WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Bos mutus AGSK00000000.1 (AGSK01) 159 3 13 8 52 49 9 25
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Bos mutus V36 trav AGSK01175091.1 10040 VSRLLTVEQHPLLLWVQEGESTNFTCTFPSSPFYVLHWYIWKPAKGPKNLIVISVNGDEKKQGQVRVTLNTKEGYSSMYLRRSQPEDSTTYLCA
Bos mutus V37 trav AGSK01176890.1 345 GTNGDSVNQTEGPVTVSEGAPMTLNCTYQTADFDPYLFWYIQHLNKAPQLLLKGSISDQNPKSKGFQATLVKRDSSFHLQKQAVQASDSAVYYCALS
Bos mutus V38 trav AGSK01176891.1 4199 GTNGDSVNQTEGPVTVSEGALLTLNCTYQATYSTYYLFWYVQHLNKAPQLLLKGSMTDQKPKSEGFQATLDRSGSSFHLQKRAGQASDSAVYYCALS
Bos mutus V39 trav AGSK01176892.1 308 GTNGDSVNQTEGPVTLSEGALLTLNCTYQTTYSDSCHFWYVHHLNKAPQLLLKGSMTNQRPEHEGFQATLVNSDSSFHLQKQAVQASDSAVYYCALS
Bos mutus V83 trbv AGSK01160982.1 1987 AVHAVVTQDPRFQIVRTGQNATLKCTQDLGHNRMCWYQQDLGHGLRLIHYSDGAHTSEPGDMPDGYSVSRSNKENFPLTLKSANRSQTSVYFCASSY
Bos mutus V84 trbv AGSK01160983.1 8932 LVDSGVTQTPRYLINARGQRGTLRCSPVSGHLSVSWYQQALGKGPEILVQYYRQEVRGEAQLLDRFSGRQFSDFHSELNLSSLELMDSAMYLCASSQ
Bos mutus V0 trgv AGSK01011573.1 11682 GLGLSKVEQAQISLSTEVKKSINIRCKIESTNFESETVYWYWQKKNQALEHLIYVTSTTTAARNQVDGKNKIEARKDAQMFTSTLTVNFIEKEDVGIYYCAGWS
Bos mutus V1 trgv AGSK01011573.1 21668 GLGQLTLVQTEVSVTGTREKSIIMSCKVFSKDFSKDYIHWYRQKPDQGLEQLLFVLDAPALNHLGGKKNKLEARKDKPSSTSTLKISFLEKEDEATYYCAGWL
Bos mutus V2 trgv AGSK01011573.1 25976 IPITQRITSITKKKGNTAFLECQIKIDKLKKNVYMHWYRQKPEQPLKRVLYISSNENVVHEQGISEERYEARKWPSNSLVSLRIHQATEEDAGLYYCACWV
Bos mutus V3 trgv AGSK01011573.1 28428 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEIDNKKNGIFYLIINNVVKSDEATYYCACWD
Bos mutus V4 igkv AGSK01028768.1 20218 ARCDLQTTQSPSSLSASLGERISITCRASQSVSNYLAWYQQKPGKAPKLLIYHESRLHTGVPSRFSGSGCGTDYTLTISRLEADDAATYYCQQYNS
Bos mutus V5 igkv AGSK01028780.1 1514 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLRWLQHKPGQSPQSLIYQVSNRNTGVPDRFTDSGSETDFTLTISSVQAEDAGVYYCVQE
Bos mutus V6 igkv AGSK01028782.1 3747 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLRWVQHKPGQSPQGVIYQVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCFQGTYEP
Bos mutus V7 trgv AGSK01043091.1 7851 FQQEIRVFQRSVMVGHAGGAITMPCQISKSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLRKLAKSDEGLYYCATWGS
Bos mutus V8 trdv AGSK01072111.1 16969 KGVLCNQVTQSPPEQRVASGSEVTLLCTFQTTYSNPDLYWYRKSPDGVFQFVLYRDNTRSRDADFARGRFTVLHSMSQKTFHLVISSVRPEDTATYYCALRL
Bos mutus V9 trbv AGSK01114536.1 351 SVDTKVIHSPGHLIKGKGQKTKMDCVPNKGHINVYWYRKKPEGAFEFLAYLKNQDIVEDTEVFQQLFLAPWPQNSPCSLEINSAKAVDSALYFCASNQ
Bos mutus V10 trbv AGSK01114537.1 734 SMDTEVIQSPGHLVKGKGQKAKMDCVPIRGHINVYWYRRKLEEALEFLVYFQKQDIVKGTEVFKERFLAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos mutus V11 trbv AGSK01114537.1 9559 SMDTEVTQSPSHLIKGKDQRAKMDCVPKGGHAYVYWYRKKLEEAFEFLVYFQNQNMMEDTALFKERFSAECPQNSPCSLEINSTEAADAALYFCASSQ
