WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Daubentonia madagascariensis AGTM000000000.1 (AGTM01) 88 4 10 10 35 17 6 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Daubentonia madagascariensis V19 trav AGTM010748583.1 120 GTNGDSVTQTEGPVTLPEGEALTLNCTYQSSYAAFLFWYVQFQNKEPVLLLKSSSETQEMDSRGFQANNVKSDSSFHLKKPSVQLSDSAVYYCAMR
Daubentonia madagascariensis V22 trgv AGTM011099715.1 85 HLEQPQLSSTKTLSKTARLECVVSEGTISAKSIYWYQERPDEVIQLLAYVLPNDTVRMAPGIASNKFEVDRIPEASTSTLTIHNVEKQDSTIYYCASWE
Daubentonia madagascariensis V26 trbv AGTM011518675.1 4233 SVFAALLSQKPSRDICQRGTSVTIQCQVDSQLAMMFWYRQLPGQNLMLIATANQGSEATYESGFTKDKFPISRPNLTFSTMTVSNVSPEDSSLYFCSVG
Daubentonia madagascariensis V32 trbv AGTM011523635.1 7179 SMDTEVTQIPTYLVKGKEQKTKMDCVPKKGHSYVYWYHKKLEEELKFLIYFQNEDIIEKTEKINERFSAQCPKNSPCSLEIQSTEFGDSALYFCASSQ
Daubentonia madagascariensis V33 trbv AGTM011523635.1 15648 SFDAKVTQTPGHLVKEKGQKAKMDCIPQKGHTFVYWYQQSQNKEFKFLMFFQNEQVLDQTEMYKERFSAECPPNSLCSLEILSSELGDSALYFCASSQ
Daubentonia madagascariensis V34 trbv AGTM011524347.1 1509 PVDAGVIQSPRHLIKGKQEAAILKCYPLSGHNTVYWYQQAPRQEPQFLISYYEKMQRAKGSIPHRFSAQQFTDYHSELNLSSLELGDSAQYLCASSL
Daubentonia madagascariensis V56 trav AGTM011536481.1 13294 SSVAQTVTQSQPEMSVREAETVTLDCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSLSLKISASQLGDAAMYFCAFMG
Daubentonia madagascariensis V58 trbv AGTM011536724.1 15683 PTVAGVTQTPRHEVTEMGKAVTLRCEPISSHTTIYWYRQTAVQGLEFLIYFNNREPIDDSGMPKDRFSAEMPDTSFSTLKIQPAEPRDSAVYLCASSL
Daubentonia madagascariensis V65 trav AGTM011540733.1 4263 GSKGDSVTQTEGQMLLSEGASLTLNCSYESTQYPALFWYVQYPGEGPQILLKAAKANDKGSNKGFEATYKKETTSFHLEKASVHESDSAVYYCALS
Daubentonia madagascariensis V82 iglv AGTM011550087.1 5335 TWAEVVFTQPQYVSGSPGQKVTISCTRSSGNIGSNYVYWFQQRPGSAPTNVIYKYDQRPSGVPDRFSGSKDNSANAAYLTISELQAGDEADYHCLSGYDNYY
Daubentonia madagascariensis V85 trdv AGTM011551521.1 2122 KGMLCNKVTSGQMVASGTEVTLHCTYKVGFSNPDLFWYQIRADYSSQFILYKGATRSLDAAFTQSWFSVKHSWTQKASYLVISPVRTKDSDSYYCFS
Daubentonia madagascariensis V87 trdv AGTM011552694.1 1425 SSMSQKVTQARAAISMLKKKAVTLDCVHEAITFSYYLFWYKQSPNGEMILLIDQESFNEQNATKGRYSLNFQKPTSSISLTITALQLGDSAMYFCALRE
Daubentonia madagascariensis V92 trav AGTM011559637.1 2807 LRGEVKVEQSPLSLITQEGDDCTIYCNYSSSASDRLHWYRQDPGESLEFLFVLLSNGAVKQEGPLTASLDTKARLSTLHIAAPQRGLSATYFCAM
Daubentonia madagascariensis V100 igkv AGTM011567613.1 6449 ARCDIQMTQSPSSLSASLGDTVTLTCQASQDISSYLNWYQQKPGTPPKPLIYGASRLQSGVPSQFSGSGSRTNYALTIRGLETEDVATYYCQHGYSYP
