WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Gadus morhua CAEA000000000.2 (CAEA02) 102 16 2 23 38 11 3 9
Gadus morhua CAEA00000000.1 (CAEA01) 104 26 4 17 26 21 3 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Gadus morhua V80 igkv CAEA020020712.1 690 TSSQVTVTQTPVVSFTPGSTVTLTCKTNPAVHNGYNLQWYQQKPGEAPKLIIKLADERVSPTPARFSGSGRRTDFSLTINGAQREDAAVYHCQS
Gadus morhua V79 igkv CAEA020019102.1 559 TSSQVTVTQTPVVSFTPGSTVTLTCKINPAVYRDSDGDNMFWYQQKPGEAPKLFIKYTTQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua V78 trav CAEA020018545.1 6955 VSAVTVVTQQPSVVTLTRGESASIDCNLGSVTGYTADWYKQIPGGVPQYVLHFHKSWTDVKYGSGFSSPHFTSTCKSWSDCRLIINNVEEGDSAV
Gadus morhua V77 ighv CAEA020017827.1 2986 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTAWVRQPEGHGLEWIGWIYTGGKHQKDSLSSKFSLVVDGSSNTVTLQGQNMQPGDSAVYYCAGE
Gadus morhua V76 trbv CAEA020016643.1 361 ASNSDKVDQTPPEMVEAIGSKKVKLSCSHSIENYNQILWYKQQRNNRQLKLLGYLYLNDVNPETGMDDEMSGSAGQHQTASLTIQNISVESSAVYFCAAS
Gadus morhua V75 igkv CAEA020016515.1 150 TSSQVTVTQTPVVSFTPGSTVTLTCKTNPAVYSDGNGQRLHWYQQKPGEAPKLIIKYITQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQSYINPYV
Gadus morhua V74 igkv CAEA020016514.1 4655 TSSQVTVTQTPVVSFTPGSTVTLTCKTNPAVYRDSNGQRLYWYQQKPGEAPKLIIKYITQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua V73 trav CAEA020015972.1 2733 YQQTIHSIQDSPVQALQGDGVTLSCNYSSATNLFWYRQYPSSPPQFLIKEYMELSRFTLKKDSDKKMFHLEISAAAVTDSALYFCAVEPTVTG
Gadus morhua V72 trav CAEA020015970.1 1451 PSVEDSISQQKDVQRAVEGAAVVLSCSYNSSVVGSLWYRQYPGSPPQFLIMEYSGIITNPIPGMNITHIKQQRLVELLISSAAVTDSALYYCALR
Gadus morhua V71 trav CAEA020015950.1 660 VHCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTYWIRQPEGHALEWIGWIRTDGKKVKDSLSSKFSLAVDGSSNTVTLQGQNMQPGDSAVYYCARW
Gadus morhua V70 trav CAEA020010933.1 2013 CNGEDRVNQTGEYVFATEGLTVSLRCTFETTDSSPSLFWYKQQTHDFPRFMLRRSTFGGDNAPEFRKDRFDAEIQIKSVPLSIQNLQLSDSALYYCALR
Gadus morhua V69 trdv CAEA020010933.1 6496 LIAGDSISPDGVQKVSGKEGGSVTLRCTYETSYNYVRLYWYRHHSNQAPQFILWKGARSWSDEHIPDTRYESTTSRTSTELTITQLTLADTALYYCALW
Gadus morhua V68 trdv CAEA020010933.1 7444 CKGEDSVNQISEVIATEGHTVSLQCTFGTDYTPYLFWYKQQRNDFPRFVLQRSTLGGKEAEEFPKERFDAQIQNTSVPLRIKNLQLSDSALYYCALR
Gadus morhua V67 trav CAEA020010933.1 8485 YSYQQTIHSIQDSPVQALQGDGVTLSCNYSSATNLFWYRQYPNSPPQFLIKDYMELSGFTLKKESDKQMFHLEISSAAVTDSALYYCAQQ
Gadus morhua V66 trdv CAEA020010933.1 9638 LIAGDSISPDKPKVSGKEGASVTLRCTYGTSFDDVDLYWYRHRSNQAPQFILYKGAKGSDSHHIPDTRYESTTSSTSTELTITQLTLADTALYYCALE
Gadus morhua V65 trdv CAEA020010933.1 14701 LIAGDSISPHNQEVSGKEGASVTLRCSYETSFNNVDLYWYRHRSNQSPQFILWKGARSRSGQQYIPDRRGASMTSRTSTKLTITQLTLADTALYYCALE
Gadus morhua V64 trdv CAEA020010933.1 17633 LIAGVSISPDEPKVSGKEGGSVTLRCNYETSSEYVRLYWYRHHSNQAPRFILYKDARSWSTEHIPDTRYESTTSSTSTELTITRLTLADTALYYCALE
Gadus morhua V63 trav CAEA020010933.1 23259 GDRVIQPREDVISTEGLTVSLDCTFVTMSTHVYLFWYKQQVNDFPRLMLRRFTIGEGDNAEEFHKERFDAKIQNTSVPLSIQNLQLSDSALYYCALKPRVTG
Gadus morhua V62 trav CAEA020010933.1 24382 PSVEDSISQQKDVQRAVEGAAVVLSCSYNSSAVSSLLWYRQYPGSPPQFLIMEYSGYITNPIPGMKITHIKQQRLVELLISSAAVTDSALYYCALR
Gadus morhua V61 trav CAEA020010933.1 25947 EDSVNQISEEVIATEGHTVSLQCIFETDSTPYLFWYKQQRNDFPRFVLQRSTFGGKEAEEFPKERFSAQIQNTSVPLSIQNLQLSDSALYYCALK
Gadus morhua V60 trav CAEA020010933.1 27660 ESHQQTINSTQDGVQALQGDSVTLSCQYSLATNLFWYRQYPSSPPQFLIKEYMEVSGFTLKKDSKRQMVALEISVAAVTDSALYYCALQ
Gadus morhua V59 trdv CAEA020010930.1 614 LIAGDSIAPANPEVGGKEEASVTLRCSYETSSESVYLYWYRHRSNQAPQFILYKGARSWRDRQHIPDTRYESTTSRTSTELTITQLTLADTALYYCALW
Gadus morhua V58 trdv CAEA020010930.1 1558 CKGEDRVNQISEVIATEGHTVSLQCTFETDYTPYLFWYKQQINDFPRFVLQRSTLGGKEAEEFPKERFDAQIQNTSVPLRIQNLQLSDSALYYCALK
Gadus morhua V57 trav CAEA020010930.1 3262 DSYQQTIHSIQDSPVQALQGDGVTLSCNYSSATYFFWYRQYPSSPPQFLIKEYMELSRFTLKKDSDKKMFHLEISAAAVTDSALYYCAVE
Gadus morhua V56 trav CAEA020009642.1 25651 LIQAQESPTLVFVESAGLGDTVTLHCESGNTVSSYLYWYKQSPGFFPEMVALKMFESITSEPHINLTLTEGEEGVCVFHLTIQNVTKGDEANYFCQIY
