WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Crocodylus porosus MDVP00000000.1 (MDVP01) 21 1 0 0 1 1 18 0
Crocodylus porosus JRXG00000000.1 (JRXG01) 111 23 19 10 16 15 20 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Crocodylus porosus V14 trgv MDVP01000001.1 88755655 GSTEVLKQTQLSISRAESRTARIECHVAVSDFGTAYLHWYRQRPGAAPERILYFSSQVQVDRESDKRKFSVQKNLNKSICILTINRISSSDIATYYCATWT
Crocodylus porosus V13 trgv MDVP01000001.1 88761297 GDSQVLRQSQTSVTRGVRKTARIQCHVSTMSFSSAYIHWYRQLPEESPERILYFSSEKPVYDRDSDKRKFEAEKELMESTCTLTIKTVNQNDSATYYCTYWD
Crocodylus porosus V12 trgv MDVP01000001.1 88763101 GSGQVLKQTEPSITKAESRTIRINCYVDSSVFGTAIIHWYRQRPGAAPERILYFSSDLYLDQDSDKRKISAEKDFDLSRCVLTINSLTSSDTATYYCATWT
Crocodylus porosus V11 trgv MDVP01000001.1 88774026 GDAKGPTQFKLSITKKESKTALIECHVSGMGNTYIHWYQQKSGRAPERILYLSSGKNIFDKESSRGKFEAYGDPSKDTYALTVKQINKDDAATYYCAYWD
Crocodylus porosus V10 trgv MDVP01000001.1 88779042 LKQLQISITKQERKTAPIQCHVSGISLDSAYIHWYRQKPGKAPERILYLSSGKPVFDRDSDKGKFEAEKILSDSTCTLTIEQTSKDDAATYYCAYWA
Crocodylus porosus V9 trgv MDVP01000001.1 88785544 LKQLQISITKQERKTAPIQCHVSGISLDSAYIHWYRQKPGKAPERILYLSSGKPVFDRDSDKGKFEAEKIPTASICTLTVRRISKDDAATYYCAYWD
Crocodylus porosus V8 trgv MDVP01000001.1 88791159 GSAQVLKQTQLSITKAESKTIRIECHATVSDFGNAYIHWYRQKPGAPPERILYFSSQLHLDSDSDKEKFNAEKKIDKSLCILTIRRIASSDAATYYCATWT
Crocodylus porosus V7 trgv MDVP01000001.1 88796748 AQMLKQSKSFITKGVHKTARIQCVVSGISLRSAYIHWYRQKPRNAPEWILYLSSGEPVIDQGFEKEKFEVDKDLTNSTCTLTVKQINKKDAATYYCAYWD
Crocodylus porosus V6 trgv MDVP01000001.1 88802960 VLRAISVKQEQISITQPANLHSTVSISCKVNGGSASTYVHWYRALPGQALQRLLYLTLDGSNVKRDTGFSREKLTAIVRQSTCTLLVRKLEKTDSGHYYCAIWE
Crocodylus porosus V5 trgv MDVP01000001.1 88806260 LLWAIGLEQEPGFIVKQSTLGSTARITCHVTGGSSSTLIHWYRVLPGQAPQRILYLSLSGDKLEQDIGSKDKFSAYGKQQACNFIVRNLKKTDSGDYYCATWDL
Crocodylus porosus V4 trgv MDVP01000001.1 88810177 LLWAIRLEQTPRVIVQQSHSSSTAAFTCKITDGSSSTYVHWYRVLPGQAPQRLLYLTLDGSDMQRESGISWDKLTAFANPRVCTLEIYKLEKTDSGHYYCATWD
Crocodylus porosus V3 trgv MDVP01000001.1 88812670 VLWAIKLDQDPPVIIQTAHRSSTAELICKVTGGSESRYIHWYRALPGEAPQRILYYSYSKPEPTLDDGIPKDKFTAYFQSKDTCKLIVHKLEKKDRGLYYCATWE
Crocodylus porosus V2 trbv MDVP01000061.1 8663761 QTYAEITQTPSVVLERKRTAYLRCKQNNGHENMFWYRQNPRQGQGLQFLFFFQYQEERERAANFSHFKANRAQDDVLYLNISSVEPEDSAVYFCATSP
Crocodylus porosus V1 trgv MDVP01000061.1 8660262 VHSAAIIQQSQSMVERPGSPASLECSLEGQSNPNFYWYRQLPGGEIHLLAYSIGVDQVGDTGPKHIHASRTTDKKFTLSIKPLLANDTGVYYCAW
Crocodylus porosus V0 ighv MDVP01000028.1 13072054 TKLQVSKSKRSITLVENRPIPLNCSVKSQTSPDSHFAVLWYVHKPSDADGKLILKTTHSSAFEYGTYAEEEGLRGRLQFERSSSGGLFSLTVQRAEVSDSGSYY