Daubentonia madagascariensis V102 ighv AGTM011568321.1 3967 VLSEDHLVQWGEGVVVSSQKLSLTCAAYTRSVSEYSVSWVRLLQGKGLEWIGVIWANGNTYYRPNLQSRVSISRNTSKNQVSLELRGVTAKDAGTYYCAQ
Daubentonia madagascariensis V106 igkv AGTM011571890.1 11600 ARCDIQMTQSPSSLSVSVGDTVTLTCRASQGISSWLAWYQKKPGKPPKPLVHTASSLYSGVPPRFSGSGSGTDFTLTISSLKPEDVATYYCQQYSSSP
Daubentonia madagascariensis V107 trbv AGTM011572299.1 7588 PVDTGITQIPKYLVTVVGSKRTLKCEQHLGHNSMYWYRQNTKKSLELMFVYNYKKLVENVTVPNRFTPDYPGSSLLYLHVDALEPQDTAMYLCASSK
Daubentonia madagascariensis V108 trbv AGTM011572299.1 9055 HTEPGVIQTPTHQVTEMGQGVILRCNPISGHLYFYWYRQILGQKVEFLVSFYNDNISEKSEIFKDRFSVERPGRSYFALKIQSTKLEDSAMYLCASSS
Daubentonia madagascariensis V117 trbv AGTM011585065.1 6817 LKDAIVTQFPRHRIIGTGKELTLQCSQNMNHFSMYWYRQDPGYGLQLLYYSPSTESIEKGDVPEGYRVSRNKTEYFPLTLESSSTKQTSVYLCASSS
Daubentonia madagascariensis V120 trgv AGTM011587524.1 4881 GLGQLKQPEISVSAATDKSAHISCKASIQNFNSVPIHWYRQKPNQGLEHLTSVTSITSAQDRKTSKLKAIKDSLTSTSTLTINFLEKEDEAMYYCACW
Daubentonia madagascariensis V142 igkv AGTM011612522.1 8789 SSGDIVLTQSPASLAVSLGEKATITCRASQSVKIMLGIISSMHWYQHKPGQAPKLLIYGASNQASGVSARFSGSGSGTDFTLTIHPVEADDAANYYCQQGKELP
Daubentonia madagascariensis V149 trav AGTM011621271.1 3180 VNSQKIEQNPQSLSVHEGETAAVTCNYTNFSPDTFQWYRQDPGRGLVFLLLIRENEGEKQEGRLRVTFDTTLKQSSFHTTASQPADSATYLCAA
Daubentonia madagascariensis V151 trav AGTM011621691.1 1819 ITGDAKTTQPSSIESTEEEPVYLPCNHSTISGSEYIYWYQQIPLQGPEYVIRGLKSNVTDRMASLAISADRKSSTLILPHVTLGDTAVYYCIVR
Daubentonia madagascariensis V179 trbv AGTM011645241.1 669 HTEAGVSQSPRYKVIEKGQDVTLRCDPISGHIRLYWYQQTLGQGPEFLIYFQNKEAPDKSGLPSDRFSAERPEGSFSMLKIQPAERGDSAMYLCASSL
Daubentonia madagascariensis V205 trav AGTM011686532.1 4821 DARAQTVTQPDLYITLSEGALLELRCNYSYGAELTLFWYVQYPGQGLQLLLRYYSGNTLVQGIKGFEAEVRKSESSFNLRKPSVHWSDAAEYFCAVS
Daubentonia madagascariensis V209 trav AGTM011691335.1 1936 VSSKQEVMQIPVALSVPEGGSFVLNCSYTDSAIYNLQWFRQDSEKGLTHLLLIQSNQREQMSGRLKASLDKSSRHSTLYIAASQPGDSATYLCAV
Daubentonia madagascariensis V216 trav AGTM011704082.1 6685 TIIDAKTTQPKSMDCAEGGAVNLPCNHSTISGNEYIHWYRQTPSQSPQYVVHGLQNTVTNDMASLTIAADRKSSTLILPQVTLRDTGMYYCIVR
Daubentonia madagascariensis V219 trbv AGTM011708689.1 2799 ARAQTIHQWPAARVQPVGSPLSLECTVKGTSNPNLYWYRQATGGPPQLLFYSIGVGHIESGVPQNLSASRPQGGQFILNSKKLLLSDSGFYLCACS
Daubentonia madagascariensis V222 ighv AGTM011713310.1 2530 VLSLTLQESGRGLVTPSQTLSLTCSVSGGSVTSSNYWNWIRQRPRKALEWMGYWTGSTRYNPAFQGRISITADTSKNQFSLQLTSVTAEDTAVYYCA