Gadus morhua V55 trav CAEA020009640.1 40073 LIQAKESPPLVFVVSAGLGDTVTLHCESENEVCSTLYWYKQSPGCFPEMVASKLYESITLKPHINLTLTEGEEGVCVFHLIIPNVTKGDEANYFCQSY
Gadus morhua V54 trav CAEA020007234.1 1809 LLTVVTQQPSVVTLTRGETASIDCNLGSVTRYSAYWFKQIPGRVPQFVLHFHKNWADVKYGSGFSSPHFTSTCTTVSDCRLIINNVKEGDSAVYHC
Gadus morhua V53 trav CAEA020007234.1 7074 VSAVTVLTQQPSVVTLTRGETASIDCNLGSVTGHSARWYKQIPGGVPQYVLSFHQTWADVKYGSGFSSPHFTSTCQSKSDCRLIINNVEDGDSAVYY
Gadus morhua V52 igkv CAEA020005884.1 1118 PSVEDSISPQKDVQRAVEGAAVVLSCSYNSSVVSSLLWYRQYPGSPPRFLIMEYSGYITNPIPGMNITHIKQQRLVELLISSAAVTDSALYYCTVLVVEIQ
Gadus morhua V51 igkv CAEA020005884.1 1118 PSVEDSISPQKDVQRAVEGAAVVLSCSYNSSVVSSLLWYRQYPGSPPRFLIMEYSGYITNPIPGMNITHIKQQRLVELLISSAAVTDSALYYCTVLVVEIQ
Gadus morhua V50 trav CAEA020005884.1 2857 EERVILTGEVVIATQGLRDSLGCTFETIGKSPSIFWYKQQLNDLPRFMLQSSTHGSGINTAEFHKDRFDAQIQNTSVPLSIHNLQLSDSALYYCALK
Gadus morhua V49 trav CAEA020005884.1 2857 EERVILTGEVVIATQGLRDSLGCTFETIGKSPSIFWYKQQLNDLPRFMLQSSTHGSGINTAEFHKDRFDAQIQNTSVPLSIHNLQLSDSALYYCALK
Gadus morhua V48 trav CAEA020005884.1 11268 PSVEDSISQPKDVQRAVEDAAVVLSCSYVSSVVNSLLWYRQYPGSPPQFLIMEYSGIITNPIPGMIITHIKQQKLVELLISSAAVTDSALYYCALQ
Gadus morhua V46 igkv CAEA020005502.1 1649 TSSQVTVTQTPVVSVAPGSTVTLTCKTNPAVYTYSTNQYLHWYQQKHGEAPKLIIKYADQLVSPTPARFSGSGSSTDFSLTITGAQREDAAVYHCQS
Gadus morhua V45 igkv CAEA020005501.1 1453 TSSQVTVTQTPVVSFTPGSTVTLTCITNPAVYRWGDGDEDMFWYQQKPGEAPKLIIKYAKKLVSPTPARFSGSGSSTDFSLTINGAQHEDAAVYHCQS
Gadus morhua V44 igkv CAEA020005214.1 67714 TSSQVTVTQTPVVSFTPGSTVTLSCKTNPAVYSDSDGHYLHWYQQKPGEAPKLIVKLVNQLVSPTPARFSGSGSSTDFSLTITGAQREDAAVYHCQS
Gadus morhua V43 igkv CAEA020005182.1 4843 TSSQVTVTQTPVVSVTPGSTVTLTCKTNTAVFNNDFIFWYQQKPGEEPKPLITRVSTRESSTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua V2 trbv CAEA020005186.1 32163 ASNSDKVDQTPPEMVEAIESKMVKLSCSHSIENYNQILWYKQQRNNRQLKLLGYLYLNDVNPETGMDDEMSGSAGQHQTASLTIQNISVESSAVYFCAAS
Gadus morhua V1 trbv CAEA020005186.1 24858 ASLSDQVHQTPPEMVVAIKSGATVTLNCSHSIKDYDRILWYKQQRNDKQLKLLGNIYSTTANLEKGMNVEMSGSADQDKTASLTIQKISVESSAVYFCAAR
Gadus morhua V0 igkv CAEA020005181.1 1387 TSSQVTVTQTPVVSVNPGSTVTLTCKTNPAVSRHPFLGYYYLNWYQQKPGEAPKLIIKLVNQLESSTPARFSGSGSTTDFSLTITGAQREDAAVYHCQSYHSGPV
Gadus morhua V41 iglv CAEA020005150.1 116038 LEAALVLTQEKTLSVNRGDNVKISCTETDSSSNYVLSWYQQKSGSPPKYLLYTTGDRASGVPSRFTTSGTRGDKTEYLLINGIQDEDEATYYCACDDCSA
Gadus morhua V40 trav CAEA020004761.1 3181 WAVKYQSQCAFKGTSVTIPCSYSHPPGHRVPLVTWYRGKIRPGGWTGYPFINSHSMKGHFQYLGDTSGSCTLRINRLLDSDQAGYFVTLKTDGDK
Gadus morhua V39 ighv CAEA020024649.1 8678 VNCEQLTQPGSLTVRPGQPLTIRCQVSYSVSSHYTAWIRQPDGKGLEWIGDEGHLKDSLSSKFSISVDEASNTATLQGQNMQPVDSAVYYCAR
Gadus morhua V38 ighv CAEA020024648.1 11876 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSHWTAWIRQPEGHALEWIGMIYTGNKLMKDSLSSKFSLSLDEASKTVTLQGQNMQAGDSAVYYCAR
Gadus morhua V37 ighv CAEA020024648.1 8239 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYATAWIRQPDGKGLEWIGWIYTSDKKVKDSFNSKFSLSLDEASKTITLQGQNMQPGDSAVYYCARE
Gadus morhua V36 ighv CAEA020024522.1 4592 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSGHYTAWIRQPEGQALEWIGWIYTGDKKVKDSLSSKFSLSLDEASKTVTLQGQNMQPGDSAVYYCARE
Gadus morhua V35 trbv CAEA020020853.1 131 ASNSDKVDQTPPEMVEAIESKMVKLSCSHSIENYNQILWYKQQRNNRQLELLGYLYLTNPYPEKEMDGEMSGSAGQHQTASLTIKNISVESSAVYFCAAS
Gadus morhua V34 trav CAEA020019636.1 1317 SSSQVTVIQTPVVSVAPGSTVTLTCKTNPAVHRWSDGDEGMFWYQQKPGEAPKLIIKYINTLVSPTPARFSGSGSSTDFSLTITGAQREDAAVYHCQS
Gadus morhua V32 trav CAEA020017942.1 866 VSAVTVVTQQPSVVTLTRGETASIDCNLGSAIDQTALWFKQIPGGVPQYVLEFHKSWADVKYGSGFSSPHFTSTCKTVSDCRLIINNVEDGDSAV
Gadus morhua V31 ighv CAEA020017826.1 300 VNSEQLTQPESLTIRPGQSLTIHCQVSYSVSTFATAWFRQPDGNGLEWIGDEENLKDSLGSKFSISVDEASNTATLQGQNMQPGDSAVYYCA
