WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Colobus angolensis palliatus JYKR00000000.1 (JYKR01) 211 44 34 27 44 51 7 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Colobus angolensis palliatus V138 trav JYKR01054659.1 27823 MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVSWEQQDQLLAICNADLGWHISPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCIYHTYPDGT
Colobus angolensis palliatus V145 trbv JYKR01058767.1 52821 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVIFFNNNISEKSEIFDDRFSVGRSDGLNFTLKIKPTKLEDSAMYFCASSE
Colobus angolensis palliatus V146 trbv JYKR01058767.1 59827 PLDTAVSQTPKYLVTQTGKKESLKCEQNLGHDAMYWYKQDSKKLLKIMFSYNNKELIINETVPNRISPESPDKAHLILHIKSLELGDSAVYFCASSQ
Colobus angolensis palliatus V147 trbv JYKR01058767.1 64434 PIDTGVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPEIMFIYNYEKLSINESVPSRFSPECSKSSLLNLHLQALQPEDSALYLCASSQ
Colobus angolensis palliatus V148 trbv JYKR01058767.1 72563 HTEPEVTQTPSHQVTQMGQEVILWCVPIPNHLYFYWYRQILGQKVEFLVYFYNDKISEKSEIFDDRFSVGRPDGVHFTLKINSTKLEDSATYFCASSE
Colobus angolensis palliatus V149 trbv JYKR01058770.1 2480 PLDTAVTQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVSNHFSPDSPDKAHLILHIKSLELGDSAVYFCASSQ
Colobus angolensis palliatus V150 trbv JYKR01058772.1 5668 HTEPEVTQTPSHQVTQMGQELILRCVPISNHLYFYWYRQILGQKVEFLVSFVNDNISEKSEIFDDRFSVGRPDGSNFTLKIKSTKLEDSATYFCASSE
Colobus angolensis palliatus V151 trbv JYKR01058772.1 12169 PLDTAVSQTPKYLVTQTEKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPNSPDKAHLILHIKSLELGDSAVYFCASSQ
Colobus angolensis palliatus V152 trbv JYKR01058772.1 16501 PTDTGVTQTPKHLVMGMTKKKSLKCEQHLGHNAMYWYKQKAKKSLELMFIYNYEKLFLNESVPSRFSPECSKSSLLYLHVRALQPEDSALYLCASSQ
Colobus angolensis palliatus V153 trbv JYKR01058772.1 29220 PVEAEVTQTPRSLIKMRGQQVTLSCSPISGHRSVSWYQQTPGHGLQFLFEYFSETQREKGNFPSRFSGRQFSNSHSEMNVSALELGDSALYLCASSL
Colobus angolensis palliatus V154 trbv JYKR01058772.1 36707 PASAGVTQSPKFQILKTGQSTTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSATEDTTDTGEVPNGYSVSRLNKKDFLLKLESAAPSQTSVYFCASSE
Colobus angolensis palliatus V155 trbv JYKR01058772.1 50145 PLDTAVSQTPKYLVTQTGKKESLKCEQNLGHNAMYWYKQDYKKFLKIMFIYNNKEPILNETVPNRFSPDSPDKAHLNLHIKSMELGDSAVYFCASSQ
Colobus angolensis palliatus V156 trbv JYKR01058772.1 53574 PMETGVRQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKANKPPELMFVYNFKERAENNSVPSRFSPECPDSSHLYLHVRTLQPEDSALYLCASSQ
Colobus angolensis palliatus V157 trbv JYKR01058772.1 63875 SVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDRMYWYRQDPGMGLRLIHYSVGEGSTDKGEVPDGYSVSRSNPQNFPLRLESAAPSQTSVYFCARSE
Colobus angolensis palliatus V158 trbv JYKR01058772.1 67926 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERLEGSVSTLKIQPTQQGDSAVYLCASSL
Colobus angolensis palliatus V159 trbv JYKR01058773.1 1183 HTGAGVSQSPRNKVTEKGKDVALRCDPISGHTVLYWYRQNLGQGLEFLIYFQGTGAVDDSGLRSDRFSATRPEGSDSTLKIQRTEQGDSAMYFCASSL
Colobus angolensis palliatus V160 trbv JYKR01058773.1 6543 PVQAGVTQSPTHLIKRRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFEYANELRRSEGNFPDRFSGRQFRNYHSEMNVSALELRDSALYLCASSL
Colobus angolensis palliatus V161 trbv JYKR01058773.1 9204 SVDSGVTQTPKHRITATGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQFYNGEERAKGNILERFSAQQFPDMQSELNLSSLELGDSALYFCASSV
Colobus angolensis palliatus V162 trbv JYKR01058773.1 10836 HRDAEITQSPRYKITETGRQVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGDVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Colobus angolensis palliatus V163 trbv JYKR01058773.1 20504 FTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQNEGVVDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Colobus angolensis palliatus V164 trbv JYKR01058775.1 7550 HRDARITQSPRYKVTETGRQVTLTCHQTWSHRDMFWYRQDLGHGLRLIHYSAGAGITDKGEVPDGYVVSRSKTEDFPLTLESATHSQTSVYFCASSE
Colobus angolensis palliatus V165 trbv JYKR01058776.1 4805 LTEAGVAQSPRYKVIEKSQAVTFWCNPISGHAILYWYQQMLGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAKLGDSAMYLCASSL
Colobus angolensis palliatus V166 trbv JYKR01058776.1 20038 PVNAGVTQTPKFQILKTGQSTTPQCAQDMNHDSMYWYRQDPGMGLRLIHYSVGAGVTDKGEVSNGYSVSRSNIEDFPLRLESAAPSQTSVYFCASSY
Colobus angolensis palliatus V167 trbv JYKR01058776.1 24228 HTGAGVSQSPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLIYFWNDAQQDKSGLPSGRFSAERPEGSVSTLKIQRTEQGDSAVYLCASSL
Colobus angolensis palliatus V168 trbv JYKR01058777.1 1075 PVDTGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALSQGPQFIFQYYEEKERERGNFPDRFSGHQFPNYSSELNVNTLGVGDSAQYLCASSL
Colobus angolensis palliatus V169 trbv JYKR01058777.1 4367 LVNAGVTQTPKFQVLKTGQSMTVQCAQDMNHNFMYWYRQDPGTGLRLIHYSGAAGTTDKGEVPSGYNVSILNTEVFPLRLESAAPSQTSVYICASSY