Daubentonia madagascariensis V224 trav AGTM011714487.1 2393 RTHGDSVIQKEGQMTLSEGAFLTINCTYTATGYPALFWCVQYPGEGPQLLLTAMKANDKGINKGFEATYKRETTSFHLEKASVHGSDSAVYYCALS
Daubentonia madagascariensis V227 trav AGTM011719922.1 8681 RTHGDSVSQKEGQMTLSEGAFLTINCTYTATGYPTLFWYVQYPGEGPQLLLKAMKANDKGINKGFEATYNGKTTSFHLEKASVHMSDSAVYYCALS
Daubentonia madagascariensis V229 trav AGTM011723760.1 4128 GVRGLHVEQSPSALSLQEGTSPTLRCNFSGTMYNMQWFRQNPKGSLTSLFFMTSGTKQNGRLKSTINSKELYSTLLITATQMEDSGTYLCAAE
Daubentonia madagascariensis V238 iglv AGTM011733173.1 736 SVSSYELTQPPSVSVSLGQTARITCSGDLLEKRYTQWLQQKPGQAPVLMIYKDSERPSGTPERFSGSSSGTTVTLTITGVQVEDEADYYCQSSESNGPI
Daubentonia madagascariensis V246 iglv AGTM011750189.1 175 SLSQPALTQPPSASASLGASVKLTCTLSSGHSTYTIAWHQQQPGKAPRYLMWLNSAGSSGKGDGIPDCFLGSSSGAHCYLNISNIQSEDEADYICAVSHSIGV
Daubentonia madagascariensis V261 trdv AGTM011787934.1 3915 VMPAFVLVPQDQAVTVPIGGSTTLRCSMQGETISNYYINWYRKTQGSTLTFIYRESDTYGFGFRDRFQGGNDIQKNQAVLKILKASESDEGFYYCACD
Daubentonia madagascariensis V265 igkv AGTM011791943.1 10510 ARCDIQMTQSLSSQSASPGDTVTITCQASQGISSWLSWYQQKPGNPLKPLIYGTSSLETGVPSRFRGSGSGTDYSLTITGLQPEDAANYYCQHYRNFP
Daubentonia madagascariensis V276 trdv AGTM011804279.1 1337 PSMAQKVTQAQPEISVVEKEGVTLDCVYETRDVTYYLFWYKQPPSGEIIFLIRQDSFNEKNETKGRYSLNFQKSTSSISLTITASQLTDSALYFCALRE
Daubentonia madagascariensis V291 iglv AGTM011840594.1 158 SVSSYELTQPPSVSVALGQTARITCGGNSIGSKSVQWYQQKPGQALVLVIYGDSNRPSGIPERFSGSNSGNTATLTISGAQAGDEADYYCQVWDS
Daubentonia madagascariensis V296 trgv AGTM011854696.1 5393 GLGLSKVEQSHISVSAEVMKSINIHCKISSACFKTEVIHWYQQKPNQALKHLVQVTSTKSPVQVPSKERKDKVVAKMYPRSSTSVLTINSVQKEDMAIYYCAGWY
Daubentonia madagascariensis V307 iglv AGTM011902849.1 2706 SWAQSGLTQEASVSGSVGQKVTLSCTGNSNNVRRYSVGWYQQISRGVPKTVKVGSSRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCSAWDGSLNA
Daubentonia madagascariensis V309 igkv AGTM011944700.1 376 SDGDIVMTQTPLSLSVTPGEPASISCRASQSLLHSDGNTYLNWYLQKPGQSPQPLIYLVSNRLSGVPDRFTSSGSGTDFTLKISRVGAEDVGVYYCQQGLQVP
Daubentonia madagascariensis V313 trav AGTM011996534.1 770 VSSQGPEQSPRSLIIQEGEDLTINCNSSKTLYGIHWYRQKYGEGGLIFLMLLHKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHSGMYLCGAE
Daubentonia madagascariensis V352 trav AGTM012932343.1 621 TLSLAKTTQPISMNSYEGQEVNISCSHTNIATDEYIFWYQQFPNQGPRLIIQGYKTNVTNEVASLFIPADRKSSTLRLSRGALSDTAVYYCIVA