Gadus morhua V30 trav CAEA020016846.1 807 VSAVTVVTQQPSVVTLTRGESASIDCNLGSVTRYTACWYKQIPGGVPQYVLQFHKNWADVKYGSGFSSPHFTSTCKTVSDCRLIINNVEEGDSAVYYC
Gadus morhua V29 trav CAEA020016840.1 875 VSAVTVVTQQPSVVTLTRGETASIDCNLGSVSDMMAFWYKQIPGGLPQFVLFFHHYFTDVTYGSGFSSPHFTSTCNSVSDCRLIINNVEEGDSAV
Gadus morhua V28 igkv CAEA020016493.1 1002 TSSQFTVTQTPVVSFTPGTTVTLTCKINPAVYRDGDGDNMFWYQQKPGEAPKLFIKYTNKLVSPTPARFSGSGSSIDFSLTINGAQREDAAVYHCQS
Gadus morhua V27 igkv CAEA020015395.1 3602 TSSQVTVTQTPVVSFTPGSTVTLTCKTQPAVYRWSDVQQGIYWYQQKPGEAPKLIISYISTLVSPTPARFSGSGSSTDFSLTISAAQREDAAVYHCQS
Gadus morhua V26 trav CAEA020007004.1 1345 VSAVTVVTQQPSVVTLTRGETASMDCNMGSVIDRRAFWFKQIPGGVPQFVLQFHLNLPNVTYGPGFSSPHFTSTCKTVSDCRLIINNVEEGDSAV
Gadus morhua V25 trav CAEA020007002.1 6886 VSAVTVVTQPSVVTLTRGETASIDCNVGSVTGYSADWYKQIPGGVPQYMLRFRHTWTDVKYGSGFSSPHFTSTSQSGTDYRLIINNVEEGDSAVYHCTIWDDSAKENV
Gadus morhua V24 ighv CAEA020006578.1 14354 VNCEQLTQPESLTVRPGQPLIIRCQVSYSVSSYSTHWIRQPDGKGLEWIGGISTVWKGVKDSLNSQFSLTLDVASKTITLQGQNMQPGDSAVYYCARE
Gadus morhua V23 ighv CAEA020006578.1 4663 VNSEQLTQPESLTVRPGQSLTIRCQVSYSVSSHYIAWIRQPEGHGLEWIGQIYTGAKYQKDSLSSKFSLSLDEASKTGTLLGQNMQPGDSAVYYCARE
Gadus morhua V22 ighv CAEA020006569.1 290 VNCEQLTQPGSLTVRPGQPLTIRCQVSYSVSSYATAWIRQPDGKGLEWIGDEGNLKDSLGSKFSISVDEASNTATLQGQNMQPGDSAVYYCAR
Gadus morhua V21 trav CAEA020005883.1 3445 CNGEDRVNQTGEYVIATEGLTVSLRCTFETTDSSPSLFWYKHQTHDFPRFMLRRSTIGEGDNAPEFPKDRFDAQIQIKSVPLRIQNLQLSDSALYYCALR
Gadus morhua V20 trdv CAEA020005882.1 4496 LIAGDSISPDEQKVSGKEGVSVKLRCTYETSSENVRLYWYRHHLNQAPQFILYKGARSWSSEHISDRRYQSTTSRTSTELTVTQLTLADTALYYCALE
Gadus morhua V19 trav CAEA020005882.1 3578 GDGVTQPREDVIATEGLTVSLDCTFVTMSTNVYLFWYKQQVNDFPRFILRRFTIGEGDNAEEFHKDRFGAKIQNTSVPLRIQNLQLSDSALYYCALR
Gadus morhua V18 trav CAEA020005833.1 457 EDSVNQISEVIATEGHTVSLQCTFETDSTPYLFWYKQQRNDFPRFVLQRTTFGGKEAEEFPKERFDAKIQNTSVPLSIQNLQLSDSALYYCALK
Gadus morhua V17 trav CAEA020005831.1 25021 EDGVTQTMGDFIGTEGLAVSLDCTFETTDTNPYLFWYKQQINDFPRYVLQRSTFGGKEAEEFPKERFDAEIQNKSVHLRIQNLQLSDSALYYCALR
Gadus morhua V16 trav CAEA020005831.1 20463 EDGVIQPREDVMATEGLTVSLRCTFKTTDTNAYLFWYKQQINDLPRFMLRRFTVGEGDNAAEFHKDRFDAQIQNKSVPLRIQNLQLSDSALYYCALR
Gadus morhua V15 trgv CAEA020005825.1 380 VVAMAAELTQDQVSWTRREGENVSFTCTNTDQCGDDYIYWYQKKESETFRVILDISKSTGALDKSYNHPQKDDFSSVLKENSWELSLQKVKASHSATYYCSCWTSG
Gadus morhua V14 trgv CAEA020005821.1 54519 VVAMAAELTQDQVSWTRREGENVSFRCTDTDQCGLIYWYQKKEGETLAVILSFEKSLGQLQKGFNHPQEDDFSSVLKDNSWELSLQKVKASHSATYYCSCLTSG
Gadus morhua V13 igkv CAEA020005787.1 4632 TSSQVTVTQTPVVSVNPGSTVTLTCKTNPAVYRHPSLGDYLFWYQQKPGEAPKLIIKLANQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua V12 igkv CAEA020005524.1 2883 TSSQVTVTQTPVVSFTPGSTVTLTCITNPAVYRWSDGDEDMSWFQQKPGEPPKLIIKYAKKLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua V11 trav CAEA020005189.1 35952 LAAVPMPVQPGDLTLQPGAAITLTCSLASDMSSYTMLWYRQHVYGDPIEFIIQEYDTSRGRFKATLDTNQNRFSLGISELQVNDSGTFYCAA
Gadus morhua V10 trbv CAEA020005189.1 32692 EVHSVIFQQSSAKIVRKGAKGIQIDCSHDESSYLLMYWYQRKDDSPSLTLIGFGYESSTQTYEDRFEEQFKITRESVLQGTLVLTEAAESDSAVYFCAAS
Gadus morhua V9 trbv CAEA020005189.1 31065 EVKGIEFQESGPKIVPDEKAEVVINCSHDDSSRPVMLWYQQKQGSGPLVLLGYNYGATTSNYEDGIKEQFEIKMDDRQSGSLAVREANVTHTAVYFCAAG
Gadus morhua V8 trbv CAEA020005189.1 21420 ASNSDKVHQTPPEMIVAIASKMPTLSCSHSIQGYNRILWYKQHRNDKLLKLLGYMIATDANPEKEMAVVMSGSAEEGKNATLEIQNIIMESSAVYFCAAS
Gadus morhua V7 ighv CAEA020005189.1 20310 VSLGIEVHQTPSELIRKPGDSAELVCRHGETNYRVMLWYQQSAGQRNLSLIGHLNYQTSNIESAFKQDFSISGDLSGETTKNASLLVHLKDPESSGVYYCAARL
Gadus morhua V6 trbv CAEA020005189.1 10428 ASLSDQVHQSPPEMVVAIKSGAKVTLNCSHSIENYEVILWYKQQRNDKQLQLLGYIYSENANPEKGMHVEMSGSAYRNQTARLTILNISPESSAVYFCAAR
Gadus morhua V5 trbv CAEA020005189.1 8682 ATPSNQVHQTPPDMVVAIKSGATVTLNCSHSIENYNTILWYKQQCNNKQLKLLGYIYSTFATPEMGMDGEMSGSAGQHQTARLTIQNISVESSAVYFCAAS
Gadus morhua V4 trbv CAEA020005187.1 11370 EVQSVIIKQSSAKIVRKGAKGIQIDCSHDDSSYPLMYWYQRKDESPSLTLIGFGYESSTQNYEDRFEERINITRESVLQGTLVLTEAAESDSAVYFCAAS