Bos mutus V12 trbv AGSK01114537.1 14341 PMDAEIYQIRFLLAEAGQDVTLECKQNLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSAHTNQTAVYLCSG
Bos mutus V13 trbv AGSK01114537.1 23586 SMDTGVTQTPRNRIANTGKSTVLECSQTKGHESMYWYRQDPGRGLRLIYSSYGIDDINKGDVSDGYNVSRKEEAKFSLYLEPATPNQTAIYFCASNI
Bos mutus V14 trbv AGSK01114537.1 29437 FSDADIYQTPRYCVIGTGKKITLECSQTMGLDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETANSSQTSSYFCASGD
Bos mutus V15 trbv AGSK01114537.1 31146 LKDAAVTQFPRRRILETEKEFTLQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGPDSFKKGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAK
Bos mutus V16 trbv AGSK01114537.1 38367 PLEADVTQSPRHRITETRKRVTLTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVGFIENGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSE
Bos mutus V17 trbv AGSK01114537.1 44189 LVDAQVTQTPRYLVKRRGEKVVIECIQNMDHERMFWYRQDPALGLRLLHFSIDAGTVEEGDVPHGYSVSRKKKESFPLTLASATTNQTSMYLCASSE
Bos mutus V18 trbv AGSK01114537.1 52898 SVFGALVSQKPSRAIRQRGTSVMIECQVDSQVNFMYWYRQLPGQSLVLMATANQGSKATYESGFTDNKFPISRPKQAFSTLTVSNASSEDSSSYFCSAR
Bos mutus V19 trbv AGSK01114538.1 2090 SVFGALVSQKPSRAIRQRGTSVMIECQVDSQVNFMYWYRQLPGQSLVLMATANQGSKATYESGFTDNKFPISRPKQAFSTLTVSNASSEDSSSYFCSAR
Bos mutus V20 trbv AGSK01114539.1 3326 SVFGALVSQKPSRAIRQRGTSMTIECQVDSQLTWMYWYRQLPGQSLVLMATANQGSKATYESGFTDNKFPISRPILAFSTLTVSNASSEDSSSYFCSAR
Bos mutus V21 trav AGSK01123275.1 14800 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSEYFPWYKQESRKGLQFLIGIYSNKAKEEDQRLTVLLNKTAKHLSLHIATTEAGDSAVYFCAAS
Bos mutus V22 trav AGSK01123281.1 98 QTRGDSVRQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANKGNNKGFEAAYNTEITSFHLEKASVQESDSAVYYCALS
Bos mutus V23 trav AGSK01123283.1 4214 VSLGNEVEQRPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLIAIHSNMGEKKDQRLTVLLNKNTKHLSLHIATIQTGDSAVYFCAAR
Bos mutus V24 trgv AGSK01130778.1 3280 TQVSSNMEEDKLSVMRATGSSVVIECDLTGNYIHWYKFQEGAVPGRLLYYDVYYSKVVLGSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos mutus V25 trav AGSK01137962.1 554 QTHGNSVTQMDGHVSRSEGTSVTINCTYSTSGYPNLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCVLS
Bos mutus V26 trav AGSK01137964.1 4799 SSIAQKVTQDQPPMSVQEKETVTLNCTYDASGTTYSPFWYKQHSSGMMTFLIPQDSYNKPNAAEGRYSLNFQKASKFITLTISASQLGDSAVYFCALSE
Bos mutus V27 trav AGSK01147344.1 515 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARKSITLVISALQLEDSAVYFCALRD
Bos mutus V28 trav AGSK01147345.1 8304 VSGKNQVEQSPPSLVVLEAENCTFQCNFTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATLVVTSKHSSLHLTAAQLSNPAFYICVVG