Colobus angolensis palliatus V170 trbv JYKR01058777.1 8997 HTGAGVSQSPRYKVSKRGQEVALRCDPISGHAALYWYQQALGQGPELLTYFSYEAQQDKSGLPSGRFSAERPEGSASTLKIERTQQGDSAVYLCASSL
Colobus angolensis palliatus V171 trbv JYKR01058777.1 29194 HTGAGVSQSPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFQNDDQLDKSGLPSGRFSAERPEGSASTLKIQRTEQGDSAVYLCASSL
Colobus angolensis palliatus V172 trbv JYKR01058777.1 37606 PVEPGVTQSPTHLIRTRGQQVILRCSPISGHSSVSWYQQALGQGPRFIFEYYKEEERERGNFPERFSGRQFPNYSSELNVNTLEMGDSALYLCASSL
Colobus angolensis palliatus V173 trbv JYKR01058777.1 45046 PGNADVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIYYSVGAGITDIGEVPNGYNVSRLNTEDFPLRLESAALSQTSVYFCASS
Colobus angolensis palliatus V174 trbv JYKR01058777.1 57464 SVDAGVTQSPTHLIKMRGEQVTLRCSPISGHSSVSWYQQALGQGPRFIFEYYEKEERGRGNFPDRFSGLQFPNYSSELNVNALLLGDSALYLCASSL
Colobus angolensis palliatus V175 trbv JYKR01058777.1 64732 PVNAGVTQTPKFQVLKTGQSMTVQCAQDMNHDYMYWYRQDPGMGLRLIYYSVTAGITTKGEVSNGYNASRINTEDFLLRLESAAPSQTSVYFCASSY
Colobus angolensis palliatus V176 trbv JYKR01058777.1 69352 HTGAGVSQSPRYKVTKKGQDVSLRCDPISGHEALYWYQRALGQGPKFLTYFNYDAQPDKSGLPNDRFSADRPEGSVSTLTIQRTEQRDSAVYLCASSL
Colobus angolensis palliatus V177 trbv JYKR01058777.1 78100 SVDAGVTQSPTYLIKTRGQQVTLRCSPISGHNTVSWYQQALGQGPQLIFQYYREQERGRGNFPDRFSGHQFPNYSSEMNVSALLLADSALYLCASSL
Colobus angolensis palliatus V178 trbv JYKR01058777.1 94276 SVAAGVIQAPRHLIKVKGETATLQCYPIPEHNTVYWYQQGPGQGPQFLISFYEKMERDKGSISDRFSAQQFSDYHSELNMSSLELGDSALYLCASSL
Colobus angolensis palliatus V179 trbv JYKR01058777.1 102049 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGHGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Colobus angolensis palliatus V180 trbv JYKR01058777.1 113166 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENKEAVDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Colobus angolensis palliatus V181 trbv JYKR01058777.1 118739 HTDAGVIQSPRHEVTQMGKEVTLRCEPISGHTYLFWYRQTMMRGLELLIYFNNKSPIDDSGMPKDRFSAKMPDASFSTLKIQPSEPRDSAVYFCASSL
Colobus angolensis palliatus V182 trbv JYKR01058779.1 3777 LIDAGVTQIPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASAL
Colobus angolensis palliatus V183 trbv JYKR01058779.1 10457 RIEAGVTQFPSHRVIEKGQTVTLRCDPISGHDYLYWYRCVIGKEIKFLIYFLSASMQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Colobus angolensis palliatus V184 trbv JYKR01058779.1 15561 HGDVMVIQNPRYQVTQSGRPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Colobus angolensis palliatus V185 trbv JYKR01058779.1 19876 SPGEEVTQTPKHLIKGEGQKAKLYCAPITGHSYVLWYQQVLKKEFKFLISFQNEYVVDETGMPKERFSAKCPRNSPCSLEIQATKLKDSATYFCASRQ
Colobus angolensis palliatus V186 trbv JYKR01058783.1 1312 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSYVYWYRQLPEEGLKFMVYLQREKIIDESGMPKERFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Colobus angolensis palliatus V187 trbv JYKR01058784.1 2244 TVNGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDAGQGLRLIYYSQIVNDIQKGDIVEGYSVSRERKESFPLTVTPAQRNPTAFYLCASSI
Colobus angolensis palliatus V188 trbv JYKR01058784.1 10049 GSGLGAVVSQYPSRVICKRGTSVKIECRCLDFQATTMFWYHQFRKQSLILMATSNEGSSVTYEQGIKQDKFLINHPNLTFATLTVTNAHPEDSSFYICSAR
Colobus angolensis palliatus V189 trbv JYKR01058784.1 20108 STDTKVTQRPRLLVKANEQKAKMDCVPIKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINERFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Colobus angolensis palliatus V190 trbv JYKR01058786.1 3610 SMDADVTQTPRNTIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVKDVNKGEISDGYSVSRQEQAKFSLSLESATPNQTALYFCATSD
Colobus angolensis palliatus V191 trbv JYKR01058786.1 12091 LMEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Colobus angolensis palliatus V192 trbv JYKR01058786.1 42337 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHDYMSWYRQDPGLGLRQIYYSINVEVVDKGDISEGYTVSRKEKRNFPLILESPSPSQTSLYLCASSL
Colobus angolensis palliatus V193 trbv JYKR01058786.1 47980 LVDVKVTQSSRHLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKVNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Colobus angolensis palliatus V194 trbv JYKR01058788.1 4955 SVFSAVISQKPSRDICQRGTSVTIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYEGGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Colobus angolensis palliatus V223 trav JYKR01067803.1 158963 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Colobus angolensis palliatus V237 trgv JYKR01073424.1 900 SQKSSNLEGKMKTITRPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPERLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNPIENDSGVYYCATWD
Colobus angolensis palliatus V238 trgv JYKR01073425.1 2684 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEFSSFYIVHWYLHQEGKAPQRLLYYDVSNSRVVLESGISPGKYDTYVSTRRNLRLRLRNLIENDSGVYYCANWD
Colobus angolensis palliatus V239 trgv JYKR01073425.1 7037 SQKSSNLEGRTKSVTRPTGSSAEITCDFSGDSNLYIHWYLHQEGKAPQRLLYYDVSNSRDVLESGLSLGKYGTHTRTRWSWILILRNLIENDSGVYYCANWD
Colobus angolensis palliatus V240 trgv JYKR01073429.1 5204 EQFQLSVSTEVKKSIDIPCKIWSTNFENDVIHWYWQKPNQALEHLIYIISTKSAVQGSMGKRSNKVEARKNSQTLTSILTIKSVEKEDMAIYYCAGWD
Colobus angolensis palliatus V241 trgv JYKR01073430.1 10631 TNGDNLIAQLVTSVTKKKGNTAFLECQIKSSTFQKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Colobus angolensis palliatus V242 trgv JYKR01073430.1 12645 GDTKMRISQDQLSSTRRQGRTVHIRCKLSGVLLEKTVVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Colobus angolensis palliatus V275 iglv JYKR01083611.1 1503 SLSQPVLTQPPSLSASPGASARLSCTLSSGFGADFYWIYWYQHKPGSPPRYLLSHYQISLHDQGSGVPRRFSGLMEGWSNKGLLLVSDLQPEDEADYYCMI
Colobus angolensis palliatus V276 iglv JYKR01083810.1 7058 VDSETVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRMLIYSTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYMGSGI
Colobus angolensis palliatus V277 iglv JYKR01083814.1 2009 SLSQPVLTQPPSLSASPGASARLTCTLSSDINVNAKSISWYQQKPGSNPRYLLSYYSDSVKHQGYGVPSRCSGSKDASTNSGILHISGLQPEDEADYYCKIWHD
Colobus angolensis palliatus V278 iglv JYKR01083815.1 1242 SLSQLVLTQSFSANASLGSSVKLTCALSSGHSSYTIAWHQQQQPGKTPQYLMDLQSSGSYNKGSGIPDRFSGSSSGAERYLTISNLQSEDEADYYCHTWDTA
Colobus angolensis palliatus V279 iglv JYKR01083822.1 27333 SWANFMLTQPHSVSGSVGQKVVISCTRSSGSIGSYYVQWYQQRPGSTPTTVIYDDNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSYDSGD
Colobus angolensis palliatus V280 iglv JYKR01083834.1 781 SWAEVVFTQPHSVLGSPGQTVTISCTRSSGSIDSSYVYWYQQRLGSAPTTVIYKNNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSVDDSYN
Colobus angolensis palliatus V281 ighv JYKR01083871.1 113 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSNYWMYWVRQAPGKGLEWVSAINTGGGSTYYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Colobus angolensis palliatus V410 ighv JYKR01138164.1 4797 VWSQVTLKESGPALLKPTQTLTLTCTFSGFSISTSGIGVGWIRRPPRKALEWLALIYWDEDKRYSPSLKSRLTISKDTSKNQVVLTMTSMDPVDTATYYCARR
Colobus angolensis palliatus V426 ighv JYKR01145775.1 2615 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYISSTSGTIYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTAVYYCAR
Colobus angolensis palliatus V427 ighv JYKR01145779.1 14761 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYGWSWIRQPPGKGLEWIARIYGSSGSTYYNPSLKSRVTISIDTSKNQFSLKLSSVTDTDTAMYYCAR
Colobus angolensis palliatus V428 ighv JYKR01145779.1 30268 VQCEVQLVESGGGLAKPGGSLRLSCVASGFTFSSYYMSWVRQAPGKGLEWVSDINSGGGSTRYADSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAK
Colobus angolensis palliatus V429 ighv JYKR01145780.1 12466 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYWWGWIRQSPGKGLEWIGHIHYSGSKYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Colobus angolensis palliatus V430 ighv JYKR01145780.1 25696 VQCEVQLVESGGGLVQPAGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSYINSDGSSTSYTDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Colobus angolensis palliatus V431 ighv JYKR01145780.1 33579 VQCEVQLVESGGGLVQPDGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYATGYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
Colobus angolensis palliatus V432 ighv JYKR01145780.1 41413 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVALIKNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTVDTAVYYCA
Colobus angolensis palliatus V433 ighv JYKR01145781.1 10011 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVSRISSGSGGSTWYPDSVKGRFTISRDNAQNTLYLQMNSLQAEDTAVYYCAR
Colobus angolensis palliatus V434 ighv JYKR01145781.1 17511 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSDYDMNWVRQAPGKGLEWVGRIKNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Colobus angolensis palliatus V435 ighv JYKR01145781.1 34312 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSSYEMHWVRQAPGKGLEWVSVIGGDSSYIHYADSVKGQFTISRDNAKNSLSLQMNNLRAEDTAVYYCAR
Colobus angolensis palliatus V436 ighv JYKR01145781.1 40573 IQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGNSDLIWIRQAPGKGLQWVSVISKSGSIIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Colobus angolensis palliatus V437 ighv JYKR01145781.1 54458 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVSWIRQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Colobus angolensis palliatus V438 ighv JYKR01145783.1 6490 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMSWVRQAPGQRLEWIGWINTNTGNPTYAQGFKERFAFSMDTSISTAYLQISSLKAEDTAMYYCAR
