WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Xiphophorus maculatus AGAJ00000000.1 (AGAJ01) 14 0 1 7 6 0 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Xiphophorus maculatus Vs199 igkv AGAJ01008745.1 17453 SNMQTLVHQVESEAVQPGGHVTLTCTAETGSCDGEHSVYWFRNNGESVPGLLYSRRGRNDQCGQKTQERTGSCRYSLLLQNLTGSQAGTYYCAVASC
Xiphophorus maculatus Vs217 igkv AGAJ01017481.1 473 VRGQVTVTQPAAVRADLGRSATISCRTSQDVYKNYYLAWYQQKDGQTPHLLFYYVGSRVSGTPNRFNDGGSNSDFTLTISGVQAEDAAVYYCQS
Xiphophorus maculatus Vs216 igkv AGAJ01017480.1 2032 VRGQVTVTQQPEAVRAGLGGSVTINCRMSQNVHVHLSSFPCLAWYQQKDGQTPKLLIYLSSTKASGTPSRFSGSGSHSDFTLTISGVQAEDAAVYYCQS
Xiphophorus maculatus Vs13 trav AGAJ01008606.1 1054 RVRLTLCRFHSVTVQAGGHVTLSCANLSKLPSHVSWSKLADGGNVGCISTMTSSESRAVLCDEGQGDKYNMTSNGTDIFLDVQEVNLLDAGVYICGQ
Xiphophorus maculatus Vs205 iglv AGAJ01011314.1 10856 VSGATVLTQKPPVLTVRKGETATMDCNLGTVVNTVYWYKQIPGGVPQWVLYFYHSWSSPSYGSGFSSPKFTSTHQSTTDYRLIINNVEEQDSAVYYCK
Xiphophorus maculatus Vs218 igkv AGAJ01017483.1 1782 SSGDIIMTQTPGSLSVDPGQRVSIECKASGYVSNEVDWYLQKPGEAPKLLIYWISNRQPGVPDRFSGSQSGADFTLTISRVQAEDAGVYYCQQDYSFP
Xiphophorus maculatus Vs200 trav AGAJ01008745.1 2558 WTSTSVCQFHSVVVQPGGEVTLRCSNLSRVPVFLHWFKLADGPNPTVIVSMSMSGWSGLNKIQLGRFTMTSNITDLFLNIRSVDFSDTGLYFCG
Xiphophorus maculatus Vs27 trav AGAJ01012255.1 17113 FFPSTMASHLISLTLVDIGDNITFDCNVSEKELKYVNWYKQSLGHIVEIVASVILGQTTMTEKFKGSHFAITPEGSRYDLTIFNISKEDEATYFCHIGTTY
Xiphophorus maculatus Vs26 igkv AGAJ01012243.1 4769 PDLTTVIQEPLLYPVFPGDLVTLSCSVFSDCESRKCKTDHRVYWFKTGPDESHPSLIYIDGKSGNECLDPKMCVYSFSKDITVSDAGTYYCAV
Xiphophorus maculatus Vs16 igkv AGAJ01008618.1 1235 RNKLLRQEWAFHSTEVGSNVTLPCFYYEENAVMIYWFKQTVGQKPNMFSRLYKVDEQGSFHDEFKDNPRFELEAGNGKNHLRISDLQPSDSATYFCVAIDS
Xiphophorus maculatus Vs14 trav AGAJ01008606.1 8156 WITKSDFEFDSVLVQPGEEVTLLCPNFTNVFEHIFWYKLIPGPGVSRISSMVNPGSKVHLHDGFQREKFNMTSNGTNIFLNIKQVNFSDSGVYICGTK
Xiphophorus maculatus Vs15 trav AGAJ01008606.1 13733 WITKSDFEFDSVLVQPGEEVTLLCPNFTNIFEHIFWYKLIPGPGVSRISSMVNPGSKVHLHDGFQREKFNMTSNGTNIFLNIKQVNFSDSGVYICGTK
Xiphophorus maculatus Vs18 igkv AGAJ01008746.1 1885 SGFDSQASVDQPKYATVPPGGSVTLNCTVQTGSCGGEHRVYWFRNSDDSPPGLVYGHGAKSEQCETNPYRQTHTCVYDLPVENLDASHAGTYYCAVASC
Xiphophorus maculatus Vs28 trav AGAJ01012255.1 22977 LIHTVETSHLISLTLVDIGDNITFDCNVSEKELKFVNWYKQALGHIVEIVASVILGQTTITERFKGSHFAITPEGTRHDLTIFNISKEDEATYFCHIGTTY