Crocodylus porosus V19 trgv MDVP01000001.1 88734795 ALELTQSEPSKTRGKTRTALIKCQVTGTTAVMHWYRHKPGEGPERILYWSAGKVVYDKESDKKFSARQESNKNVYSLTIDDISSDDAAMYYCASWDD
Crocodylus porosus V18 trgv MDVP01000001.1 88739828 GSIGVTLTQSPSSTTRTVGTTARMKCVFTNFTGAFASAAIHWYQQSPGEAPKRVLYFISGDAAVDDQSQKSRFTVEKDSSKHTCTFNINSATKTDTGVYYCAYWD
Crocodylus porosus V17 trgv MDVP01000001.1 88747607 ITITQTPEFTVKRENAAVRMSCVLQGISENIASAIIHWYHQSPGEAPKRVLFYTSGKTTFDDNSQANNLQVTIDPAKSRYTFYVNRIKKMHAGIYYCAYWY
Crocodylus porosus V16 trgv MDVP01000001.1 88752128 GDAQVLKQSQSSIVRGVHKTARIECHVSGISFSNAYIHWYRQKPSEAPERILYLSSGRPSFDKESDKEKFEAKKNINDNTCTLTLNKIRTEDAATYYCACWD
Crocodylus porosus V15 trgv MDVP01000001.1 88754191 GHAQLLLQQIQTSVTKEQYKIARMDCKISGLKNFKSAVIHWYRQISGRAPERILFISESEPSIDQPSNKNKFHCEKDPDKQISTLTANYVTHNDTATYYCAVW
Crocodylus porosus V20 trav MDVP01000041.1 16018746 CCAQVTQPPTASVSPRGTVQLSCTLGGSYTVSSNRVVWIQQKQGNAPRFLLYFFTESNKGMGSGVPSRFSGSRSGSDKEGYLTITGALEEDDAVYYCATWTGSA
Crocodylus porosus V30 ighv JRXG01099458.1 867 AISAVQLIQSGPGVVKPGETLTVTCIVSGQSVTKTNRWWHWLQQPPGKGLEWMEEISYNGVTKYSPPLKSRVTISRDTSKNQFSLQLPSLTAADMVTYYCART
Crocodylus porosus V29 trbv JRXG01097076.1 5849 LCTGVVVTQKKFVAIQTGTDANLLCEHDDDTYHTVLWYQQKDQGQLQLVVIAVGMGNERTEDEYKPRYSMERKDMLHNSLKITPATVTDSAVYFCAASK
Crocodylus porosus V28 trav JRXG01093992.1 15255 AALGASIQTLESQVSGAEGGTVTLRCSYESRADAVYLHWYRQLLPGGLQYILFRGAKESSNLENTAKFAQKRFSSQAADTSTELTLSALQLADSAVYYCALE
Crocodylus porosus V27 ighv JRXG01078895.1 2196 AASAVTLVESGPGVVKPGETLALTCTVSGASIADSSYDWNWIRQPPGKGLEWVAYIYPYSGSTQYNPSLQSRTTISADKSKSQFSLQLRSLTAADTATYYCA
Crocodylus porosus V26 ighv JRXG01078894.1 2908 ALCQVQLVPSGPGLVKLGETLTLTCAITGNSDQIISSGCCIWSWIRQKPGKGLEWVGYVIKSGSTTYASLLRSRVSITADSSRNQFSLQLGSLTPADTAMYYCVRQ
Crocodylus porosus V25 ighv JRXG01053648.1 7127 VLAQVQLLESGPGVVKPRETLTLTCDVRGSYTTGCDWSWFQQPPSKGLEWLGLIHPTAGNTYYSLSLGSQITVSADTARHQFSLQLRSLTEADTATYYCSIDN
Crocodylus porosus V24 trbv JRXG01050949.1 25 SGLGVLITQVPKSATQRLGGTMKLTCYQNDTSYTYMYWYKQHQGEGLNLMAWGTDKSKAKYEDGYKKQTLIADRTSSTAFTISFTELEAQDSASYFCAASD
Crocodylus porosus V23 iglv JRXG01048769.1 371 VQSQPVVIMQPSASSVSPGQTVTLSCGLSAGAITSSNCLSWYQQKPGSVPQMLTFEAKRCSRIPTWFSGAVSGQKFTLTITGVQAEDEADYSCAVWYSGK
Crocodylus porosus V22 igkv JRXG01044615.1 2181 SSGDRVMTQTPEALAMSPGDTVTIKCKCSSSLTYSGREYLSWYQQKPGQAPKLLVYDGVTRKPGVPARFSGTGTGTDFTLTVSSIEATDAGDYYCQQYYNFP
Crocodylus porosus V21 ighv JRXG01042106.1 6946 VLTQVQVVASGPGVVKPGDILTLTCSVSGVSITDSNYDWHWIRHPPGNELEWMGRIYPYNGNTNYASSLQNRIMIFAATSKNQFFLQLLSLIVADTAMYYCG