Bos mutus V29 trdv AGSK01160814.1 1219 SSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWNMDYYYIFWYKQLPRGEMTFLIRQYSEDGNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCALWK
Bos mutus V30 trav AGSK01160946.1 580 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIRGDEYIHWYQQNPNQSTQYVIHGLRGTVNSSMVSLTIASDRKSSTLVLPQVTLRDATVYYCIMRD
Bos mutus V31 trav AGSK01160949.1 11790 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKYFSGNTVVQGIRGFVAEFKSSDFSFNLRKLSVHWSDSAEYFCAVS
Bos mutus V32 trav AGSK01161013.1 3217 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTAYLAPYLFWYVQHLNKAPQLLLKGSMSDQNPKSKGFQATLVRSDSSFHLQKQAVQASDSAVYYCALS
Bos mutus V33 trav AGSK01161017.1 3942 RTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTYYLFWYVQRLNKAPQRLLMGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos mutus V34 trav AGSK01175088.1 7390 NVFDAKTTQPSSMDYPEGEDVTLPCSLSTVSGNEYIHWYRQSPSQSRQSPEYIIHGFRDTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bos mutus V35 trdv AGSK01175091.1 3847 SGVAQKVTQDQPDISREAGEAVTLNCRYETSWSSYNIFWYKLFASGEMTFLIGQGSYSLNARDGCYSINFQKSRKAISLTISDLQLEDSAKYFCTLWE
Bos mutus V40 ighv AGSK01187048.1 5550 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLTSYGVSWVRQAPGKALEWVGGIDNDGDTYYNPALKSRLSITKDNSKSQVFLSLSSLTTEDSATYYCAR
Bos mutus V41 trgv AGSK01188204.1 796 TQVSSNMEEDKLSVMRATGSSVVIECDLTGNYIHWYKFQEGAVPRRLLHYIVSNSKVVLDSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bos mutus V42 trgv AGSK01188205.1 2233 TQVSSNMEEDKLSVMRATGSSIVIDCDLTGSYIHWYKFQEGAVPRRLLYYDVYYSKVELDSGISERKYRVYKGKILISNLQESDSGTYYCAVWE
Bos mutus V43 trgv AGSK01188205.1 16371 TQVSSNTEGEKMSITKATGSGSSVEIICDLITQTLKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGVSEGKYKVYKEKSYTFAILNLQESDSGMYYCAAWE
Bos mutus V44 ighv AGSK01188417.1 3204 ILSQVQLRESGPSLVKPSQTLSLTCTASGLSLTSYGVSWVRQAPGKALECLGGISSGGSTGYNPALKSRLSITRDNSKSQVSLSVSSVTPEDTAVYYCAK
Bos mutus V45 trav AGSK01189154.1 3729 VSGKNQVEQSPPSLVVLEGENCTFQCNFTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATVDATAKHSSLHITAAQLSDPAFYICVVG
Bos mutus V46 trdv AGSK01189155.1 1782 SGVAQKVTQDQSDVSSHVGQSVTLNCRYETNWNAYYLFWYKQLPSGQMTYVIRQGSLVTNAKKDRYSVNFKKADKSISLTISALQLQDSAKYFCALCE
Bos mutus V47 trdv AGSK01189155.1 2145 SGVAQKVTQDQSDVSSHVGQSVTLNCRYETSWSYYYLYWYKQLPSGQMTYVIRQGSEVTNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALSD
Bos mutus V48 trdv AGSK01190624.1 7557 CGVTQKVIQDQPDIYSQLGQSVTLNCRYETTWSFYYMFWYKLLPNGEMMYLIALASSGQNARNGRYFVTFQKIRKSISLTISDLQLEDSAEYFCALWE
Bos mutus V49 trav AGSK01191169.1 2100 LRVQMKVEQSPGVLTLQEGRNSSLICNYSTSIRGVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos mutus V50 trdv AGSK01192399.1 934 SGVAQKVIQDQPYITSQIEQSVILKCRYELSQSGYTHYFFWYKQLRSGEMTFLIRQESLGPNARNGRYSVNLQKAQNSISLTISALQLEDSAKYFCAVWE