Daubentonia madagascariensis V354 iglv AGTM012938310.1 91 SWGQSVLTQGASASGSVGQKVTLSCTGNSNNIGAYTVSWYQQICPSAPQTGSPWPSGIPDRFSGSKSGNTASLTISGLQPEDETDYYCSTWDT
Daubentonia madagascariensis V363 ighv AGTM013009384.1 18 AHSQVQLVQSGAEVRQPGGSVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGYIDPSNGGTGYAQKFQGRVTMTRDTSTSTAYMEMRSLRSEDTAVYYCAR
Daubentonia madagascariensis V369 igkv AGTM010362291.1 356 LKMGNGVTQSPADLALYPGDRTTITCKTNPSEKTKFSWYQQRPGQVPKVLVYDTSTQASGVPTRFSGTHSGTDFTLTISNMDTDDAGTYYCHEWPG
Daubentonia madagascariensis V400 trdv AGTM011532587.1 2903 STVAQKVTQAQTATSMTVGRAVTLNCLYETSWSTYYIFWYKELPSKEIIFLLRQGYSEQNVRNGRYSVNFRKEAKSIDLTISALRLEDSAKYFCALAE
Daubentonia madagascariensis V402 igkv AGTM011532750.1 3642 SRGEIVLTQSPAFLSGTPGEKATLTCWASQGISSNLHWYQQKPDQAPKLLIKYASQSILGVPSRFSGRGSGADFSLTTSSLEAEDAATYYCQQNNNY
Daubentonia madagascariensis V419 ighv AGTM011541225.1 2570 AHSQVQLVQSGAEVRQPGASVKVSCKASGYTFTSYAMHWVRQAPGQGLKWMGYVNTNTGGTGYAQKFQGRVTMTRDTSTSTAYMELRSLRSEDTAVYYCAR
Daubentonia madagascariensis V437 trgv AGTM011548791.1 1202 TQTSSNLEGRMSVTRKTGSSVIITCDILERGTNYIHWYLPQEGKAPRRLLYHDFLNSLVMAESGISPRKYHAYASTGRSARFILQNLEESGSGVYYCASWV
Daubentonia madagascariensis V438 trbv AGTM011549230.1 7333 LTNAGVSQNPRHLVRRRGQEAILTCSPMKGHSHVYWYRQLLGEGLKFMIYLQKERIIDESGMPMKRFSAEFPKEGPNTLQIQQAEPGDSAVYFCASS
Daubentonia madagascariensis V439 trbv AGTM011549230.1 381 SGLGALVSQHPSRAICKSGASVKIECHAMDFQATTMFWYRQFPKQSFMLIATSNTGSDGTYEPGFNKTKFPISHPNLTYSALMVTSAHPEDSSFYICSGS
Daubentonia madagascariensis V442 trbv AGTM011551369.1 7240 SPDEVAQTPGHLLKGKGQKVKMYCVPKKGHRYVCWYQQIPKKEFKFLVSFQNEEVLDETEMPKERFSAECPENSRCSLQIQTAELQDSAVYLCASSE
Daubentonia madagascariensis V453 trav AGTM011559890.1 4331 VSSEDKVVQSPPSLAVHEGDSTTLSCGYEVTNFQSLQWYKQEKNAPTFLFTLISSGIEKKSGRLSSILDKKELLSTLNITATQTRDSAIYLCAVK
Daubentonia madagascariensis V455 trbv AGTM011561246.1 4989 LVGTKVTQTPRHLVRRMGEKVLLECLQDMDHRRMFWYRQDPGLGLRLIYFSHDVDSNEKGDVPEGYSVSRKKKEHFSLVLESASTNQTSVYLCASSL
Daubentonia madagascariensis V460 igkv AGTM011563509.1 2830 TTGNTVLIQFPDLLSASVGDSVSINCKANQDISDYLSWYQKKPGQAPKPLIYDADNRYSGVSSRFTGMQSGTEFILTISSVEADDDAAYYCQQDYTVP
Daubentonia madagascariensis V462 trav AGTM011566999.1 1979 SGIAQKVAQAMLVQEKEDMTLDCTYDTRESSYGLFWYKQPSGGEMILLIRQNSYNQQNATEGRYSLNFQKANKSINLVISASQLGDSAIYFCALRE
Daubentonia madagascariensis V464 trbv AGTM011567535.1 2161 WSHPNSKTFDQSKRTASEVTLRCSPISEHLSVSWYQQTLGQGLQFLFEYYNELQRAKGNFPDRFSGHQFRDYRSELNVSALELGDSALYLCASSL