Crocodylus porosus V20 ighv JRXG01042104.1 6088 TLTLTCTISGPSTATLGSSCCWWNWVRKGPGKGLEWLGNIERGGTTHYASSLTSRLTISVEPSKNQFSLQLQSLTAADTATYYCARNTV
Crocodylus porosus V19 trbv JRXG01035147.1 21457 QTYAEITQTPSVVLERKRTAYLRCKQNNGHENMFWYRQNPRQGQGLQFLFFFQYQEERERAANFSHFKANRAQDDVLYLNISSVEPEDSAVYFCATSP
Crocodylus porosus V18 trgv JRXG01035147.1 17958 VHSAAIIQQSQSMVERPGSPASLECSLEGQSNPNFYWYRQLPGGEIHLLAYSIGVDQVGDTGPKHIHASRTTDKKFTLSIKPLLANDTGVYYCAW
Crocodylus porosus V17 ighv JRXG01032404.1 3396 AVSEVTLVESGPGVMKPGQTLTLNCTLSSESLSSGSAWAWIRQPPGQGLQLMGRTVYTGVRWYTDYASALQGQVTISGIASQEQISLQLRSLTAADTATYYCAR
Crocodylus porosus V16 ighv JRXG01030446.1 35918 VLSQITLKESGPGVVKPGETLSLTCTVSGFSLTSYGVHWARQAAGERLQWVGAIWSGGSTNYNSALQSRLTISRDTSSSQVHLRVTGLQLADTARYYCAR
Crocodylus porosus V15 ighv JRXG01030446.1 3658 QLVEFGGTMRKPGDSLRLSCKVSGLNFSSTWMSWLRQAPGKGLQWVARINPGASSQVSYSADVQGRFTISRNDSQNLLYLQMSSLNPEDTALYYCAR
Crocodylus porosus V14 trav JRXG01030445.1 3272 SLIQPPSEVKQPGETLKLSCKYSGSDFTKYWMQWVRQPHSLGLSWIGEANKDATSTNIRQAFQERFKITRDNANSLIHLEVRNLQAEDSAVYYCA
Crocodylus porosus V13 ighv JRXG01030437.1 2537 VELVHSDAVVKKPGETVRISCKASGFTLTGTYMHWVQQAPRKGPVCVGDADPTNGNTSYAEILKGRIAITTSNSISTVYLQLSCLSPGDTAMYYCATGTVGRML
Crocodylus porosus V12 igkv JRXG01022351.1 5204 SSGEIVLTQTPESLAVSPGDQVTIKCKASSSLTYIGYQLLAWYQQKPGQATKLLIYSAVTRQSGVPARFSGSGSGTDFTLTISSVQAEDAADYYCQQYY
Crocodylus porosus V11 igkv JRXG01022350.1 12914 RVMTQTPESLAVSPGDTATIKCKCSSSLTSAGKEFLAWYQQKPGQTPKLIITFASTRQPGVLARFSGSGSGTDFTLTVSRVEAEDAGRYYCQQQYGAP
Crocodylus porosus V10 trav JRXG01018264.1 3820 ASEQLSQSLGALRGQEGQDLKLRCDYSMAQDSFTLDWYQQRPGEQPAFLVGRYSFGSRRTVPSTPSRFSTELKAGGGASMLSIAGAQPADSALYFCALQG
Crocodylus porosus V9 trav JRXG01018263.1 17198 AALGDLIWTMESQVFGAEGGTVTLRCSYKSSGGPVYLHWYRQFLSGQIQYILFRGAMEGTDIWDTTEFGWDRFSSQDSDTSTELTLSVLQLADSAVYYCALE
Crocodylus porosus V8 trav JRXG01018263.1 14039 APLGNSIWVTESPESQVSGGEGGTMTLRCSHESKSNVAYLLWYRQFLSGGLHYILSRGVREIRAVQDTAEFAKERFSSQASDTSKELTLSALQLADSAVYYC
Crocodylus porosus V7 ighv JRXG01016025.1 9640 VTVTQPGSASARPGESITLTCGTSGYNINDQHMHWLREAPGKGLVWMAAFRTGYDTYIANDFKGRVTPSTSGSTAKLQIARLTLADTATYYCTRE
Crocodylus porosus V6 ighv JRXG01016025.1 4302 ITLTQPGSSSARLGESTTLTCAVSGYNINEHHMHWLRKAPGKALIWMAAFKTGATTYIANDFNGRINPSTSGSTVKLQIARLTAADTATYYCT
Crocodylus porosus V5 igkv JRXG01012083.1 3645 SSGQVVLTQSPESLSVPVGGRVSITCKASASISNCLNWYQQKPGQVPKLLVYYASNLQSGVPARFSGSGSGTDFTFTISSVEADAAADYYCQQCNQWP
Crocodylus porosus V4 igkv JRXG01012081.1 1215 AQGQIVVTQSPESVAVSVGETVTIQCTSSRSIGTEMSWYQRKPGQAPKLLINSGSRYTGIPDRFSPSGSGTDFTLTISGVVAEDAGGYYCQQDYTTP