Colobus angolensis palliatus V439 ighv JYKR01145783.1 38607 AHSEVQLVQSGAEVRKPGATVKISCKASGYTFTDYYLDWVRQAPGKGLEWMGAVDPEDGEANYAQKFQGRVTMTADTSTDTAYMELSSLRSEDTAVYYCAR
Colobus angolensis palliatus V440 ighv JYKR01145783.1 46397 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVSRISSGSGGSTWYPDSVKGRFTISRDNSKNTLYLQLNSLRAEDTAVYYCA
Colobus angolensis palliatus V441 ighv JYKR01145785.1 6849 VLSQVQLQQWGEGLVKPSGTLSLTCAVSGGSISSYWWSWIRQPPGKGLEWIGEINGSGGSTNYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCTR
Colobus angolensis palliatus V442 ighv JYKR01145786.1 4106 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMDWVRQAPGKGLEWVAVIRYDGSKKYYADSVKDRFTISRDNSKNTLYLQMNNLRVEDTAVYYCAR
Colobus angolensis palliatus V443 ighv JYKR01145787.1 6643 VQCEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYDMHWVRQAPGKGLEWVSVISTSGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCAR
Colobus angolensis palliatus V444 ighv JYKR01145787.1 11283 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQSPGKGLEWIGHIDNSGSKYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Colobus angolensis palliatus V445 ighv JYKR01145788.1 1871 VWSQVTLKESGPALVKPTQTLTLTCTFSGFSISTSGTGVGWIRQPSGKALEWLASIYWNDSKDYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAGV
Colobus angolensis palliatus V446 ighv JYKR01145790.1 2870 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMSWVRQAPGKGLEWVSGISWNGGSTGYADSVKGRFTISRDNAKNSLYLQMGRLTAEDTALYYCAKD
Colobus angolensis palliatus V447 ighv JYKR01145796.1 8767 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYYWSWIRQPPGKGLEWIGHIYGGSASTNYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Colobus angolensis palliatus V448 ighv JYKR01145814.1 2631 AQSQVQLVQSGAEVKKPGASVKVSCKASGYTFSIYAISWVRQAPGQGFEWMGVIVPVAGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Colobus angolensis palliatus V449 ighv JYKR01145828.1 3646 VQSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYIPWVRQAPGQGLEWMGWINPSSGSTGYAQKFQGRVTMTRDTSTSTAYMELSSLTSEDTAVYYCAR
Colobus angolensis palliatus V450 ighv JYKR01145828.1 23535 AQSQVQLVQSGAEVKKPGASVKVSCKASGFTFGSDAISWVRQAPGQGLEWMGWIIPVVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Colobus angolensis palliatus V451 ighv JYKR01145838.1 8567 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWGWIRQPPGKGLEWIGYIHSGGSTYYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCAS
Colobus angolensis palliatus V452 ighv JYKR01145838.1 19722 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMDWVRQAPGKGLEWVAVIWYDGSQKYYADSVKDRFTISRDNSKNTLYLQMNNLRLEDTAVYYCAK
Colobus angolensis palliatus V454 ighv JYKR01146533.1 22523 AQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSDYAMHWVRQAPGKGLEWVGRIKNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMNNLKTEDTAVYYCA
Colobus angolensis palliatus V455 ighv JYKR01146533.1 33593 AVGGVWGRLGPAGVSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVSRISSGSGGSTYYPDSVKGRFTISRDNSKNTLYLQMNNLRAEDTAVYYCA
Colobus angolensis palliatus V484 ighv JYKR01164724.1 4455 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSCITNGGGSIYYADSVKGRFTISRDNSKNTLSLQMNNLRLEDTAVYYCAK
Colobus angolensis palliatus V485 ighv JYKR01164729.1 525 AQSQVQLVQSGAEVRKPGDSVKVSCKASGHTFTNHNMDWVRQAPGQGLEWMGGINTNTGGTSCAQTFQGRVTMTRDTSTSTAFMELSCLRSEDTAVYYCAR
Colobus angolensis palliatus V486 ighv JYKR01164731.1 130 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMDWVRQAPGKGLEWVSAINSGGSSTWYADSVKGRFTISRDNSKNTLYLQMNNLRLEDTAVYYCAR
Colobus angolensis palliatus V487 ighv JYKR01164735.1 1001 VQCEVQLVESGGGLVQPGGSLRLSCAASRFTFSDHYMEWVCQVPGKGLQWAGQVNPNGDTTFLMDSVKGRFTISRDNAKNTLCLQMNSLKTEDTAVYYCAR
Colobus angolensis palliatus V488 ighv JYKR01164735.1 4987 VQCEVQLVESGGGFVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGPEWVSDISGSTIYYADSVKGRFPVSRDNAKNSLSLQMNSLRAEDTAVYYCAR
Colobus angolensis palliatus V489 ighv JYKR01164735.1 10403 VWSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGIGVGWIRQPPGKALEWLAHIYWDDGKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAQI
Colobus angolensis palliatus V490 ighv JYKR01164738.1 3941 AHSQVQLVQSGAEVKKPGASVKVSCKASGFTLDSYAISWVRQAPGQGLEWMGVIIPDYDVTNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Colobus angolensis palliatus V491 ighv JYKR01164740.1 929 AHAQVQLVQSGAEVKKPGSSVKVSCKASGYTFTSSAMQWVRQAPGQGLEWIGAIIIGNGNTGYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAA
Colobus angolensis palliatus V492 ighv JYKR01164750.1 753 VLSQVQLQESGPGVVKPLETLSLTCAVSGGSISSYRWGWIRQPPGKGLEWIGYIVGSSGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTDTDTAVYYCAR
Colobus angolensis palliatus V531 igkv JYKR01182071.1 1066 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQTPRLLIYGASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYYCQQDNSWP
Colobus angolensis palliatus V532 igkv JYKR01182071.1 11794 ARCDIQMTQSPPSLSASVGDRVTITCQASQGISNYLAWYQQKPGKAPKLLIYDASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYKSTP
Colobus angolensis palliatus V533 igkv JYKR01182071.1 29957 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSNP
Colobus angolensis palliatus V534 igkv JYKR01182071.1 45476 TTGETVVTQSPATLSLSPGERVTLSCRTSQSVGSYLAWYQQKPEHSPRLLIYGASNRATGIPARFSGSGSGTDFTLTISSLEPEDVGVYYCQQYSNLP
Colobus angolensis palliatus V535 igkv JYKR01182073.1 21636 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFYGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAANYYCLQSKNFP
Colobus angolensis palliatus V536 igkv JYKR01182078.1 1873 SNGEIVLTQSATSMAVSQGERVTICCMASSSVSTSNLQWYQQKPGFPPRLLAYRTSSLASGVPARFSGCGSGTSYTLTIGSMEAEDAANYYCQHWNNI
Colobus angolensis palliatus V537 igkv JYKR01182079.1 4965 SNGEIVLTQSPTSMAVSQEERVTISCTASSSVSTSNLQWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQHWNNI
Colobus angolensis palliatus V544 iglv JYKR01183730.1 1168 SWAEVVFTQPLSVLGSPGQTVTISCTRSSGSIDSSYVYWYQQRLGSAPTTVIYKNNQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSVDDSYN
Colobus angolensis palliatus V555 trdv JYKR01187826.1 89025 RGRLCDKVTQSFPDRMVVNGSEVVLLCTYDSTYSNPDLFWYRIRPDYTFQFVFYGDKSRSQGAYFTQGRFSVKHLLTQKAFHLVISPVRTEDSATYYCAM
Colobus angolensis palliatus V570 iglv JYKR01193531.1 1121 SLSQPVLTQPASLSASPGASASLTCTLRSGINVGGYTIHWYQQKPGSPPRYLLKYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSKDEADYYCSI
Colobus angolensis palliatus V571 iglv JYKR01193536.1 1540 SSSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPHWFQQKPGQAPKTLIYDTSNKLSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSDA
Colobus angolensis palliatus V652 trgv JYKR01030314.1 1111 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCILYDGTVRKESSIPSGKFEVDRIPKTSTSTLTIHNVQKQDIATYYCALWE
Colobus angolensis palliatus V714 trbv JYKR01058802.1 27809 VRSQTVHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVNQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Colobus angolensis palliatus V817 igkv JYKR01111704.1 432 TTGQIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYFCQQYSNWN
Colobus angolensis palliatus V818 igkv JYKR01111706.1 42239 TTGQIVMTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKPGQAPRLLIYGASSRATGIPARFSGSGCGTEFTLTISSLEPEDVGVYYCQQDYSWP
Colobus angolensis palliatus V819 igkv JYKR01111707.1 17244 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNNLAWYQQKPGKAPKLLIYYATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQHNSYP
Colobus angolensis palliatus V820 igkv JYKR01111707.1 10794 ARCDIQMTQSPSSLSASVGDTVTISCRASQGISSWLAWYQQNPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQHNSYP
Colobus angolensis palliatus V821 igkv JYKR01111714.1 20355 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTEFILTISSLQPEDFAAYYCQQYNSNP
Colobus angolensis palliatus V822 igkv JYKR01111714.1 1043 TTGAIVMTQSPATLSLSPGETTTLSCRTSQSVSSKLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGIDFTLTISSLEPEDFAVYYCQETSNLF
Colobus angolensis palliatus V860 iglv JYKR01125408.1 48138 SAASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISEAQVEDEADYYCYSTDSSGN
Colobus angolensis palliatus V861 iglv JYKR01125408.1 37033 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVFWYQQHPGTAPKLMIYDVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYSSSYY
Colobus angolensis palliatus V862 iglv JYKR01125408.1 19997 LCALPVLTQAPSASASLGASVKLTCTLSSGHSSYTIAWYQQQPEKAPRYLMKLDSDGSHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Colobus angolensis palliatus V863 iglv JYKR01125408.1 10552 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGSYNIVSWYQQHPGTGPQLMIYRVSYRPSGVPDRFSGSKSGNTASMTISGFQVEEEADYYCYS
Colobus angolensis palliatus V864 iglv JYKR01125410.1 14119 SWAQSALTQPPSVSGSPGQSVTISCTGTSNDVGSYNSVSWYQQHPGKAPKLVIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSGT
Colobus angolensis palliatus V865 iglv JYKR01125421.1 15473 SWAQSALTQPPSVSGSAGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSKRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Colobus angolensis palliatus V866 iglv JYKR01125421.1 8249 SEASYELTQPPSVSVSPGQTARITCSGDTLAKRYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCQSADSSGNH
Colobus angolensis palliatus V867 iglv JYKR01125423.1 18785 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNRVSWHQQHPGTAPRLLIYSVSNWPSGISERFSGSNSGNTASLTISGLQAEDEADYYCCSYRSGSI
Colobus angolensis palliatus V868 iglv JYKR01125423.1 7494 SAASYELTQPPSVSVSPGQTARITCGGDNIGSKNVHWYQQKPAQAPVLVIYDDSVRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKY
Colobus angolensis palliatus V869 iglv JYKR01125423.1 3036 SVVSSELTQDPALSVALGQTVRITCQGDSLKTYYASWYQQRPGQVPVLVIYGNNNRPSGIPGRFSSSYSGNTGSLTLTAAQVEDEAVYYCHSWDSSGKH
Colobus angolensis palliatus V870 iglv JYKR01125425.1 22442 SWTQSALTQPRSVSGSPGQSVTISCTGTSSDGGGYNYVSWYQQHPGTAPRLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Colobus angolensis palliatus V871 iglv JYKR01125425.1 9983 FAASYDLTQPPSVSVSPGQTARITCGGDNIGSKSVHWYQQKPAQAPVLVIYDDSDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWEGSSDH
Colobus angolensis palliatus V872 iglv JYKR01125425.1 3310 SVVSSELTQDPAVSVALGQTVRITCQGDSLSSYYASWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSYSGNTGSLTVTGAQVEDEADYYCGSWDSSGNY
Colobus angolensis palliatus V873 iglv JYKR01125426.1 960 SVASYELTQPPSVSVSPGQTARITCSGDELPNNYAYWYQQKPGQAPVLVIYEDSERPSGIPERFSGSSSGTTVTLTISGAQAEDEADYYCYSGDGNS
Colobus angolensis palliatus V874 iglv JYKR01125438.1 1131 LTSQAKVIQKTSRTANPGETITLTCGSSAGAVTISNYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGSLRGDKAVLTTTEAQPEDEAFYYCAL
Colobus angolensis palliatus V875 iglv JYKR01125448.1 9446 SWAQSVLTQPPSASEALRKSVTISCSGSSSNIGSNGVSWYQQLPGTAPKLLIYYDDQRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDGSLN
Colobus angolensis palliatus V876 iglv JYKR01125449.1 25558 SWAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYYVHWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSASLAITGLQTEDEADYYCQSYDSSLS
Colobus angolensis palliatus V877 iglv JYKR01125449.1 2201 SLSQPVLTQPPSFSASPGESARLTCTLSSDINVGSYNIYWYQQKPGSPPRYLLYYNSDSDKHQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCVI
Colobus angolensis palliatus V878 iglv JYKR01125450.1 6394 SWAQSVLTQPPSASGTPGQRVTISCTGSSSNIGAGYYVQWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLAITGLQSEDEADYYCGAWDNSLSG
Colobus angolensis palliatus V879 iglv JYKR01125457.1 19355 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPILLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCEAWDDSLSA
Colobus angolensis palliatus V880 iglv JYKR01125457.1 9616 SNSQAVVTQEPSLTVSPGGIVTLTCASSTGAVTSGHYPHWCQQKPGQAPRTLIYNTNFKHSWTPARFSGSILGGKAALTLSGAQPEDEAEYYCSLYYSDA
Colobus angolensis palliatus V881 iglv JYKR01125457.1 2113 SLSQPVLTQPASLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCTT
Colobus angolensis palliatus V882 iglv JYKR01125459.1 8594 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWFQQKPGQAPRALIYNTNSKHSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGP
Colobus angolensis palliatus V883 iglv JYKR01125459.1 527 SLSQPALTQPASLSASPGASASLTCTFSGGIIVAGYHIHWYQQKPGSPPRYLLMYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Colobus angolensis palliatus V913 igkv JYKR01140444.1 12017 SSGDIMMTQTPLSLPITIGEPASTSCRSSQSLLSSNGYNYLSWYLQKPGQSLQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQIP
Colobus angolensis palliatus V914 igkv JYKR01140444.1 3741 TRCAIQMTQSPSSLSASVGDTVTITCRASQSIGSNLAWYQQKPRKVPKLLIYAASTLQSEVPSRFSGSGSGTDLTLTISSLQPEDVATYYCQKCDSAP
Colobus angolensis palliatus V915 igkv JYKR01140448.1 11992 ARCDIQMTQSPSSLSASVGDRVTITCRSSQGISNYLSWYQQKPGKAPKPLIYYASNLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYDNLP
Colobus angolensis palliatus V916 igkv JYKR01140449.1 359 ARCDIQMTQSPSSLSASVGDRVTITCRSSQGINNYLSWYQQKPGKAPKPLIYYASNLETGVPSRFSGSGSGTDYTLTISSLQPEDIATYYCQQYDNLP
Colobus angolensis palliatus V917 igkv JYKR01140451.1 18419 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNYLNWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQYDNSP
Colobus angolensis palliatus V918 igkv JYKR01140453.1 41876 SRGDIMMTQTPLSLLITPGEPASISCRSSQSLLDSDDKNTYLDWYLQKPGQSPQPLIYFVSRRASGVPDRFSGSGSGSDFTLKISQVEAEDVGVYYCMQCIELI
Colobus angolensis palliatus V919 igkv JYKR01140453.1 28739 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNYLNWYQQKPGKAPKLLIYYASNLETGVPSRFSGSGSGTDYTFTISSLQPEDVAIYYCQHGYSTP
Colobus angolensis palliatus V920 igkv JYKR01140453.1 7869 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLHSNGRTYLDWYLQKPGQPPCLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Colobus angolensis palliatus V921 igkv JYKR01140456.1 792 ARCDIQMTQSPSSLSASVGDTVTITCQASQGITNDLAWYQQKPGESPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQLNDFATYYCQHYYSTP
Colobus angolensis palliatus V946 ighv JYKR01147076.1 690 VLSQVQLQESGPGLVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPSRGLEWLGRTYYRSKWYNDYALSVQSRITINPDTSKNQFSLQLSSVTPEDTAMYYCAR
Colobus angolensis palliatus V947 ighv JYKR01147081.1 3891 VLSQVQLQESGPGLVKPSETLSLTCTVSGYSISSGFYCSWIRQSPGKGLEWIGYIDNSGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAS
Colobus angolensis palliatus V989 igkv JYKR01174233.1 1224 TRAETILTQSPAFVSATPGDKVTISCRASQDIDDDMNWYQQEPGEAPKLIIKAATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Colobus angolensis palliatus V990 igkv JYKR01174239.1 24981 ARAEMILTQSPASESVTPGDKVIISCKASQDTDDDMNWYQQEPEEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDAAYYFCQQRDN
Colobus angolensis palliatus V991 igkv JYKR01174239.1 14164 AKCDVQLTQSPTFLSASVGDRVTIACRASQSINKGLAWYQQKPGNAPKLLISYASSLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Colobus angolensis palliatus V992 igkv JYKR01174242.1 3423 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQHY
Colobus angolensis palliatus V1008 igkv JYKR01182079.1 12626 QKRYSQQSPAFVSATPGDKVTISCKASQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQHDNFP
Colobus angolensis palliatus V1018 ighv JYKR01186732.1 5368 VQCEVQLVESGGGLVQLEGSLRLSCVASGFTFSDYNMAWVRQAPGKGLEWVSSISSPSGSNTYYLDSVKGRFTISRDNAQNTLYLQMNSLQAEDTAVYYCA
Colobus angolensis palliatus V1019 ighv JYKR01186733.1 14011 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGYWMGWVRQAPGKGLEWVGRIKNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCTT
Colobus angolensis palliatus V1021 trdv JYKR01187829.1 7610 VMSAIELVPEHQTVIVSVGDPATLRCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Colobus angolensis palliatus V1022 trdv JYKR01187830.1 18024 VSLGIILEPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILVSKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Colobus angolensis palliatus V1023 trav JYKR01187833.1 47412 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASDRLYWYRQNPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLGTLYITAALQDLSATYFCAV
Colobus angolensis palliatus V1024 trav JYKR01187833.1 35572 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINALHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Colobus angolensis palliatus V1025 trav JYKR01187834.1 22422 SGMAQTVTQSQPEMSVQEAETVTLNCTYDTSESDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Colobus angolensis palliatus V1026 trav JYKR01187834.1 11323 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAARYFCAYR
Colobus angolensis palliatus V1027 trav JYKR01187836.1 9053 SERADWIEPQETEVSATEGKTVNLLCNYGTSSGSYLDLYWFRQYLSQAPEYILYRGWGYSGKGDANFAIGKFYSKSTAKATNLYIRNLVPADTALYYCVL
Colobus angolensis palliatus V1028 trav JYKR01187837.1 25741 VRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADSIYWYRQLPSQGPEYVIHGLTSNVNNRMVSLTIAEDRKSSTLILHHATLRDAAVYYCILR
Colobus angolensis palliatus V1029 trav JYKR01187837.1 21015 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSFLYITASQPSHAGIYLCGG
Colobus angolensis palliatus V1030 trav JYKR01187837.1 8267 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNNLLWYKQDPGEGPVLLIALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Colobus angolensis palliatus V1031 trav JYKR01187837.1 3478 VSSEDKVVQNPLSLVVHEGDTVTLNCSYEVVNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSGILDKKDLFSILNITATQTRDSAVYLCAVE
Colobus angolensis palliatus V1032 trav JYKR01187842.1 27419 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVLTSLQWYRQDPGEGPVLLVTVVTGGEVKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Colobus angolensis palliatus V1033 trav JYKR01187842.1 8585 VRSQKPVQGPQAVILQEGEDAIINCNSSKALYSVHWYRQKHGEVPVFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSGTYFCGAE
Colobus angolensis palliatus V1034 trav JYKR01187843.1 9532 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLRKPSAHVSDAAEYFCAVS
Colobus angolensis palliatus V1035 trav JYKR01187846.1 2226 TIIDAKATQPTSMDCAEGRAANLPCNHSTISENEYIYWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Colobus angolensis palliatus V1036 trav JYKR01187847.1 1747 IIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRNSSVLILPHATLRDTAVYYCIVRV
Colobus angolensis palliatus V1037 trav JYKR01187848.1 5224 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIMLVKNGEVKKQKRLTFQFGEAKKNSSLHITATQTTDIGTYFCA
Colobus angolensis palliatus V1038 trav JYKR01187849.1 69304 LSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFILYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Colobus angolensis palliatus V1039 trav JYKR01187849.1 56352 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPGDSATYLCAV
Colobus angolensis palliatus V1040 trav JYKR01187849.1 36562 VRGIQVEQSPPDLILQEGANSTLRCNYSATVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTTERYSLLHISSSQTTDSGIYFCAVEPQCSP
Colobus angolensis palliatus V1041 trdv JYKR01187849.1 14023 SSMAQKVTQAQSSVSMPVGKAVTLNCQYETSWWLYYIFWYKQLPNKEMIFLIRQYSSEQNAKNGRYSVNFEKAASSITLTISALQLGDSATYFCALRG
Colobus angolensis palliatus V1042 trav JYKR01187849.1 5202 VSSILNVEQSPQSLNVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Colobus angolensis palliatus V1043 trav JYKR01187851.1 23585 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFMFWYVQYLNKEPELLLKSSENQETDSRGFQASHVKSDSSFHLKKPSVQLSDSAVYYCVLR
Colobus angolensis palliatus V1044 trav JYKR01187851.1 20358 SSMAQKVTQAQTAISVVEKEDVNLDCVYEARGSTYYLFWYKQPPSGELVFLIRQNSFNEQNEINGRYSSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Colobus angolensis palliatus V1045 trav JYKR01187852.1 3563 VNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLILIRSNEREKSSGRLRVTLDTSTKSSSLLITASRAADTASYFCATD
Colobus angolensis palliatus V1046 trav JYKR01187853.1 12907 GTRAQSVTQLDSQVSVSEEAPVLLRCNYSSSVSVYLFWYVQYPNQGLQFLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Colobus angolensis palliatus V1047 trav JYKR01187853.1 1066 GTRAQSVTQPEKLLSVFKGAPVELKCNYSYSGSPNLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSETSFHLKKLFAQEEDSAMYYCALS
Colobus angolensis palliatus V1048 trav JYKR01187854.1 6770 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYTYSSGNQEDGRFTAQVDKSSKHISLFIRDSQPSDSATYFCAMS
Colobus angolensis palliatus V1049 trav JYKR01187855.1 16610 RTRGDSVTQMQGPVTLSERAFLIINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKDDDKGSNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Colobus angolensis palliatus V1050 trav JYKR01187856.1 2063 SGIAQKITQTQPAMFMQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLIRQESYDKQNATEGRYSLNFQKARKSVNLVISASQVGDSAMYFCAMR
Colobus angolensis palliatus V1051 trav JYKR01187857.1 23947 GTGAQSVTQLDSQVSVSEGDIVLLRCNYSSSFSPNLFWYVQYPNQGLQLLLKYTSGPTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVS
Colobus angolensis palliatus V1052 trav JYKR01187857.1 17573 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAVG
Colobus angolensis palliatus V1053 trav JYKR01187857.1 1686 VSRGDSVGLHLPTVSVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQFIIDIRSNMATRQGQRVTILLNKTVKHLSLQIAATEPGDSAVYFCAEN
Colobus angolensis palliatus V1054 trav JYKR01187858.1 6466 VWSQQKVEQNSGSLSVPEGAIASLNCTYSDRGSQSFFWYRQHSGQSPELLMSTYSSGDKEDGRFTAQLNKASQYVSLLIRDSQLSDSATYLCAV
Colobus angolensis palliatus V1055 trav JYKR01187859.1 19679 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Colobus angolensis palliatus V1056 trav JYKR01187860.1 23043 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDNGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Colobus angolensis palliatus V1057 trav JYKR01187860.1 7411 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRARQYISLLIRDSQLSDSATYLCAVR
Colobus angolensis palliatus V1058 trav JYKR01187860.1 1959 GTGAQSVTQLDSQVSVSEGVLVLLRCNYSSPVSPNLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDVAEYFCAVN
Colobus angolensis palliatus V1059 trav JYKR01187862.1 59348 MSRGENVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLRLLTYILSNMDLKQDQRLTVLLNKKDKHLSLRIPDTQTGDSAIYFCAES
Colobus angolensis palliatus V1060 trav JYKR01187862.1 49571 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Colobus angolensis palliatus V1061 trav JYKR01187862.1 6659 EINGDSVVQTEGPVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKAMMANDKESNKGFEATYHKETTSFHLKKDSVQESDSAVYFCALS
Colobus angolensis palliatus V1062 trav JYKR01187864.1 35366 GLRAQLVTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPNQGLRFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Colobus angolensis palliatus V1063 trav JYKR01187864.1 23339 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPADRKSSTLSLPRVALSDTAVYYCLVG
Colobus angolensis palliatus V1064 trav JYKR01187869.1 2157 MCLVLGTTGQNIDQPTEMTAMEGAIVQINCTYQTSGFNGLSWYQQHDGEAPTFLSYNVLDGLEEKGRFSSFLSNSKGYSYLLLKELQMKDSASYLCAVR
Colobus angolensis palliatus V1065 trav JYKR01187871.1 12041 TAGQSLEQPSEVTAVEGAIVQINCSYQTSRFDGLSWYQQYDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Colobus angolensis palliatus V1072 iglv JYKR01190575.1 1053 VDSQTVVTQEPSLSVSSGGTVTLTCGLSSGLVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDCFSGSILGNKAALTITGAQADDESDYYCTLYMGSGI