Gadus morhua V3 trbv CAEA020005186.1 34617 ASLSDQVRQTPPEMVVAIKSGATVTLNCSHRIENYERILWYKQQNNDKQLKLLGNLFTTTANAENGIDVVMSGSAYKDQMATLTIPNLRVESSAVYFCAAS
Gadus morhua V100 trav CAEA020024125.1 2144 VNFEQLTQPGSLTVRPGQPLTIRCQVSYSVSTYSKAWIRQPEGHGLECIGWIYTGGKHQKDSLSSKYSLAVDGSSNTLTLQGQNMHPGDSAVYYCARE
Gadus morhua V99 trdv CAEA020024124.1 16421 LCAQTITQSEPVVAKLMESHTLTCTYSGLPTSSAFAWIRQNEEKGLEWIASISGPSGSTKSYSVSVKGRFTISRDNDNQQVHLQMDQLETADSAVYYCAR
Gadus morhua V98 ighv CAEA020024124.1 22804 VNCEQLTQPESLTIRPGQPLTIRCQVSYSVSSYYTFWIRQPDGKPLEWIGYIRTDGKKVKDSLSSKFSLAVDEASKTVTLQGQNMQPGDSAVYYCARE
Gadus morhua V97 ighv CAEA020024124.1 24047 VKCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTAWIRQPDGKPLEWIGYIRTDGKKVKDSLSSQFSLAVDGSSNTVTLQGQNMQPGDSAVYYCAR
Gadus morhua V96 ighv CAEA020023786.1 1242 VKCEQLTQPESLTVRPGQPLTIRCQVSYSLSYWTAWIRQPEGHALEWIGHIDSSSKRVKDSLGSKFSLAVDGSSNTVILQGQNMQPGDSAVYYCARE
Gadus morhua V95 igkv CAEA020023353.1 5363 YSQVTVTQTPVGSVTPGSTVTLTCKTNPAVLNNNYLFWYQQKPGEEPKLIIKYINQLISPTPARFSGSGHMADFSLTINGAQREDAAVYHCQS
Gadus morhua V94 igkv CAEA020023353.1 10814 TSSQVTVTQTPVVSVTPGTTVTLTCKTNSAVYNGNELHWYQQKPGEAPKPIIRRIRTLVSPTPARFSGSGSSTDFSLTINGAQHEDAAVYHCQS
Gadus morhua V93 igkv CAEA020023333.1 464 TSSQVTVTQTPVVSFTPGFRVTLTCKTNTEVFSNSNGQYLHWYQQKPGGAPKLIIKLVNQLVSPTPRFRGSGSITAFSLTINGAQREDAAVYYCQSLHSGPV
Gadus morhua V92 ighv CAEA020023037.1 2118 VNCEQLTQPESLTIRPGQPLTIRCQVSYSVGSWTAWIRQPEGHALEWISMINTGGKHQKDSLSSKFSLTLDVASKTITLQGQNMQPGDSAVYYCARE
Gadus morhua V91 trav CAEA020023036.1 1039 VDCEQLTQPESLTIQPGQPLTIRCQVSYSVSTYATHWIRQPEGHALEWIGYIYTGGKRVKDSLSSKFSLAVDSSTKTVTLQGQNMQLGDSAVYYCARE
Gadus morhua V90 ighv CAEA020023036.1 8113 MNCEQLTQPESLTVRPGQPLTIRCQVSYSLSYWTAWIRQPEGHALEWIGHIDSSSKRVKDSLGSKFSLAVDGSSNTVLLQGQNMQPGDSAVYYCARE
Gadus morhua V89 trav CAEA020023034.1 717 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSSWTHWIRQPEGHALEWIGRIYTGDKKVKDSLSSKFSLVVDDSSSTVTLQGQNMHPGDSAVYYCARE
Gadus morhua V88 trav CAEA020023034.1 1910 VHCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTAWIRQPEGHALEWIGWIRTDGKKVKDSLSSKFSLAVDGSSNTVTLQGQNMQPGDSAVYYCARW
Gadus morhua V87 igkv CAEA020022168.1 627 TSSQVTVTQTPVVSFTPGSTVTLTCKTNTAVYNGNELHWYQQKPGEDPKAHHKIYRNQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua V86 igkv CAEA020022062.1 422 TSSQVTVTQTPIVSFTPGTTVTLTCKTNPAVYRWSDVQQGIFWYQQKPGEAPKLIISYISTLVSPTPARFSGSGSNTDFSLTITGAQREDAAVYHCQS
Gadus morhua V85 igkv CAEA020022060.1 523 TSSQVTVTQTPVVSFTPGSTVTLTCKTNPAVNGNTYLFWYQQKPGEEPKLIIKLVNQLVSPTPARFSGSGSSTAFSLTINGAQREDAAFYHCQS
Gadus morhua V84 trav CAEA020022059.1 2932 TSSQVTVTQTPVVSFTPGSTVTLTCKTTQRFTDTNLFWYQQKPGEAPKLIVKFVNQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQSYHSSGDV
Gadus morhua V83 igkv CAEA020021571.1 573 TSSQVTVTQTPVVSFTPGSTVTLTCKTNPAVYSTYLHWYQQKPGEAPKLIISYISTLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua V82 trav CAEA020021511.1 136 TSSQVTVTQTPVVSFTPGTTVTLTCKTNSEVHNNNFLHWYQQKPGEAPKLIIKYVNQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQSDHTGGV
Gadus morhua V101 ighv CAEA020024125.1 913 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYYTAWIRQPEGHALEWIGWIYTGGKRVKDSLSSKFSLAVDGSSNTVTLQGQNLQPGDSAVYYCARE
Gadus morhua V81 trav CAEA020021418.1 359 TSSQLTVTQTPVVSVTPGSTVTLTCKTNSAVFSKDFLHWYQQKPGEAPKLIMKYVKTLVPPTPARFSGSGRNTAFSLTITGAQREDAAVYHCRS
Gadus morhua V47 igkv CAEA020005503.1 1119 TSSQVTVTQTPVVSFTPGSTVTLTCKTNPAVNRYGNGQYLHWYQQKPGEAPKLFIKVVNQRVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQSYHSGGV
Gadus morhua V42 trgv CAEA020005151.1 1135 LEAALVLTQEKTLSVNRGANVKISCTETDSSSNYVLTWYQQKSGSPPKYLLTTTGSRASGVPSRFTCSGTRNDKTEYLLINGIQDEDEATYYCACVGCGA
Gadus morhua V33 iglv CAEA020018666.1 867 VSAVTVVTQQPSVVTLTRGETASMDCNLGFINAARWYKQIPGGVPQYVLQFFHSWADVKYGSGFSAPRFTSTSQSISDYRLIINNVEEGDSAVYYCQEWDNTAKEEV