Crocodylus porosus V3 ighv JRXG01010452.1 8211 VLSAIQLLQSGPAVVKPGQTLTLTCTVSGESITSQTKGWTWLQQPPGRSLEWMGYLHHSGNTYYSPALQSRITISQDTSKNQFSLQLHSMTATDTATYYCATGY
Crocodylus porosus V2 trav JRXG01007806.1 9301 CCAQVTQPPTASMSPGGTVRLSCTLGGSYTVSNNRVVWIQQKQGNAPRFLLYFFTESSKGMGSWVPSWFSDSRSGSDKEGYLTISGALEEDDAVYYCVTWTGSA
Crocodylus porosus V1 trav JRXG01007806.1 5535 CCAQVTQPPTASVSPRGTVQLSCTLGGSYTVSSNRVVWIQQKQGNAPRFLLYFFTESNKGMGSGVPSRFSGSRSGSDKEGYLTITGALEEDDAVYYCATWTGSA
Crocodylus porosus V0 igkv JRXG01003326.1 105 AASQEGLWLQQSPAEIWMTPGQTAELNCAVSFPQQHVSWYKEHQDGSLQWVAHTGNFVEAKGRHTSKVSSTRKTHSLVISQLQEEDSGLYYCGLDVT
Crocodylus porosus V68 trgv JRXG01036671.1 23911 GHAQLLLQQIQTSVTKEQYKIARMDCKISGLKNFKSAVIHWYRQISGRAPERILFISESEPSIDQPSNKNKFHCEKDPDKQISTLTANYVTHNDTATYYCAVW
Crocodylus porosus V67 trgv JRXG01036671.1 25375 GSTEVLKQTQLSISRAESRTARIECHVAVSDFGTAYLHWYRQRPGAAPERILYFSSQVQVDRESDKRKFSVQKNLNKSICILTINRISSSDIATYYCATWT
Crocodylus porosus V66 trdv JRXG01031564.1 149 AFSQMELVARGPRIAGVSEPLTLTCADYKVKMTIFGYYWYWYQQLPGKKKEEVAWIYPYDGTKKYTSSFQNRVTISSDTSNNEVSLQLVSPTAADSAMYYCARCDYR
Crocodylus porosus V65 iglv JRXG01029507.1 2266 VWSQAVVTQEPAVSVSPGGTVTLSCSLSTGAITTSNYPSWYQQKPGSAPRLLIYNTNSRPSGIPTRFSGAISGQKAALTITGVLAEDEADYYCAVYIGSGVK
Crocodylus porosus V64 trav JRXG01026849.1 1321 LGVQLQLHQPQRFLFVEVGGTAEIPCSSREDVEWGAKVQWYLKRAGEAPMRIKKCADERYESRFACKHQSRSTTLEIRDIQRKDSGIYYCAHA
Crocodylus porosus V63 iglv JRXG01025437.1 5060 CLAQTAPTQPPSVSVSPGQTATLTCTGNSIGSNVVSWYQQKPGSAPLMVMYANNNRPSGVSERFSGSKSGNTATLTITGVRVEDEADYYCSVYTGSSA
Crocodylus porosus V62 trav JRXG01018265.1 23494 LLCDHITQSPSVLQEKAGNQAKLFCSYTTSHGNPDLFWYRQLSDNSLQYILYRDNSQSHNANFAKERFAVEHRKSEKTFHLVISAVRVEDSALYLCAVS
Crocodylus porosus V61 trav JRXG01018265.1 23494 LLCDHITQSPSVLQEKAGNQAKLFCSYTTSHGNPDLFWYRQLSDNSLQYILYRDNSQSHNANFAKERFAVEHRKSEKTFHLVISAVRVEDSALYLCAVS
Crocodylus porosus V60 trav JRXG01018265.1 23494 LLCDHITQSPSVLQEKAGNQAKLFCSYTTSHGNPDLFWYRQLSDNSLQYILYRDNSQSHNANFAKERFAVEHRKSEKTFHLVISAVRVEDSALYLCAVS
Crocodylus porosus V59 iglv JRXG01016022.1 2239 SGAQFVLTQPPSVSASPGGTVPITCARSSGSISGSRNSWYQRTPGRAPGTVIYTDTERPSGIPSRFSGSIDESANTATLTITGVQPDDEANYYCSAG
Crocodylus porosus V58 iglv JRXG01016022.1 5149 CGAQFVLTQLPLVSASPEGTVTVSCTRSSGSISSSYVSWYQQKPGSAPVLVIYEWSKRPSGIPSWFSGSTDSSSNMATLTITGVQADEEADYYCSSYDSNSN
Crocodylus porosus V57 ighv JRXG01013997.1 5277 ITLTQPGSASARPGESITLTCDTSGFDINYYHMHWIQESSGKGLVWMVAFRMGYDTYIANDFKGHVTPSTNGSTAKLQIVRLTAADTATYYCTRQ
Crocodylus porosus V55 ighv JRXG01008613.1 5972 AASAVQLVETGPGVVKPGETLMLTCTVSAQSITASSTYWNWIRQAPSTSLEWMGLINYQGGTSYNTALQSRTAISRDTSKNQFSLQLRSLTAADTATYYCAR