Bos mutus V51 trav AGSK01193091.1 913 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSDNIFWYRQFPNQGPQFIIQGYKTNVENQVASLLIPPDRKFSTLSLPQASLRDTAVYYCIVRD
Bos mutus V52 trdv AGSK01194669.1 3078 SGVAQNVTQDQPVIISQAGKVATLNCRYEISRNVHDYWIFWYKQLPSGEMTYIVHQYSEDRNERKGCYSVNFQKARKSISLTLSFFKLEHSAKYFCALWE
Bos mutus V53 trav AGSK01194671.1 11332 VQGLDVEQSPPALSLQEGASHVLRCNFSASVSNVQWYLQNPSGRLIHLFNIPSGTKQDGRLNATTIPKERHSSLHISSSKTTDSGTYFCAVQHSAPQ
Bos mutus V54 igkv AGSK01195062.1 68 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLRWVQHKPGQSPQGVIYQVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCVQE
Bos mutus V55 iglv AGSK01195489.1 11304 SWAQAVLTQPSSVSGSLGQRVSITCSGSSNNVGYGNYVSWFQQIQGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASYQSG
Bos mutus V56 trdv AGSK01195637.1 1311 PSVAQTVTQPQPQESVQETGTVTLDCTYSTSESGCYLFWYKQPPSGDMVFIIRQYAYEQQNATNDRYSVNFQKEAKSFSLKISDSQLEDAAMYFCAYSG
Bos mutus V57 trbv AGSK01196717.1 83 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHRSVYWYQQVLGQGPQFLIQYFNTQENEKGNISDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bos mutus V58 trav AGSK01196793.1 72 VRGVDVEQSPPALTPQEGASSTLWCNFSTSADSVWWYLQKPWGRHLIYIPSGTRQGGRLNATTVLKERRSSLHVSSLRTTDSGTYFCAVQHCAPQ
Bos mutus V59 trav AGSK01197798.1 2239 GTGAQLVTQPDGHINVSEGNHVELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLPGPTRVKGIKGFEADFKKDENSFHLMKASAHWSDSAKYFCALC
Bos mutus V60 trdv AGSK01197816.1 1116 CGVAQKVTQDQPDISSQVGQSVTLNCQYETSWRYYYLFWYKQLPSGQMTYLIQQYSEYSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCTLSE
Bos mutus V61 trav AGSK01197816.1 7576 TVIDAKTTQPGSMDCAEGEDVNLPCNHSTFGGNDYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCVLRE
Bos mutus V62 trav AGSK01197818.1 1707 STNGDSVNQTEGPVTVSEGALMTLNCTYQATYSNSYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDSSFHLQKQAVQASDSAVYYCALS
Bos mutus V63 trav AGSK01199282.1 1362 VSAQQLNQSPQSMSIQEGEDVSMNCSSSSMLNFLLWYKQDAGEGPVLLIKLLKGGELARNGKLTAQFGGTRKDSLLNISASEPKDAGTYFCAG
Bos mutus V64 trav AGSK01199330.1 2969 VSLGNEVEQSPSTLSVQEGNSSVITCTYKDTASDYFPWYKQEPGKGPQLLIAIRSNMGEKKDQRLTVLLNKTTKRLSLHIATTEAGDSAVYFCAAS
Bos mutus V65 trav AGSK01199330.1 6926 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARKSITLVISALQLEDSAVYFCALRE
Bos mutus V66 trav AGSK01199464.1 401 GVRGVKVEQNPSVLSLQEGANSTLRCNFSDTVNNVQWFQQNPRGSLARLFFIASGMKKNERMSSTVNSKERYSTLHITASQLEDAATYLCAVE
Bos mutus V67 trav AGSK01199502.1 731 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSAYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVLLNKTTKHLSLHITTTEAGDSAVYFCAAS
Bos mutus V68 trav AGSK01199709.1 248 GTNGDSVNQTEGPVTVSEGALLTLNCTYQTTYSDPYVFWYVQHLNKAPQLLLKGSMKDQKPKSEGFQATLVRTDSSFHLQKRAVQTSDSAVYYCALS