Gadus morhua Vs41 trbv CAEA01132560.1 6937 ASNSDKVHQTPPEMVVAIESRAMAPLKCSHSIQDYNRILWYKQQRNDKQLQFLGYILLEDAKPEKGMAISGSAEKDQIAMLTIQNISMESSAVYFCAAS
Gadus morhua Vs40 trbv CAEA01132560.1 5213 SQQHQVDQTPAAVLEEQNSRGVNLSCEHQIPNHYTILWYQRSQGSNRLELIATVYYKQPTVEANFTGYFSVDGDGEKWSRLELLKPRSPEDTGEYYCAAR
Gadus morhua Vs43 trbv CAEA01132560.1 10302 ASNSDKVHQTPPEMIVAIASKMPTLSCSHSIQGYNRILWYKQHRNDKLLKLLGYMIATDANPEKEMAVVMSGSAEEGKNATLEIQNIIMESSAVYFCAAS
Gadus morhua Vs42 trbv CAEA01132560.1 9190 VSLGIEVHQTPSELIRKPGDSAELVCRHGETNYRVMLWYQQSAGQRNLSLIGHLNYQTSNIESAFKQDFSISGDLSGETTKNASLLVHLKDPESSGVYYCAARL
Gadus morhua Vs45 trbv CAEA01132561.1 2278 EVKGIEFQESGPKIVPDEKAEVVINCSHDDSSRPVMLWYQQKQGSGPLVLLGYNYGATTSNYEDGIKEQFEIKMDDRQSGSLAVREANVTHTAVYFCAAG
Gadus morhua Vs44 trav CAEA01132561.1 731 SLFHPGFPTDLFQRRSTVGSPGETVTLTCSHDDDAVFYLFWYRLRKFGEPLVLVGYVYAEIINTEPQFEHRFVLSGNAKGKINLMIGNLSVEDSGVYYCCSK
Gadus morhua Vs47 trbv CAEA01132561.1 3903 EVHSVIFQQSSAKIVRKGAKGIQIDCSHDESSYLLMYWYQRKDDSPSLTLIGFGYESSTQTYEDRFEEQFKITRESVLQGTLVLTEAAESDSAVYFCAAS
Gadus morhua Vs210 trav CAEA01247980.1 2049 CNGEDRVNQTGEYVIATEGLTVSLRCTFETTDSSPSLFWYKHQTHDFPRFMLRRSTIGEGDNAPEFPKDRFDAQIQIKSVPLRIQNLQLSDSALYYCALR
Gadus morhua Vs0 ighv CAEA01000639.1 36 VKCEQLTQPESLTVRPGQPLTIRCQVSYSLSYWTAWIRQPEGHALEWIGHIDSSSKRVKDSLGSKFSLAVDGSSNTVILQGQNMQPGDSAVYYCARE
Gadus morhua Vs2 ighv CAEA01001256.1 75 VNCEQLTQPEFLTIRPGQPLTIRCQVSYSVSSYYTAWIRQPEGNALEWIGMIKTGGKHQKDSLSSKFSLAVDGSSKTVTLQGQNMQPGDSAVYYCARE
Gadus morhua Vs4 igkv CAEA01005618.1 186 TSSQFTVTQTPVVSFTPGTTVTLTCKINPAVYRDGDGDNMFWYQQKPGEAPKLFIKYTNKLVSPTPARFSGSGSSIDFSLTINGAQREDAAVYHCQS
Gadus morhua Vs187 trbv CAEA01184384.1 489 ASLSDQVRQTPPEMVVAIKSGATVTLNCSHRIENYERILWYKQQNNDKQLKLLGNLFTTTANAENGIDVVMSGSAYKDQMATLTIPNLRVESSAVYFCAAS
Gadus morhua Vs184 igkv CAEA01176523.1 818 LNQAQESPTLVFVESAGLGDTVTLHCESDNTVSSYLYWYKQSPGCFPEMVASKLFESITLKPHINLTLTEGEEGVCVFHLTIQNVTKGDEANYFCQIS
Gadus morhua Vs106 trav CAEA01531890.1 113 LIQAQESPTLVFVESAGLGDTVTLHCESGNTVSSYLYWYKQSPGFFPEMVALKMFESITSKPLINLTLTEGEEGVCVFHLTIQNVTKGDEANYFCQTY
Gadus morhua Vs105 trgv CAEA01531508.1 3344 VVAMAAELTQDQVSWTRGERDAVSFRCTNTDQCSYIYWYQKKEGETFTLILRIQKSNGYLEKGYNHPQKDDFSSVLKENSCELSLQVVKASHSATYYCSCWTSG
Gadus morhua Vs108 ighv CAEA01533311.1 3153 LCAQTITQSEPVVAKLMESHTLTCTYSGLPTSSAFAWIRQNEEKGLEWIAYITGPSGDTKSYSVSVKGRFTISRDNDNQQVHLQMDQLETADSAVYYCAR
Gadus morhua Vs165 trdv CAEA01106564.1 695 LIAGDSISPHNQEVSGKEGASVTLRCSYETSFNNVDLYWYRHRSNQSPQFILWKGARSRSGQQYIPDRRGASMTSRTSTKLTITQLTLADTALYYCALE
Gadus morhua Vs164 trdv CAEA01106564.1 3624 LIAGVSISPDEPKVSGKEGGSVTLRCNYETSSEYVRLYWYRHHSNQAPRFILYKDARSWSTEHIPDTRYESTTSSTSTELTITRLTLADTALYYCALE
Gadus morhua Vs166 trav CAEA01106567.1 1709 CKGEDGVTQTMGDFIGTEGLAVSLDCTFETTDTNPYLFWYKQQINDFPRYVLQRSTFGGKEAEEFPKERFDAEIQNKSVHLRIQNLQLSDSALYYCALR
Gadus morhua Vs204 trbv CAEA01243369.1 3727 EVKGIEFQESGPKIVPDEKAEVVITCSHNDSSRPLMLWYQQKQGSGPLVLLGYNYGATTSNYEDGIKEQFEIKMDDSQSGSLAVREANVTHTAVYFCAAG
Gadus morhua Vs207 trbv CAEA01243369.1 593 EVQSVIIKQSSAKIVRKGAKGIQIDCSHDDSSYPLMYWYQRKDESPSLTLIGFGYESSTQNYEDRFEERLNITRESVLQGTLVLTDAAESDSAVYFCAAS
Gadus morhua Vs169 igkv CAEA01107299.1 1012 TSSQVTVTQTPVVSVTPGTTVTLTCKTNPAVQNGFQLNWYQQKPGEAPKLIIKLADELVSPTPARFSGSGRRTDFSLTINGAQHEDAAVYHCQS
Gadus morhua Vs203 trbv CAEA01243369.1 6730 ASPQHQVDQTPSDVLEEQNSSRVNLSCEHQIPSYDTILWYRRSQGSHQLDLIASVYSSLLTVEASFKGHFTVDGNGMKWSRLELLKPRSPEDTGVYYCAAR
Gadus morhua Vs34 trbv CAEA01132555.1 2874 LSQGFEVHQTPSELIRKPGDSAELFCMHGETDYRVMLWYQQSAGQRDLSLIGHVNYKTSNVENVFIEDFTLSGDLSGETVINSSLLVLLKDHETSGLYYCAARL
Gadus morhua Vs35 trbv CAEA01132556.1 1068 ASPQHQVDQTPSDVLEEQNSSRVNLSCEHQIPSYDTILWYRRSQGSHQLDLIASVYSSLLTVEASFKGHFTVDGSGMKSSRLELLKPRSPEDTGVYYCAAR
Gadus morhua Vs36 trbv CAEA01132556.1 4300 SQQHQVDQTPAAVLEEQNSRGVNLSCAHQIPNHYIILWYQRSQGSNRLELIATVYYKQRTVEANFTGYFSVDGDGEKWSRLELLKPRSPEDTGEYYCAAR