Crocodylus porosus V54 ighv JRXG01008612.1 1821 TQSQVWLAESGGGVQVPRGSLRLTCQTSGFNFIDYWMEWFRLSPDMGLQWVAEIRNAANNHADYYSNTVKGRFTVSRDDSNALLYLQMNDLKAEDTALYYCT
Crocodylus porosus V53 ighv JRXG01008609.1 1121 VWTQVQLVESGGDVKKPGNSLRLTCKASGFTFSSYGMHWVHQAPGKGLDWVAAISSSGSSQWYSPAVQGRFTISRDNSQNMLYLQVSSLKPEDTALYYCAK
Crocodylus porosus V52 trdv JRXG01007566.1 100 TASRALAQVSQPPRLMALEGGQLHIPCNHSFTPHQMMYWYPQPAQGQGSLIFLGSGYDGASPVGELTMAVHPASRSSNLSRDGARLQDAGIYYCATV
Crocodylus porosus V51 trbv JRXG01007038.1 1193 LLDARITQTQSLILRKRGTAELQCEQTYGHDQMFWYRQDLGLGLQLLFYFYYEKEREKGNISHRFTAAMSGPKVLRLNISSVEPQDSAVYFCASSA
Crocodylus porosus V50 trbv JRXG01007038.1 9437 LCSGVTVTQKKKFIAIQNGAGATLPCEHNDKDYITILWYRQKAGAGGELEFVARSVDKSSEEIEEKFQKSFKLKRENTLKASLEISGTAGDSAVYFCAASR
Crocodylus porosus V49 trbv JRXG01007038.1 27150 LCTGVTVTQQKFIAIKKGTTASLPCEHDDKSYYVILWYRQQEGTGGEMEFVARHADGNEVAEIEPKFKERFTLNRKNTLKASLDIRETTEDSAVYFCAASK
Crocodylus porosus V48 trbv JRXG01007038.1 33107 RLDAQISQTQSLVLKKGGLALLKCEQTYGHNAMFWYRQDLGQGPQMLFCFYHEKETERGNISHRLTAARFGKKVLHLNISAVQPQDSAVYFCASSL
Crocodylus porosus V47 trbv JRXG01007038.1 36556 LCSGVTVTQKKFIAIKKGTTASLPCEHNDSNNYAILWYRQQEGAGGELEFVAWQIKGNEAETETKFKERFKLKETNTLKYSLDIMLGVAEDSAVYFCAAT
Crocodylus porosus V46 trbv JRXG01007038.1 42866 LLDARISQTQSLVLKKGDLAQLKCEQTDGHNSMFWYRQDLGQGPHLLFYFYYGKESERGNISDRFTANMLGANVFHLNISVVEPQDSAVYFCASSA
Crocodylus porosus V45 trbv JRXG01007038.1 47123 VCTGVTVTQEKFVSIKTGTNASLHCEHNDSSYITILWYQQQEAARGQLEFVALHVDSNEAEIETKFKKRFKLTRTNTLKGSLEITGGTAEDSAVYFCAASKAQ
Crocodylus porosus V44 trbv JRXG01007038.1 50589 LLDARISQTQSLVLKKGDSAQLKCEQTDGHNSMFWYRQDLGQGPQLLFNFNYEKERERGNISDRFTADMSGANVFHLKITLVEPQDSAVYFCASSL
Crocodylus porosus V43 trbv JRXG01007038.1 59575 LCTGVTVTQTKFVTVRNGANASLPCEHDGNVDYNTILWYRQDRAAGNKLELVVRHTEGSTPETEAKFKGKYILQPKTRGKASLYIISGTAEVSAVYFCAASK
Crocodylus porosus V42 trbv JRXG01005725.1 1722 VISAVTLVESGPEVVKPGQILALTCTVSGVSISDASYAWNWIWQAPGKGLERVAEIYPYTGGTGFNPSLQSRTTISADKSKNQFSLQLRSLTAADTAMYFCASKTQ
Crocodylus porosus V41 trdv JRXG01005588.1 1034 GSSLEDKVTQQRADASRVERGAVTLDCTYETGESNYYLYWYKQSPGGSLVLLLWQHSAGSKRSEAGPRFTADFQQPQRSLRRRISDLQPSDSATYFCAFSR
Crocodylus porosus V40 ighv JRXG01005335.1 28446 QLLVSGPRTVKVSEPLTLTCAVSGKLITTTDFRGYWYQQFQGKGLKWMSLIDGAGATQYASSLQNRTKVSRDTSMNQFSLHLESPTTADTAMYYCALG
Crocodylus porosus V39 iglv JRXG01005222.1 979 VWSQAVVTQEPAVSVSPGGTVTLSCSLSTGAISTSNYPYWFQQKPGSAPQQLIYSTNKRPSGIPTRFSGAISGQKAVLTITGVQAEDEANYYCAVYTNSALW
Crocodylus porosus V38 iglv JRXG01005221.1 719 VWSQPVVTQEPVVSVSPGGTVTLSCSLSTGAITTSNHPGWLQHKPGSPPRLLIYDTNTRPSGLPTRFVGSISGQKAALTISRVQAEDEADYYCVVYIGG
