTASPNQTALYFCASSY
Rhinolophus ferrumequinum V413 trbv AWHA01050221.1 5092 FQDAGVTQFPRHRVSGTRKKLTLQCSQDMGHFTMYWYRHDPGFRLQLIYYSTGVNAIEKGDVPAGYHVSRKELKDFPLTLESASTNQTSVYFCASSE
Rhinolophus ferrumequinum V414 trbv AWHA01050222.1 16489 PTSASTTQSPRHLVMGRGQEAQLRCYPMESHLYVYWYWQFPGEELKFITSLGKEETPDESEMPTKRFSVKFPKEGPSVFKIQLAEPGDSAVYFCASSL
Rhinolophus ferrumequinum V415 trbv AWHA01050222.1 14873 SSGLGPRVSQNPSKAIGMSGDSVNIQCHTVDLQATTMFWYRQFPKQGLILLATSNMGSSVKYEQDFTEAKFPISHPNLTFSSLTVASMHPEDSSLYFCGAS
Rhinolophus ferrumequinum V416 trbv AWHA01050222.1 8634 SKDTEVTQTPRHLVRGKEQKAKMECVPIKGHSYVYWYRKKLGEELKFLVYCQNDEIVEKTEEIDKQILVQCPKNASCSLEVQSTDSGDSALYFCASSQ
Rhinolophus ferrumequinum V417 trbv AWHA01050222.1 5857 LADAEIYQTPAFRLTRAGQDVTLECKQNLKYNAMYWYRQDPGQGLRLIYYSTVEKDVQKGDLTEGYGVSREEKGLFPLTVKLAQTNQTSLYLCSGS
Rhinolophus ferrumequinum V418 trbv AWHA01050222.1 1311 LVDAQVTQTPGYLVRGRGQKARMDCTPEKGHPVVYWYQHIQKKEFKFLIYFQNEQVVDQIEMVKERFSASCPRNSPCILEILSPEPGDSALYFCASSQ
Rhinolophus ferrumequinum V419 trbv AWHA01050223.1 3444 SLDADVIQSPGHLIKGKGQNVKMDCVPIKEHNYVFWYQQILAKEFKFLISFQYQNVYKTEMPKERFSAECPQNSPCSLEIRGTEPQDSAIYLCASSE
Rhinolophus ferrumequinum V420 trbv AWHA01050223.1 693 HTDPGVSQTPSHRITEVGQGVTLGCDPISGHIFVYWYRQNLRHEMEFLISFQYQNIAVKSGMPKERFSAERPTGTYSTLMIQPAELGDSALYLCASAGI
Rhinolophus ferrumequinum V421 trbv AWHA01050224.1 755 PLGATVTQNPRYQVTRIGKPVYLSCSQDMNHDTMYWYQQRLSQAPKLLFYYYDQDFNNETDTSDNFQPSRPNTSFCSLGIRSPGVRDSAVYLCASSR
Rhinolophus ferrumequinum V428 trav AWHA01056519.1 4687 VSSASNVEQSPQSLHVQEGKSTNFTCRFPSSSFSALHWYRWEPAKSPKILFVISLNGDEKEERRVKATLDTKNGYSFLYIKGSQPEDSATYLCAF
Rhinolophus ferrumequinum V431 trav AWHA01058655.1 8565 VSRGENVVQHPPSLSVLEGNSCDMNCSYSDSGSNYFPWYKQEAGTGPQLFKYIRSNQDKIKDGRFILLLNKTAKQFSLHIETTQPGDSAVYFCAAS
Rhinolophus ferrumequinum V432 trdv AWHA01058655.1 2945 SNIAQKVTQGQPALLVQEKEAVTLDCIYDTTAGTYSLFWYKQLSSGSMIFLIRQDSYNQQNATEGRYSLNFQKAKNSVNLVISASQVEDSALYFCALTE
Rhinolophus ferrumequinum V440 iglv AWHA01063663.1 1796 SLSQPVLTQPPSLSASPGASARLTCTLSSGFNVGGYWIAWYQQKPGSPPLYLLVFKSDSDKYQGSASSRFSGSKDTSANAGLLLISGLQPEDEADYYCAV
Rhinolophus ferrumequinum V464 trav AWHA01088348.1 1679 GSNGDSVNQTEGSVILPEGTSMILKCNYQTTYSNVFLFWYVQYLNKAPQLLLKSMTENQRTEHQGFEAKLVKSDSSFHLQKSSLRMSDSAMYYCALS
Rhinolophus ferrumequinum V487 trav AWHA01103825.1 5137 VSGGENVVQHPPSLSVQEGNRCDMDCSYSDSASQYFSWYKQEAGKGPQLIIYIRSHQVKIEDGRFIVSLNKTVKQFSLHIEATQPGDSAVYFCAAS
Rhinolophus ferrumequinum V523 trav AWHA01138045.1 4698 GANAQLVTQQDRHVTVTEGASLELKCNYTYSSSPYLFWYVQYPNQGLQFLLNYFSGDTLVKGIKDFEAEFRKDETSFHLKKSSARWSDSAVYFCAIS
Rhinolophus ferrumequinum V564 trav AWHA01175980.1 1553 VRSQEVQQSPQSWIIQEGEDVTITCNSSKTLYSLHWYLQKHGEGPVILMILRQGGEDKNLDKIVGTLNEKKQQSSLYIVASQPRHSGTYFCGV
Rhinolophus ferrumequinum V569 iglv AWHA01181108.1 4693 SLSQPVLTQPPSLSASLGASARLTCTLSSGFNVGDFWIRWYQQKPGSPPRYLLTFHSDSDKHQGSGVPSRFSGSNDASANAGILLISGLQPEDEADYYCKT