Gadus morhua Vs37 trbv CAEA01132558.1 1121 ATPSNQVHQTPPDMVVAIKSGATVTLNCSHSIENYNTILWYKQQCNNKQLKLLGYIYSTFATPEMGMDGEMSGSAGQHQTARLTIQNISVESSAVYFCAAS
Gadus morhua Vs30 igkv CAEA01121228.1 1262 TSSQVTVAQTPVVSVTPGSTVTLTCKTNPAVYSDGNGQRLHWYQQKPGEAPKLIIKLVNQLVSPTPARFSGSGSSTDFSLTISAAQREDTAVYHCQSYHSGYV
Gadus morhua Vs33 trbv CAEA01132554.1 13435 ASLSDQVHQTPPEMVVAIKSGATVTLNCSHSIKDYDRILWYKQQRNDKQLKLLGNIYSTTANLEKGMNVEMSGSADQDKTASLTIQKISVESSAVYFCAAR
Gadus morhua Vs38 trbv CAEA01132558.1 2867 ASLSDQVHQSPPEMVVAIKSGAKVTLNCSHSIENYEVILWYKQQRNDKQLQLLGYIYSENANPEKGMHVEMSGSAYRNQTARLTILNISPESSAVYFCAAR
Gadus morhua Vs39 trbv CAEA01132560.1 3506 ASLSDQVHQTPPEIVVAIESGPTVTLECSHSIKNYDQILWYKQLRNDKKLVFLGYISSTTKFPEAGVIMSGSADQDQTVELRIQDISVESSAVYFCAAS
Gadus morhua Vs198 ighv CAEA01225805.1 2694 VNCEQLTQPESLTIRPGQPLTIRCQVSYTLNYWTAWIRQPEGHTLEWIGMINTGGKHQKDSLSSKFSLTLDVASKTITLQGQNMQPRDSAVYYCAR
Gadus morhua Vs199 ighv CAEA01225805.1 1263 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYATHWIRQPEGHALEWIGWIHTSDKKVKDSLSSKFSLAVDGSSNTVTLQGQNMQPGDSAVYYCARE
Gadus morhua Vs191 trav CAEA01194221.1 466 DSYQQTIHSMQDRVQPLQGDNVTLSCNYTSADYFFWYLQYPSSPPQFLIKEYMVKSRFTLKKYDDRLLFALEISSVAVTDSALYYCAVRPTVTG
Gadus morhua Vs192 trbv CAEA01199501.1 1894 SQQHQVDQTPAAVLEEQNSSRVNLSCKHQIPSYDTILWYRRSQGSNRLDLIAYVSYKQPTVEANFTGYFSVDGDGEKWSRLELLKPRSPEDTGEYYCAAR
Gadus morhua Vs193 trbv CAEA01199501.1 461 FVLSSLDINQSPRHLLTARDLGNVTLHCRHGDSDYPYVFWFQHWTVQGTGRHMVMVGRIYHNTAQMELGFNARFGITGDAKADVNLTITQVHQSDTAQYFCAAS
Gadus morhua Vs115 trav CAEA01538536.1 730 SLFHPGFRTDLFQRRSTVGSPGETVTLTCSHDDDAVFYLFWYRLRKFGEPLVLVGYVYAENINTEPQFEHRFVLSGNAKGKINLMIGNLSVEDSGVYYCCSK
Gadus morhua Vs116 trbv CAEA01538536.1 2486 EVKGIEFQESGPKMVPDEKAEVVITCSHNDSSRPLMLWYQQKQGSGPLVLLGYNYGATTSNYEDGIKEQFEIKMDDRQSGSLAVREANVTHTAVYFCAAG
Gadus morhua Vs290 ighv CAEA01542676.1 1609 VRGQQLTSSESVVKRQGESVTLSCHVTGVSLTYLHWIRQRSGHGLEWIGWIDSGTGTAFAASLQGQFTITKDSTREEVYLNVKSLKPEDSALYYCAKE
Gadus morhua Vs297 igkv CAEA01548580.1 307 YSQVTVTQTPVGSVTPGSTVTLTCKTNPAVLNNNYLFWYQQKPGEEPKLIIKYINQLISPTPARFSGSGHMADFSLTINGAQREDAAVYHCQS
Gadus morhua Vs294 igkv CAEA01545408.1 1967 TSSQVTVTQTPVVSIAPGSTVTLTCKTNPAVYRDDDGDDCMFWYQQIPGEAPKLIITYTSTLVSSTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua Vs279 trav CAEA01537924.1 3460 ESHQQTINSTQDGVQALQGDSVTLSCQYSLATNLFWYRQYPSSPPQFLIKEYMEVSGFTLKKDSKRQMVALEISVAAVTDSALYYCALQPTVTG
Gadus morhua Vs278 trav CAEA01537923.1 3650 PSVEDSISQPKDVQRAVEDAAVVLSCSYVSSVVNSLLWYRQYPGSPPQFLIMEYSGIITNPIPGMIITHIKQQKLVELLISSAAVTDSALYYCALQ
Gadus morhua Vs174 ighv CAEA01147503.1 1795 VNCEQLTQPESLTIRPGQPLTIRCQVSYSVGSWTAWIRQPEGHALEWISMINTGGKHQKDSLSSKFSLTLDVASKTITLQGQNMQPGDSAVYYCARE
Gadus morhua Vs173 trav CAEA01145649.1 734 PSVEDSISQQKDVQRAVEGAAVVLSCSYNSSVVSSLLWYRQYPGSPPQFLIREYSGYITNPIPGMNITHIKNQRLVELLISSVAVTDSALYYCALR
Gadus morhua Vs271 trav CAEA01537922.1 2457 YEGEERVILTGEVVIATQGLRDSLGCTFETIGKSPSIFWYKQQLNDLPRFMLQSSTHGSGINTAEFHKDRFDAQIQNTSVPLSIHNLQLSDSALYYCALK
Gadus morhua Vs270 trdv CAEA01537921.1 2361 LIAGDSIAPANPEVSGKEGASVTLRCSYETSSESVLLYWYRHRSNQAPQYILYKGARSYSSSQNIPDRRYASTTSRTSTELTITQLTLADTALYYCALE
Gadus morhua Vs273 trav CAEA01537923.1 19805 YSYQQTIHSIQDSPVQALQGDGVTLSCNYSSATNLFWYRQYPNSPPQFLIKDYMELSGFTLKKESDKQMFHLEISSAAVTDSALYYCAQQPTVTG
Gadus morhua Vs272 trav CAEA01537922.1 723 PSVEDSISPQKDVQRAVEGAAVVLSCSYNSSVVSSLLWYRQYPGSPPRFLIMEYSGYITNPIPGMNITHIKQQRLVELLISSAAVTDSALYYCALQ
Gadus morhua Vs275 trdv CAEA01537923.1 17843 LIAGDSISPDGVQKVSGKEGGSVTLRCTYETSYNYVRLYWYRHHSNQAPQFILWKGARSWSDEHIPDTRYESTTSRTSTELTITQLTLADTALYYCALW
Gadus morhua Vs274 trav CAEA01537923.1 18785 CKGEDSVNQISEVIATEGHTVSLQCTFGTDYTPYLFWYKQQRNDFPRFVLQRSTLGGKEAEEFPKERFDAQIQNTSVPLRIKNLQLSDSALYYCALR
Gadus morhua Vs277 trav CAEA01537923.1 5274 DSYQQTIHSIQDRVPALQGDGVTLSCSYSSATNFFWYRQYHSSPPQFLIKDYMELSGFTLKKDSEKQKMFHLEISAAEVTDSALYYCAVLCSPQ