Crocodylus porosus V37 iglv JRXG01005221.1 6079 VWSQAVVTQEPAVSSVSPGGTVTLSCSLSTGAITTSKYPYWFQQKPGSAPRQLIGGTNNRPSGIPTRFSGSISGQKSALTITGVQAEDEVDHYCIVWYSSGW
Crocodylus porosus V36 iglv JRXG01005221.1 7934 QSSQTALTQADPTLSVAPGQTATLRCTLQGVEFISSTNPAWYQQRPGSNPRLLIYQSRSRASGVPERFSADTSGNTALLTITGVQAEDEADYYCAAWDS
Crocodylus porosus V35 iglv JRXG01005220.1 11513 SGAQFVLTQPPSVSASPGGTVSITCARSSGSISGSWNSWYQQTPGRAPVMVIYKDTERPSGIPSRFSGSIDESANTATLTITGVQLDDEADYYCLTYDSNSN
Crocodylus porosus V34 igkv JRXG01111393.1 627 SLGEVVLTQTPETLVVSPGDRVTIKCKGSASSSNYIGWYLQKPGQAPKLLIYDSTSRVSGILDCFGGSGFVTDFTLTVSRVEAEDAGNYYCQQRQSSP
Crocodylus porosus V33 iglv JRXG01107294.1 39499 CDAGTVLTQPPLVSASPGGMIKISCTMSGASTGHCYVSWGQQKPAVAPVMLIYEDNKRPSDIAARFSGAVDSSADTTASTVTGVQAEDEGDYYRYTT
Crocodylus porosus V32 trav JRXG01102401.1 677 LGVQLQLHQPQPFLFVQVGGMAEIPCSSREDVEGGGNVHWYLRRAGEVPIHIKKCADGRNESRFACKHQKYNTTLEIRDIQRKDSGIYYCARA
Crocodylus porosus V31 trav JRXG01101978.1 77 AVRGDSVHPEKPLVTAAEGDTVTLRCNYKPSSSSSYYLYWYRQHPDQTLQYILRRGTKAYRGVRDNAAFAEQRFSSQASDSDTTLNITALELADTAVYHCA
Crocodylus porosus V107 ighv JRXG01102103.1 21211 VQSKIEFVASGGTVKMLGDSLRISCRTTGIDFNNFWLCWVRHIPGRGLQTVAYISKLAGDTVHYSDAVRGRFTISRDNPRQLLHLQMSNLRPEDAAEYYCLWM
Crocodylus porosus V106 igkv JRXG01094955.1 865 GCGDIALTQTPESLAVSAGDTVTIKCKASEYRGSSSMAWYQQKLGQAPKLLIYSSRPSRIPDWFSGSGSGTDFTVNINRVEAGDYYCQQHYSYP
Crocodylus porosus V105 igkv JRXG01090314.1 4149 TRVDTVMTQTPESLLVSPGDTVTLQCKACTSTGNTVAWHQQKPGQPPALLVYSSSSRPSGVPDWFSGTGNGNTDYSLTIRSVVPEDTRDYYCQQYSSRP
Crocodylus porosus V104 igkv JRXG01090313.1 2753 SLGEIVLTQTPETLVVSPGDRVTIKCKGSASSSNNICWYLQKPGQAAKLLIYDSTSRVSGIPDRFSGSGSGTDFTLTITTVEAEDAGDYYCQQRQSSP
Crocodylus porosus V103 trgv JRXG01086909.1 4097 LKQLQISITKQERKTAPIQCHVSGISLDSAYIHWYRQKPGKAPERILYLSSGKPVFDRDSDKGKFEAEKILSDSTCTLTIEQTSKDDAATYYCAYWA
Crocodylus porosus V101 trgv JRXG01086909.1 16214 GSAQVLKQTQLSITKAESKTIRIECHATVSDFGNAYIHWYRQKPGAPPERILYFSSQLHLDSDSDKEKFNAEKKIDKSLCILTIRRIASSDAATYYCATWT
Crocodylus porosus V100 trgv JRXG01086909.1 21803 AQMLKQSKSFITKGVHKTARIQCVVSGISLRSAYIHWYRQKPRNAPEWILYLSSGEPVIDQGFEKEKFEVDKDLTNSTCTLTVKQINKKDAATYYCAYWD
Crocodylus porosus V99 trgv JRXG01086909.1 28015 VLRAISVKQEQISITQPANLHSTVSISCKVNGGSASTYVHWYRALPGQALQRLLYLTLDGSNVKRDTGFSREKLTAIVRQSTCTLLVRKLEKTDSGHYYCAIWE
Crocodylus porosus V98 trgv JRXG01086909.1 31315 LLWAIGLEQEPGFIVKQSTLGSTARITCHVTGGSSSTLIHWYRVLPGQAPQRILYLSLSGDKLEQDIGSKDKFSAYGKQQACNFIVRNLKKTDSGDYYCATWDL