Rhinolophus ferrumequinum V576 trbv AWHA01189466.1 9114 HMDAGITQSPRYKITGIEKKVTLRCHQTDNHDYMCWYRQDPGHGLRLIHYSIAAGTTNEGDVPEGYNVSRSNTENFPLTLKSATPSQTSVYFCASSY
Rhinolophus ferrumequinum V577 trbv AWHA01189467.1 5098 DAGDSVSQSPRHKVTEKGQNVSLRCDPISSHSVLFWYRQTLGQGPEFLMYFQGKDAVDTSGMPKDRFVVKRPQGSHSTLEIQRAEQRDSAVYLCASSL
Rhinolophus ferrumequinum V579 trav AWHA01190027.1 3674 GTRAETVTQPEDHISVTEGAPVQVKCNYSYSGSPELFWYVQYPKQGLQLLLKHFSKESTKGFTANLDKSGASFHLKKEAVQEEDSAIYYCVLR
Rhinolophus ferrumequinum V597 trav AWHA01209076.1 740 SNIAQKVTQDQPAMLVQEKESVTLECKYSTSDSAYSLFWYKQLSSGAMIFLIRQDSYSPQNATEGRYTLNFEKAKSSVNLVISASQLEDSALYFCALRE
Rhinolophus ferrumequinum V616 trav AWHA01225217.1 6879 DTCGDSVKQTEGPVILPEGAFLTLNCTYQASYSTFLYWYVQYQNEEPKLLLKSSSDKKANIRGFHADLVKKDSSFHLQKPAVETTDSAVYYCALA
Rhinolophus ferrumequinum V617 trdv AWHA01225217.1 4763 SSMTQSVNQTQSAISVVEKEAATLGCVYEAKSYSYYLFWYKQPPSGEMTFLIHQESYNEQKKTEGRYSLNFQKSANSINLTITASQIGDSAVYFCALR
Rhinolophus ferrumequinum V625 iglv AWHA01230616.1 4531 SVAQAGLTQPSSVTKSLRQTATLTCTGNSNNVGNQGAAWLQQLPGQAPKVLTYRNNNRPSGVSERFSSSRSGSVSSLSISELKPEDEADYYCSAWDSSLNA
Rhinolophus ferrumequinum V639 igkv AWHA01242971.1 8700 TTGEIVMTQSPASLSLSPGERATLTCRASQTVSSYLAWYQQKPGQAPKLLIYGATTRASGVPARFSGSGSGTDFTLTISSLEREDFAIYYCQQYNSGY
Rhinolophus ferrumequinum V644 trgv AWHA01247790.1 750 GFGQLKLEQPIISICRTRDKSAYISCKMSTENINTDYIHWYRQKPDQGIEHLLYVDSRTTVSNNFGGKKNKLQASKSSLTSTLTINFLEQEDEAIYYCACWSG
Rhinolophus ferrumequinum V663 trbv AWHA01261365.1 872 PTDAVGVTQIPRHKVIRTGQAVTLSCEPMSGHTGLYWYRQTSVQGPEFLIYFRSQQLVDDSGMPKTRFSAQMSNESYSTLKIQPTEPGDSAVYLCASSL
Rhinolophus ferrumequinum V664 trav AWHA01261741.1 1019 VSGGENVVQRPPSLSVQEGNSCDMNCSYTDSTSDYFPWYKQEAGKGPQLIIHIRSYQDKTEDGRFTVSLNKTVKQFSLHIEDTQPGDSAVYFCAAS
Rhinolophus ferrumequinum V667 iglv AWHA01264097.1 533 SVVSSDLTQTAAASVSLGQTARITCQGEILKSYYPNWYQQKPGQAPVLVIYGNNNRPSGIPDQFSSSDSADTSTLTISGAQAEDEADYYCQSWDNSKK
Rhinolophus ferrumequinum V671 trbv AWHA01275056.1 1300 RIAAGVTQFPSHRVIEKEQAVTLRCDPIPGHESLLWYQHAVGKEMKFLIRFLQEIIPDKSGMPNNRFSAERTEGTYSTLKIRTAQLEDSGVYFCASSL
Rhinolophus ferrumequinum V673 igkv AWHA01278221.1 3190 ARCDIQMTQSPSSVSASLGDSVTITCRASQGISNELSWYQHKPGTAPKLLIYGANSLQTGVPSRFSGQGSGTAFTLTISSLQPEDVATYYCLQDYSTP
Rhinolophus ferrumequinum V675 trbv AWHA01281277.1 3302 NSKTSYVAAMLLRKSSKRLTSLQCEQRLGHKAMHWYKQSAQKPPQLMFTYNYKELSENMTVPSRFSPTCTDSSHLYLHVDALQPEDSAVYLCASSQDIALQ
Rhinolophus ferrumequinum V676 trbv AWHA01281277.1 1282 PVDSGVSQTPRHLVKAKGQAVTLRCSPVPSHLSIYWYQQALGEGPQFLVQYYNGQERDKGNLSNRFLVQQFPNKSSELNISSLELSDTALYLCASSL
Rhinolophus ferrumequinum V677 iglv AWHA01282200.1 4348 SWAQTPLTQPPSVSGTPGTSVTISCAGSSNDIGGYNYVSWYQQHPGTAPKLLIYEVSKRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYRSG
Rhinolophus ferrumequinum V681 trav AWHA01285552.1 1869 VSSKQEVNQSPEVLTIKEGHSLFLNCSYTDSAIYTLQWYRQDPGKGLTLLLIQSSPGVQETGRIKAFFDKTSRHSALHIASAQLSDSATYLCAV