Daubentonia madagascariensis V483 trgv AGTM011574881.1 11597 GSCRTEITQSSNTATKIESDVKYQCQYNIPDGNYDAAYWYLQRANQRLTYICHAVQGTVESDYYQQSVHGNLSSSTLSIKHTQPRDKAIYYCALW
Daubentonia madagascariensis V488 trbv AGTM011578596.1 651 HTDAGITQNPRHKVTETGKQVTLTCRQTENHNYMYWYRQDVGHGLRLIHYSVGKDIIDKGEVPEGYSVSRSNTEDFPLTLESATRSQTSVYFCASSD
Daubentonia madagascariensis V496 trav AGTM011587413.1 6289 VSSMLNVEQSPRSVHVQEGESTNFTCSFPDSLFSALYWYRWEAAKSPKTLFVMTSNGDEKKEGRISVTLNTKEGYSYLYIKGSQLEDSATYLCAV
Daubentonia madagascariensis V510 trav AGTM011594120.1 9642 GTRAQSVTQPDGHITVSEGSPLELRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSGKSLVTGIKSFEAEFRKSETSFHLKKSSAHLSDSAHYFCAVS
Daubentonia madagascariensis V511 trav AGTM011594120.1 1556 MSRGQKLEQSPFLNVQEGDSSVINCTYTDSTFTYFYWYKQGPGEDLQLLMNILSNVDKKQDQRLSVLLNKMAKHLSLNISDTQPGDSAVYFCAVS
Daubentonia madagascariensis V512 iglv AGTM011594392.1 1847 SLANVVLTQPTSVSGSPGQKVTISCTRSSGNIESKYVYWYQQRLGSAPTTVIYNDDQRPSGVPDRFSGSIDSSSNSASLTISGLESEDEADYYCQSFDSD
Daubentonia madagascariensis V523 trav AGTM011599312.1 3207 VRGIQVEQSPPSLSLHEGASCMLWCNFSASVSNVQWFRQNPGGRLINLFYIPSGTKQNGRLNATTVAKERRSSLHVSSSQTTDSAIYFCAVEP
Daubentonia madagascariensis V536 trav AGTM011607886.1 1572 VNSQQGEENPQALSIQEGENFTMNCSYKSSINNLQWYRQDSGRGLTLLILIRSNKREEHHGRLRATLNTSTKSSSLIITASQASDTAAYFCATD
Daubentonia madagascariensis V538 trav AGTM011609629.1 2257 GTGAQSVTQPDIQVTVSEGAPLELRCNYSYTGTPYLFWYAQYPGQSLQFLLKYTTGATLVKGIKGFEAEFRKSETSFHLKKHSAHLSDSAEYFCAVS
Daubentonia madagascariensis V545 trav AGTM011616170.1 3411 VSGGENVGLHPPTLSVQEGDTSVINCTYSDSASTYFPWYKQELGKGPQLIIDIRSNMGKKQEQRLTVLLNKTAKHLSLHIAATQPGDSAVYFCAE
Daubentonia madagascariensis V552 trav AGTM011621712.1 3487 DARAQSVTQPDLYIPVSEGALLELRCNYSYGGGALYLFWYVQYPGQGLQLLLRYYSGNTLVQGIKGFEAEVRKSESSFNLRKPSVHWSDAAEYFCAVS
Daubentonia madagascariensis V558 trav AGTM011629454.1 503 VSGKNQVEQSPQSLIILEGENCTLQCNYTVSPFNNLRWYKQDTGRGPVSLIIMTYSESKESNGRYTATLDASTKQSSLHITASQLSDSASYICVVS
Daubentonia madagascariensis V572 iglv AGTM011643800.1 8639 ATSQAVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYANWVQQKPYQAPRGLIGNTNNRIPGVPARFSGSLLGDKAALTITGAQPEDEAEYYCALWYSDH
Daubentonia madagascariensis V573 trbv AGTM011644030.1 4496 HVGAMVIQNPRYQVTRVGKPVTLSCSQNLNHDTMYWYQQKLSQAPKLLFYYYDEEFNSETDTSDNFQSSRPNNSFCSLEIRSPGLGDSAVYLCASSR
Daubentonia madagascariensis V592 trav AGTM011661598.1 4597 VRSQQKEVEQNPETLSVPEGAIASLNCTYSNQASQSFIWYRQNLKGPAFVVSIYSTGDKEEGRFTARLNTASQYVSLLIRDSQPSDSATYLCAV