Crocodylus porosus V97 trgv JRXG01086909.1 35232 LLWAIRLEQTPRVIVQQSHSSSTAAFTCKITDGSSSTYVHWYRVLPGQAPQRLLYLTLDGSDMQRESGISWDKLTAFANPRVCTLEIYKLEKTDSGHYYCATWD
Crocodylus porosus V96 trgv JRXG01086909.1 37725 VLWAIKLDQDPPVIIQTAHRSSTAELICKVTGGSESRYIHWYRALPGEAPQRILYYSYSKPEPTLDDGIPKDKFTAYFQSKDTCKLIVHKLEKKDRGLYYCATWE
Crocodylus porosus V95 trgv JRXG01086908.1 483 GDAKGPTQFKLSITKKESKTALIECHVSGMGNTYIHWYQQKSGRAPERILYLSSGKNIFDKESSRGKFEAYGDPSKDTYALTVKQINKDDAATYYCAYWD
Crocodylus porosus V94 trdv JRXG01075853.1 1237 SSLEDKVTQRQEDASGVERGAVTLDCTYETGETDYYLYWYKQSPGGSPVFLLWQYSAGAEESAAGPRFTADFQKPQRSLRLRISDLQPSDSSTYFCAFSR
Crocodylus porosus V93 trgv JRXG01072537.1 2903 GVSEVRLDQWGTQLVKPTESASLTCAVYGAALWDHAWSWVRQRPGKGLEWLGLIQGNGNLHYNPTFRNQITITKDNSKNQVYLQLNNMEAADTATYYCARVAE
Crocodylus porosus V92 trbv JRXG01071662.1 35 VTVTQKKKFITIQNGASAILPCEHNDNSYLAILWYWQKAGAGGVLEFVARSVDNNPAEIKEKFKISVKLKRENTLKASLEISGTAGDSAVYFCAASR
Crocodylus porosus V91 trdv JRXG01066799.1 2267 AARWALAQVSQPPQLMVLEGGQLHIPCNHSFTPHQTMYWYQQPTLGQGTLILLGSRYDGASPAGELTMAVYPASRSSNLSRDGARLQDAGIYYCAVR
Crocodylus porosus V90 trav JRXG01066798.1 246 RAQQDSVSQSPSALVIPAGHTATLSCSFSTSDIYPFLFWYRQHPNSPLEMLMQLNEAEWRKQAGRLSAELHVGNSSGWLAIQGTTLQDSAGYLCALS
Crocodylus porosus V89 trdv JRXG01066797.1 960 AARWALAQVSQPPWLTVLEGERLHISCNQTVTGHNVMFWYLQSLEDGGALRFLGSGYDEVSAVGELTLTVEKATRSTRLSQDSARLHDSGTYYCAVR
Crocodylus porosus V88 trav JRXG01059424.1 24 SLGTAQILQPPSAEALEGAPLSLTCEHSSITPGDYIHWYRLFHNRGLQYIVSGVEDTAPVSSLAGALHISADRKSSALALRAAGRGDAGVYYCAVG
Crocodylus porosus V87 ighv JRXG01058219.1 344 AVSAVTLIESGLGVVKPGQTITLTCKVSGESLTHGNAWTWIRQPPGQGLQWIGCTYYSSFRWYTDYASSLQGRVTISADTSQNQVSLQLQSLTAADSAMYYCARDTA
Crocodylus porosus V86 trdv JRXG01053347.1 1411 SSLEDKVTQRQEDASGVERGAVTLDCTYETGETDYVLYWYKQSPGGSLVLLLWQDSGGSKRSEAGPRFTAYFQKRQRSLPLSISDLQPSDSATYFCAFSR
Crocodylus porosus V85 iglv JRXG01051284.1 2080 VWSQPVVTQEPLASSVSPGGTVTLSCTLSTGAITTSNNPAWYQQKPGSPPRLLIYSNNSRPSGIPTRFSGSISGQKATLTIAGVQAEDEADYYCSVWCSSG
Crocodylus porosus V84 iglv JRXG01051282.1 168 SFSQIALTQPSSESVSLGNTIKLSCTLSVGGTFGDVSWFQQKVGNSPRYLLRYNTDSDKHQGSGVPSRFSGSKDTSNKIGYLTITNVQAEDEADYYCA
Crocodylus porosus V83 iglv JRXG01051282.1 4394 SFSQFTLTQPSSGSVSLGNTVKLSCTISSGKTLGGVVWIQQKDGNSPRYLLMYNSDSDKHQGSGVPSRFSGSKDTSSTTGYLTITSVQAEDEADYYCA
Crocodylus porosus V82 iglv JRXG01051069.1 2765 VSAQPVLTQEPSVSVSPGGTVTLSCSLSTGAMTSSNYRGWYQQKPGSAPQLLMSDNNTRPSGIPTRFSGSLSGQKATLTITGAQIEDDADYYCKVWTESA
Crocodylus porosus V81 ighv JRXG01050797.1 5318 AMSAVTLVESGPGVVKPGQTLTLTCKVSGESLTHGNAWTWIRQPPGQGLQWIGHNDYSGFRWYTDYASSLQGRVSILTDTSQNQVSLQLQSLTAADSATYYCARDTA