Bos mutus V69 trbv AGSK01200273.1 10155 LVDSEVTQSPKYLIKSRKQQATLRCSPDSGHSSVNWYQQALGQGPQFLVQYYRGQVSGGENMPDRFSAKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bos mutus V70 trdv AGSK01201716.1 361 SSMADKVTEAQTTVTAREREAVTIGCTYETSRTYYTLFWYRQFPGGRMEFLIHQDSNNANARRDRYSVNFQKGKKIISLTISSLYLADSAKYFCVLWE
Bos mutus V71 trav AGSK01232217.1 646 KSTQQLEQNPQFLRIQEGGNVTMHCNSSGTFTFFQWYRQKPEQGPVLLMTLTKPKEVKEQKRIRAQFGEAKKDSSLLITAAQPGDAGTYLCAG
Bos mutus V72 trav AGSK01034941.1 2170 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTTYSGSYHFWYVHHLNKAPQLLLKGSMTNQRPEHEGFQATLVNSDSSFHLQKWAVQASDSAVYYCALS
Bos mutus V73 trav AGSK01034946.1 1373 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVSGSPYLFWYIQHRNQGLQFLLKYIRGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos mutus V74 trav AGSK01034950.1 7392 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVLGSPYLFWYVQHRNQGLKFLLKYIRGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos mutus V75 trdv AGSK01072120.1 43617 VMSAVVLVPQDQEKTVVVGKSATLSCSMKGAAFISKYYIFWYRKTLGNTMTFIYQERGVYGPGFEDNFRGKIVNLTNQAVLEVLKASERDEGFYYCATD
Bos mutus V76 trdv AGSK01072123.1 10937 SNNVESADVPTVFKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQNKHSREGRYSVEFNKPNQMLKLTISALTLNDSAVYFCAVRE
Bos mutus V77 trav AGSK01101129.1 5352 LRRADWIRSQESEVSGEEGKTVSLFCNYYTSSKSFISLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Bos mutus V79 trbv AGSK01114543.1 5755 VRTQTIHQWPSTRVQPAGSPLSLECTVKGTSNPTLYWYRQEAGGSLQQLFYSFSAGQIEPREFQNFKASRPQDGQFTLSSKKLQLNNSGFYLCAWS
Bos mutus V81 trbv AGSK01160980.1 555 AVHAGVTQDPRCQVVKTGQKATLKCTQDLGHDRMYWYRQDPGSGLRLIHYSAAAPTTEKGDMPEGYSVSRLSTENFALTLESANRSQTSVYFCASSY
Bos mutus V82 trbv AGSK01160982.1 12235 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHRYVSWYQQALGQGPHFLVQYFDGKVRTKGNMPDRFSGEQFSDSRSQMNLSSLKLTDSAVYLCASSQ
Bos mutus V85 igkv AGSK01172404.1 18452 ARCDIQVTQSPSYLSASLGDRVSITCQANQSVSHYLNWYQQKPGEAPKLLIYYATSRYTRVPSRFSGSGSGTDFTLTISSLEADDAANYYCQQDYS
Bos mutus V86 igkv AGSK01172404.1 2267 ASGEAVLYQTPAYIAASLGESISITCRANQSISDYLSWYKQKPGQAPMILIYDADNRFNGVPERFTATQSETEFVFTISQVEADDAAMYYCQQDY
Bos mutus V87 igkv AGSK01172405.1 10325 SSGDVVLTQTPLSLSIIPGEMASISCKSSQSLVHSDGNTYLNWIQYKPGQSPQGLIYQVSNRYSGVSDRFTGSGSGTDFTLTINGVQAEDAGVYYCYQGTEDP
Bos mutus V88 iglv AGSK01172748.1 5586 SLSQPVLTQPVTVSASLGASARLSCTLSSGYNVSNYSIYWYQQKAGNPLRYLLRFKSDSDKHQGSGVPSRFSGSKDASTNAGLLLISGLQPEDEADYYCAVWHG
Bos mutus V89 igkv AGSK01173228.1 1577 SSGDVVLTQTPLSLSVIPGETVTISCKSTQSLKYSDGKTYLQWFQHKPGQSPRLLIYQISNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCLQSSYAP
Bos mutus V90 trav AGSK01175642.1 1255 LRVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bos mutus V91 iglv AGSK01177064.1 10061 SVVSYELPQPTSVSVALGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYN
Bos mutus V92 iglv AGSK01177064.1 5314 HLASSQLTQPPAVSVSLGQTASITCQGDDLELLSAHWYQQKPGQAPVLVIYADDNLASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSADIGD
Bos mutus V93 iglv AGSK01177064.1 1245 PVSSYELTQSPPASMSPGQTARITCGGPSVGGENVEWHQQKPGQARAPVIYGDDNRPTGVPDQFSGANSGNMATLTISGARAKDEADYYCQLWDSSSNN
Bos mutus V94 iglv AGSK01177069.1 7443 PLASSQLTQPPAVSMSLGQTASITCQGDDLESYYAHWYQQKPSQAPVLVIYESSERPSGIPDRFSGSSSGNTATLTISGAQTEDEADYYCQSADSSGD
Bos mutus V95 iglv AGSK01177069.1 741 SVVSYELTQLTSVSVALGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYN
Bos mutus V96 iglv AGSK01177070.1 6831 SWAQSGLTQPSSVSGNLGQTVTISCAGTSSDVGAYNGVGWYQQLPGSAPKTLIYNLNKRSSGIPARFSGSKSGNTATLTISGLQAEDEADYYCSSYKSGGT
Bos mutus V97 ighv AGSK01177713.1 845 VLSQVQLRESGPSLVKPSQTLSLTCTVSGFSLTSYGVSWVRQAPGKALECLGGISSGGSTGYNPALKSRLSITKDNSKSQVSLSVSSVTTEDTATYYCAK
Bos mutus V98 trav AGSK01180219.1 2416 PSVAQMVSQPQPEESVQEADTVTLDCTYSTRDTDYYLFWYKQPPSGEMVYIIHQYAFEQQNATNDHYSVNFQKEAKAFSLRISDSQLEDAAVYFCAYSG
Bos mutus V99 trbv AGSK01180886.1 2662 SMDTEVTQSPSHLVKGKGQKAKMDCVPMRGHASVYWYRNKLEAFEFLVYLWNGKITEDTDMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bos mutus V100 trbv AGSK01180887.1 661 SVNPEVIQSPGHLVKGKGQKAKMDCVPIKGHINVYWYCKKPEGAFEFLAYLKNQDIVEDTEVFQQRFLAPWPQNSPCSLEINSTEAADAALYFCASSQ
Bos mutus V101 trbv AGSK01180888.1 720 SMDTEVMQSPSHLVKGKDQRAKMDCVPKKGHSYVYWYRKELEEALELLVYLQDEKIIEDTAMFKQRFSAECRQNSPCSLEINSTEAADSALYFCASSQ
Bos mutus V102 iglv AGSK01182284.1 5206 SWAQSGLTQPPSVSGNLGQTVITSCAGTSSYVGSYNGVGWYQQLLGSAPKTLIYNVSKRPSGIPDRFSGSKSGNTATLTVSGLQAEDEADYYCSSYKSGGS
Bos mutus V103 iglv AGSK01182291.1 8694 SWAQAVLTQQPSVSGSLGQRVSISCSGSSSNIGHGYGTWYQQIPGSAPRMLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAAYDSSSGG
Bos mutus V104 iglv AGSK01182291.1 2235 SWAQAVLTQPPSVSGSLGQTVTISCTGSSNNIGILGVSWYQQLQGSAPRTLIYISNQRPSGVPDRFSGTKSGNTGTLTIASLQAEDEADYYCASADLSLNT
Bos mutus V105 trav AGSK01182573.1 8044 VQGLDVEQSPPALSLQEGASHMLRCNFSASVNNVQWYLQNPSGHLIHLFNIPSGTKQNGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos mutus V106 trdv AGSK01182575.1 580 SGVAQKVTQDQPVIISQVGKVATLNCQYETSRNVHVYCIFWYKQLPSGEMTYLIRQYSEDGNERDGRYSVNFQKARKSISLSISFLKPEHSAKYFCALWE
Bos mutus V107 trdv AGSK01184464.1 1517 SGMAQTVIQDQPDISSQLGQSVTLNCRYATTWSSYYYMFWYKLLPNGEMIYLIGHSGQNERHGRYSVNFQKARKSISLTISDLQLEDSAKYFCALWE
Bos mutus V108 trav AGSK01184651.1 1730 GLRAQSVTQPQAEVPVAEGDPVTVKCTYSVSRSPYLFWYVQYGNQGLQFLLKYIGGDSLVKGNYDFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bos mutus V109 trbv AGSK01185805.1 2723 SMDTDVTQSPSHLVKGKGQKAKMDCVPIRGHSYVYWFRKKLEEPLEFLVYFQKQDIVEDTAMFKQRFSAECPQNSPCSLEINSTEAVDSALYFCASSQ