Gadus morhua Vs276 trav CAEA01537923.1 13361 CNGEDRVNQTGEYVFATEGLTVSLRCTFETTDSSPSLFWYKQQTHDFPRFMLRRSTFGGDNAPEFRKDRFDAEIQIKSVPLSIQNLQLSDSALYYCALR
Gadus morhua Vs26 ighv CAEA01113479.1 69 VDCEQLTQPESLTIQPGQPLTIRCQVSYSVSTYATHWIRQPEGHALEWIGYIYTGGKRVKDSLSSKFSLAVDSSTKTVTLQGQNMQLGDSAVYYCARE
Gadus morhua Vs269 trav CAEA01537921.1 3329 PSVEDSISPQKDVQRAVEDAAVVLSCSYNSSVVSSLLWYCQYPGSPPQFLIMEYSGYITNPIPGLNIKRIKQQRLVELQISSAVTNSALYYCALQ
Gadus morhua Vs29 ighv CAEA01118116.1 1296 VNCEQLTQPESLTVRPGQPLTILCQVSYSVSSYYTHWIRQPDGKGLEWIGGISTGWKGAKDSLSSKFSLSLDEASKTVTLQGQNMQPGDSAVYYCARQ
Gadus morhua Vs28 ighv CAEA01118116.1 92 VNCEQLTQPESLTIQPGQHLTIHCQVSYSVSTYGTHWIRQPEGHALEWIGWIYTGDKKVKDSLSSKFSLAVDGSSNTVTLQSQNMQPGDSAVYYCARE
Gadus morhua Vs284 ighv CAEA01539055.1 3630 MNCEQLTQPESLTVRPGQPLTIRCQVSYSLSYWTAWIRQPEGHALEWIGHIDSSSKRVKDSLGSKFSLAVDGSSNTVLLQGQNMQPGDSAVYYCARE
Gadus morhua Vs286 trav CAEA01542222.1 3351 PSVEDSISQQKDVQRAVEGAAVVLSCSYNSSVVSSLLWYRQYPGSPPQFLIREYSGYITNPIPGMNITHIKKQRLVELLISSAAVTDSALYYCALQ
Gadus morhua Vs280 trav CAEA01537924.1 1773 CKGEDSVNQISEEVIATEGHTVSLQCIFETDSTPYLFWYKQQRNDFPRFVLQRSTFGGKEAEEFPKERFSAQIQNTSVPLSIQNLQLSDSALYYCALK
Gadus morhua Vs281 trgv CAEA01537929.1 2012 VVAMAAELTQDQVSWTRREGENVTFRCTDTDQCGLIYWYQKKEGETLAVILSFEKSLGQLQKGFNHPQEDDFSSVLKDNSWELSLQKVKASHSATYYCSCLTSG
Gadus morhua Vs256 iglv CAEA01487787.1 1011 LEAALVLTQEKTLSVNRGDNVKISCTETDSSGNYLLTWYQQKSGSPPKYLLYTTGSRASGVPSRFTTSGTRGDKTEYLLINGIQDEDEATYYCA
Gadus morhua Vs288 trdv CAEA01542222.1 1361 LIAGDSISPDEQKVSGKEGVSVKLRCTYETSSENVRLYWYRHHLNQAPQFILYKGARSWSSEHISDRRYQSTTSRTSTELTVTQLTLADTALYYCALE
Gadus morhua Vs86 igkv CAEA01386289.1 47 TSSQVTVTQTPVVSVTPGSTVTLTCKTNPAVYRWSDGDEGMSWYQQKPGEAPKLFIKFANKLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua Vs98 ighv CAEA01469871.1 50 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTAWIRQPEGHALEWIGWIHTGGKRVKDSLSSKFSLTLDEASKTITLQGQNMQPGDSAVYYCARE
Gadus morhua Vs99 trav CAEA01489219.1 81 ESHQQTIHSIQDSPVQALQGDGVTLSCNYSSATYFFWYRQYPSSPPQFLIKEYMELSGFTLKKDSERKVFALEISSAAVTDSALYYCAVQPTVTG
Gadus morhua Vs92 igkv CAEA01432638.1 89 LIQSQEEPRLIFVKSAGLGDNVTLHCEAKEKKIHYLYWYKQSPGYFPQMVASKSYGSITMKPHFDLRFTMEEGASDFNLILQNVTEGDEANYFCSQS
Gadus morhua Vs93 ighv CAEA01433246.1 397 VNCEQLTQPESLTVRPGQPLTILCQVSYSVSSHYTAWIRQPDGKGLEWIGYEGNLKDSLGSKFSISVDGSSNTATLQGQNMQPGDSAVYYCAR
Gadus morhua Vs90 igkv CAEA01420704.1 51 TSSQLTVTQTPVVSVTPGSTVTLTCKTNSAVFSKDFLHWYQQKPGEAPKLIMKYVKTLVPPTPARFSGSGRNTAFSLTITGAQREDAAVYHCRS
Gadus morhua Vs18 igkv CAEA01079534.1 1232 TSSQVTVTQTPVVSFTPGSTVTLTCKTNKAVAGNTYLFWYQQKPGEAPKLIIKLVNELVSPAPARFSGSGSSTDFSLTITGAQREDAAVYHCQSAHSGPV
Gadus morhua Vs152 trgv CAEA01045636.1 1969 ELTQDQVSWTRREGEAVSFRCTDTDQCTGSYIFWYQKKESETFTLILDIGKSNGALDKSYNHPQKDDFSSVLKENSWELSLQLVKASHSATYYCSCWTSG
Gadus morhua Vs171 trav CAEA01120240.1 533 TSSQMTVTQTPVVSFTPGSTVTLTCKTSTAVHNNDFLYWYQQKPGEEPRLLITRVSTLVSPTPARFSGSGSSTDFSLTITGAQREDAAVYHCQSYINNYVF
Gadus morhua Vs121 ighv CAEA01539551.1 1261 VNCEQLTQPESLNVRPGQPLTIRCQVSYSVSTYSTAWIRQPEGHGLEWIGWIYTGGKHQKDSLSSKFSLAVDGSSNTLTLQGQNMQLGDSAVYYCARE
Gadus morhua Vs120 ighv CAEA01539549.1 4039 VNCEQLTQPESLTVRPGQPLIIRCQVSYSVSSYSTHWIRQPDGKGLEWIGGISTVWKGVKDSLNSQFSLTLDVASKTITLQGQNMQPGDSAVYYCARE
Gadus morhua Vs123 ighv CAEA01539552.1 5098 VRGQQLTSSESVVKRQGEPVTLSCHVTGVSLTYLHWIRQRSGHGLEWIGRIDDGTGTIFAASLQGQFTITKDSTREEVYLNVKSLKPEDSALYYCAKE
Gadus morhua Vs122 ighv CAEA01539551.1 2490 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTHWIRQPEGRALEWIGRIVPAGKTVKDSLSSKFSLAVDGSSNTVTLQGQNMQPGDSAVYYCARE
Gadus morhua Vs125 trav CAEA01539821.1 2903 CKGEDRVNQISEVIATEGHTVSLQCTFETDYTPYLFWYKQQINDFPRFVLQRSTLGGKEAEEFPKERFDAQIQNTSVPLRIQNLQLSDSALYYCALK
Gadus morhua Vs124 trdv CAEA01539821.1 657 LIAGDSISPDEPKVSGKEGASVTLRCSYEISYNYVYLYWYRHLSNRAPQFILWKGARSQNNEHIPDTRYQSTTSRTSTELTITQLTLADAALYYCALE