Daubentonia madagascariensis V626 trav AGTM011736427.1 2127 DARAQSVTQPDVHVTVSEGASLELRCNFSYGGAFSFFWYVQYPGQGLQLLLRYFSGDTLVKGIKGFEAEFRKNESSFNLRKPSVHWSDSAEYFCALS
Daubentonia madagascariensis V640 igkv AGTM011751303.1 881 SSGDVVMTQTPLFLTITPGDLASISCRASQSLLYSDGNTYLSWYLQKPGQSPQLLIYKVSNRFSGVPGRFSGSGSGTDFTLKISRVAAEDVGVYYCQQDIQVP
Daubentonia madagascariensis V641 trav AGTM011751468.1 2059 VRSQQKEVGQNPESLSVSEGAIASLNCSYSNRASDYFMWYRQYSGKGPEFLVSIYSTGDKEEGRFTVQLNKASQYVSLLIRDSQPSDSATYLCAV
Daubentonia madagascariensis V646 trav AGTM011762959.1 778 GTRAQSVTQPNVYVTVLEGVALELRCNYSASSPTLMWYVQYPNQGLQLLLKYVSGSTLVKGIRGFEAEFMKSETSFHLKKHSAHLSDSAQYFCAVS
Daubentonia madagascariensis V649 trav AGTM011769197.1 887 RTYGNSVTQREGQVTLSEAAFLTINCTYTATGYPALFWYVQYPGEGPQLLLTAKKANDKGINKGFEATYKKETTSFHLEKASVHESDSAVYYCALS
Daubentonia madagascariensis V657 iglv AGTM011791889.1 2093 SSYQAVVTQDPSLTVSPGGTVTFTCDSSTEAVTNDHNSCWIQQKSGQVPRTLIYDTSNKHSWTPARFSGSLLGGQAALTLSGAQPEDEAEYYCMLRYSDG
Daubentonia madagascariensis V673 iglv AGTM011815200.1 1780 SVSSYELTQPPSVSVAPGQTARITCGGNNIGNKNAYWYQQKPGQAPVLIIYDDNNRPSGIPERFSGSNSGNTATLTISGAQAGDEADYYCQVWDS
Daubentonia madagascariensis V679 igkv AGTM011833431.1 544 VSGDINLTQTPASLSAYPGETVSISCQASADVHGEISWTRIKLGQRLEPLISHVTTLAPGVPAWYSGRGSGTSYVFSISALEPGDSGEYYCIHDYGWP
Daubentonia madagascariensis V684 trav AGTM011840816.1 6582 GVRGLHVEQSPAVLSLQEGTSPTLRCNFSGTMYNMQWFRQNPKGGLTSLFFMTSGTKQNGRLKSTINSKELYSTLLITATQMEDSGTYLCAAE
Daubentonia madagascariensis V692 trdv AGTM011875338.1 346 FGIAQKVTQAQPAMLVKEKEAVTLDCAYDTSVGSYGLYWYKQPISGEMILLVRQDSYNQQNATEGRYSLNFQKARKSINLVISASQLGDSAIYFCALSE
Daubentonia madagascariensis V711 trgv AGTM011957048.1 1066 TQVSSNLEGRMKSISRKTGSAVDITCDIQQSDSYIHWYLFQEGKAPRRLLYYDTYYSSKTVDEGISAKKYDASKVSDRSFKLQLQHAEVSDSGVYYCTTWG
Daubentonia madagascariensis V720 trav AGTM012295021.1 2395 GVRGLQVEQSPSVLSLQEGTSPTLRCNFSGTMYSMQWFRQNPGGSLISLFFMTSGTKQNGRLKSTINSKELYSTLLITATQMEDSGTYFCAAE
Daubentonia madagascariensis V732 trav AGTM012330826.1 977 GLRAQSVTQPEDQVAVSEGDPLTLKCTYSYSGSPYLFWYVQYPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKASALGSDSALYFCAVS
Daubentonia madagascariensis V742 trav AGTM012949529.1 360 LNGQQVKQVPQFLHIQEGEDFSTYCNFSSTLDRVQWYKQRPGGSPVLLVTLLKGGEVKKEKRLTTQFGETRKDSSLHVTATQTTDVGTYFCAE
Daubentonia madagascariensis V745 trav AGTM012962960.1 297 VRSQKKEVEQNPESLSVPEGAIASLNCTYSNTAYQYFMWYRQYSGKGPELLVSVYSIGDKEEGRFTAQLNKTGRYLSLLIRDSKSSDSATYLCAV