Crocodylus porosus V80 trbv JRXG01047109.1 1391 FCSIYVKQPPFLTRIPKEHTSLQCTLIQTSYSYMFWYRQREGRELEALFYSAGEGSESSFTKEPMEANRSGNDWTLTWKSLSHSDSAVYYCACSY
Crocodylus porosus V79 trav JRXG01047108.1 12 FGSIYVEQPLFLTGVPRATTSLQCTLFKTSHYNMFWYRQREGRELEALFYSAGEGSESSYTKEPMEAKRSGNDWTLTWKSLSHSDSAVYYCACSD
Crocodylus porosus V78 iglv JRXG01045600.1 4420 SLAQYVLTQPPAASVSPGQTARLTCTGTSLGSYYVQWFQQKPGSAPLQLIYQDSKRPSGIPDRFSGATSGDTATLTITGVQAQDEADYYCQIWHSSSKQ
Crocodylus porosus V77 iglv JRXG01045600.1 7334 SLAQYVLTQPPAASISPGQTAWLTCTGTGLGTYYVQWFQQKPGSAPLRLIYWNSKRPSSIPDRFSGATSGDTATLTITGVQAQDEADYYCQIWHSSSKQ
Crocodylus porosus V76 iglv JRXG01045599.1 1610 LFAQNVVTQPPAVSVSPGQTAQLTCSGPGSYMHWYQQKPGSAPILIIYDNTKRPSGISDRFSGSKSGNTAMLTITGVQAQDEADYYCSMWVSSSAQ
Crocodylus porosus V75 iglv JRXG01039097.1 2675 SLAQYVLTQPPSASVSPGETARLTCSGSNLGNKYVHWYQQKPGSAPLLIIYRDSSRPSTIPDRFSGANSGGTATLTITGVQAQDEADYYCSAYDSNKG
Crocodylus porosus V74 trgv JRXG01036672.1 1032 GDSQVLRQSQTSVTRGVRKTARIQCHVSTMSFSSAYIHWYRQLPEESPERILYFSSEKPVYDRDSDKRKFEAEKELMESTCTLTIKTVNQNDSATYYCTYWD
Crocodylus porosus V73 trgv JRXG01036672.1 2836 GSGQVLKQTEPSITKAESRTIRINCYVDSSVFGTAIIHWYRQRPGAAPERILYFSSDLYLDQDSDKRKISAEKDFDLSRCVLTINSLTSSDTATYYCATWT
Crocodylus porosus V72 trgv JRXG01036671.1 4515 ALELTQSEPSKTRGKTRTALIKCQVTGTTAVMHWYRHKPGEGPERILYWSAGKVVYDKESDKKFSARQESNKNVYSLTIDDISSDDAAMYYCASWDD
Crocodylus porosus V71 trgv JRXG01036671.1 9548 GSIGVTLTQSPSSTTRTVGTTARMKCVFTNFTGAFASAAIHWYQQSPGEAPKRVLYFISGDAAVDDQSQKSRFTVEKDSSKHTCTFNINSATKTDTGVYYCAYWD
Crocodylus porosus V70 trgv JRXG01036671.1 17327 ITITQTPEFTVKRENAAVRMSCVLQGISENIASAIIHWYHQSPGEAPKRVLFYTSGKTTFDDNSQANNLQVTIDPAKSRYTFYVNRIKKMHAGIYYCAYWY
Crocodylus porosus V109 trgv JRXG01106634.1 57 GVSEVRLDQWGTQLVKPTESASLTCAVYGAALRDRAWSWVRKRPGKGLEWLGHIHENGNLHYNPTFRNRISITRENSKNQMYLQLNNMEAADTATYYCATVAG
Crocodylus porosus V110 trdv JRXG01108374.1 4757 GSSLEEKVTQRQEDASGVERGAVTLDCTYETGETDYYLYWYKQSPGGSLVFLLLQSSQGGKQNAAGPRFTADFQKPQRPLHLRISELQLSDSATYFCAFSR
Crocodylus porosus V108 ighv JRXG01106634.1 1526 VQSQYQLHESGPGVLKPGETLSLTCTITSGTVTNSSWWNWVRQTPGKGLEWMGWWSGSTHYNTHFQNRITISVDSSRTKYYLWLSSLITADTSTYYCARDTV
Crocodylus porosus V102 trgv JRXG01086909.1 10599 LKQLQISITKQERKTAPIQCHVSGISLDSAYIHWYRQKPGKAPERILYLSSGKPVFDRDSDKGKFEAEKIPTASICTLTVRRISKDDAATYYCAYWD
Crocodylus porosus V69 trgv JRXG01036671.1 21848 GDAQVLKQSQSSIVRGVHKTARIECHVSGISFSNAYIHWYRQKPSEAPERILYLSSGRPSFDKESDKEKFEAKKNINDNTCTLTLNKIRTEDAATYYCACWD
Crocodylus porosus V56 ighv JRXG01008613.1 18 VLSQVTLKESGPGVVKPGETLTLTCTISVDSVTNNYWDWFRQAPGKGLEWIGEIDQYSSTWRKSYNPSLQSRTTLFADKSRNQFSLQLSSLMATDTAMYYCAR