Gadus morhua Vs127 trav CAEA01540564.1 2138 LIQAQESPRLVSMESAGLGDTVTLHCEAQQMDCSNLYWYKQCLGCYPEMVASKVFQVATMKPHINLTLTEVEGACVFNLIIQNVTKGDEANYFCQQ
Gadus morhua Vs126 trav CAEA01540562.1 4055 LIQAKESPPSVFVESAGLGDTVTLHCECGDTDSNYLYWYKQSPGCLPEMVATKLFEWYTWKPPIYLMLERTEGEEGVWVFHLIIPNVTKGDEANYFCQSY
Gadus morhua Vs75 igkv CAEA01315788.1 539 MTQTKEDPQSLFLKEAKLGDTVALGCAVLKDENNFPQLFWYKQSLGHNPQMVARRYQKSFISPSFMPRFTAGNGSNFNLTISNVKKEDEANYFCNQGGIY
Gadus morhua Vs85 ighv CAEA01385926.1 1523 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYYTAWIRQPEGHALEWIGWIYTGGKRVKDSLSSKFSLAVDGSSNTVTLQGQNLQPGDSAVYYCARE
Gadus morhua Vs84 ighv CAEA01385926.1 292 VNFEQLTQPGSLTVRPGQPLTIRCQVSYSVSTYSKAWIRQPEGHGLECIGWIYTGGKHQKDSLSSKYSLAVDGSSNTLTLQGQNMHPGDSAVYYCARE
Gadus morhua Vs254 trav CAEA01483777.1 588 CEGEERVILTGEVVIATQGLRDSLGCTFETIGKSPSIFWYKQQLNDLPRFMLQSSTHGSGINTAEFHKDRFDAQIQNTSVPLRIQNLQLSDSALYYCALK
Gadus morhua Vs251 igkv CAEA01450434.1 2845 LIQSQEEPRLIFVKSAGLGDNVTLLCEAKDTNINYLYWYKQSPGYFPQMVASRSYGSITMKPHFDLRFTMEEGASDFNLIIQNVTKGDDEANYFCRQY
Gadus morhua Vs250 igkv CAEA01450433.1 1376 LIQSQEEPRLIFVKSAGLGDNVTLHCEAKDKNVNYLYWYKQSPGYFPQMVASKSYGSITMKPHFDLRFTMEEGASDFNLIIQNVTKGDEANYFCRQY
Gadus morhua Vs258 iglv CAEA01491068.1 534 LEAALVLTQEKTLSVNRGANVKISCTETDSSSNYVLTWYQQKSGSPPKYLLATTGSRASGIPSRFTGSGTTNDKTEYLLINGIQDEDEATYYCACVGCGA
Gadus morhua Vs237 igkv CAEA01390159.1 289 TSSQVTVTQTPVVSVTPGSTVTLTCKTNSAVYDGDELYWYQQKPGEAPKLIMKLVNQLVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQC
Gadus morhua Vs132 ighv CAEA01542895.1 50 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSSWTHWIRQPEGHALEWIGRIYTGDKKVKDSLSSKFSLVVDDSSSTVTLQGQNMHPGDSAVYYCARE
Gadus morhua Vs133 trav CAEA01543061.1 848 LIQAKESPPSFFVESAGLGDTVTLHCECGDTDSNYLYWYKQSPGCLPEMVASKLFESITLKPHINLTLIEGKEGVCVFHLIIQNVTKGDEASYFCQSY
Gadus morhua Vs239 ighv CAEA01399155.1 822 VNSEQLTQPESLTIQPGQPLTIRCQVSYSVSSHYTAWIRQPEGHTLEWIGQIYTGNKLMKDSLSSKFSLTLDVASKTITLQGQNMQPGDSAVYYCARE
Gadus morhua Vs245 iglv CAEA01436438.1 1012 LEAALVLTQEKTLSVNRGDNVKMSCTETDSSGNYVLSWFQQKSGSPPKFLLTTTSSRASGVPSRFTYSGTRNDKTEYLLINGIQDEDEATYYCACVSCGT
Gadus morhua Vs246 ighv CAEA01436521.1 1152 VNCEQLTQPGSLTVRPGQPLTIRCQVSYSVSSHYTAWIRQPDGKGLEWIGDEGHLKDSLSSKFSISVDEASNTATLQGQNMQPVDSAVYYCAR
Gadus morhua Vs247 igkv CAEA01441110.1 554 TSSQVTVTQTPVVSFTPGSTVTLTCKTNPAVYSDAYGQRLNWYQQKPGEAPKLIMKLANQRVSPTPARFSGSGSSTDFSLTINGAQREDAAVYHCQS
Gadus morhua Vs56 ighv CAEA01161293.1 1969 VNSEQLTQPESLTVRPGQSLTIRCQVSYSVSSHYIAWIRQPEGHGLEWIGQIYTGAKYQKDSLSSKFSLSLDEASKTGTLLGQNMQPGDSAVYYCARE
Gadus morhua Vs227 igkv CAEA01363960.1 762 TTSQVTVTQTPVVSVTPGSTVTLTCITNPAVYRDSDGDDFMFWYQQKPGEAPKLIIRYANRLQSSTPARFTGSGSRTDFSLTINGAQREDAAVYHCQS
Gadus morhua Vs53 trdv CAEA01155105.1 229 LIAGDSIAPAKPEVGGKEGASVTLRCSYETSEDYVYLYWYRHRSNQAPLYILLKGARSSSGQQNIPDTRYASTTSRTSTELTITQLTLSDTALYYCALR
Gadus morhua Vs221 ighv CAEA01285470.1 340 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTYWIRQPEGHALEWIGWIRTDGKKVKDSLSSKFSLAVDGSSNTVTLQGQNLQPGDSAVYYCARE
Gadus morhua Vs228 iglv CAEA01365148.1 753 LEAALVLTQEKTLSVNRGDNVKISCTETDSSSNYVLSWYQQKSGSPPKYLLYTTGDRASGVPSRFTTSGTRGDKTEYLLINGIQDEDEATYYCACDDCSA
Gadus morhua Vs283 ighv CAEA01539055.1 12037 VNCEQLTQPGSLTIQPGQPLTIRCQVSYTLNYWTHWIRQPEGNSLEWIGFIYTGDKKVKDSLSSKFSLSLDEASKTVTLQGQNMQPGDSAVYYCARE
Gadus morhua Vs211 trbv CAEA01252297.1 488 ASLSDQVRQTPPEMVVAITSGATVTLNCSHRIENYERILWYKQQHNDKQLKLLGNLFTTAANTEKGIDVVISGSAYKDQMATLTIPNIGVESSAVYFCAAS
Gadus morhua Vs5 igkv CAEA01007606.1 1321 TSSQVTVTQTPVVSFTPGSTVTLTCITNPAVYRWGDGDEDMFWYQQKPGEAPKLIIKYAKKLVSPTPARFSGSGSSTDFSLTINGAQHEDAAVYHCQS
Gadus morhua Vs57 ighv CAEA01161295.1 3051 VNCEQLTQPESLTVRPGQPLTIRCQVSYSVSSYWTAWVRQPEGHGLEWIGWIYTGGKHQKDSLSSKFSLVVDGSSNTVTLQGQNMQPGDSAVYYCAGE
Gadus morhua Vs287 trav CAEA01542222.1 2288 CKGGDGVTQPREDVIATEGLTVSLDCTFVTMSTNVYLFWYKQQVNDFPRFILRRFTIGEGDNAEEFHKDRFGAKIQNTSVPLRIQNLQLSDSALYYCALR