Bos mutus V110 trbv AGSK01185807.1 5347 HVGAMVVQNPRYLVTGLGKPVTLSCSQNMKHYAMYWYQQKPSQAPKLLLYYYDKQITKEKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Bos mutus V111 trbv AGSK01185808.1 3122 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQASIDESGMPKDRFSAKMHNASFSTLKIQPTDPGDSAMYLCASSK
Bos mutus V112 trbv AGSK01185808.1 634 CISAEVAQSPSHRVIEKKQAVNLSCDPISGHESLFWYYHAVGKEMKLLIYFLRESMQDDSGMPKGRFTAERMEGTSSTLRVHSAELGDSGVYFCASSR
Bos mutus V113 trbv AGSK01185809.1 1924 TTDANLGVTQTPRHEVTEKGQAVTLSCELIKSHTALYWYRQTSVRGLEFLAYFSNQAPIDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Bos mutus V114 trbv AGSK01185810.1 23660 PLEAEVTQTPRHLIKTTGQTATLRCSPISGHSSVSWYQQAQSQGPQFIYEFYETLQRAKGNFSNRFLAKQFPDFSSELNVNSLDLTDSALYLCASSL
Bos mutus V115 trbv AGSK01185810.1 18755 HTRAGVVSQSPGYRVAGRGQTVNFRCDPIPGHQVLYWYRQMLGQGPEYLTNFQGKEEQSRMPKTRFSAERPESTYSYLKIQPVEPEDSALYLCASSP
Bos mutus V116 trbv AGSK01185813.1 5629 AVHAGVSQDPRFQVVKTGQNVTLRCTQDLYHDSMYWYRQDLGLRLRLIRYSSFTDTTYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCTSST
Bos mutus V117 trbv AGSK01185813.1 2642 HTGAGAVSQSPRHRVAGRGQTVNLRCDPISGHVSLYWYRQTLGQGPEFLTYFQNDQGIDKSGMPKNRFYAERPEKTYSYLKIQPVEPGDSAVYLCASSP
Bos mutus V118 trbv AGSK01185814.1 5236 LVDSGVTQTPRYLIKAKGQRGTLGCSPVSGHLSVYWYQQALGQGPEFFVEYYRQEVRGEAQLPKRISGKQFSDSGSELNLSSLELMDSAVYLCASSQ
Bos mutus V119 trbv AGSK01185814.1 4431 LVDSGVTQTPRYLIKAKGQRGTLGCSPVSGHLSVYWYQQALGQGPEFFVEYYRQEVRGEAQLPKRISGKQFSDSGSELNLSSLELMDSAVYLCASSQ
Bos mutus V120 trbv AGSK01185816.1 2977 AVHAGVTQDPRLQGVRRGATLKCTQDLNHDYMYWYRQDLGHGLRLIHYSAGVRSREPGDVPDGYSVSRSSKENFALTLESANHSQTSVYFCTSSY
Bos mutus V121 trbv AGSK01185817.1 2110 AVHAGVTQDPRFQVMRTGQKATLTCTQDLGHDCMYWYRQDLGQGLRLIHYSVAAPDTVKGDIPEGYRVSRPSTKDFPLMLESANRSQTSVYFCASSY
Bos mutus V122 trbv AGSK01185837.1 9476 VVHAGVTQDPRFQVVRTGQNMTLRCTQDLNHDYMYWYRQDLGHGLRLIHYSDGPPTTEKGDVPEGYSVSRPSTEDFPLTLESANRSQTSVYFCTSSY
Bos mutus V123 trbv AGSK01185837.1 1341 LVDSEVTQIPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGEVYQRGNMSDRFSVQQLGDSRLELNLTSLELMDSALYLCASSP
Bos mutus V124 trbv AGSK01187396.1 7775 AVHAGVTQDPRFQVVRRGQSTTLTCTQDLGHNYMYWYRQDLGHGLRLIHYSAGPPTTEKGDVPNGYRVSRSSTENFPLTLESANCSQTSVYFCASSY
Bos mutus V125 trbv AGSK01187396.1 5485 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHRSVYWYQQVLGQGPQFLIQYFNTQENEKGNISDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Bos mutus V126 trbv AGSK01187397.1 7424 AVHAGVSQDRRFQVVRSGQKLTLRCTQDLNHDYMYWYRQDLGHGLRLIHYSNGHPYTEKGDVPEGYSVSRPSTEDFPLTLESANRSQTSVYFCASSY
Bos mutus V127 trbv AGSK01187397.1 3628 LVDSGVTQTPKYLIKSRKQQATLRCSPVSGHLSVYWYQQALGQGPQFLVQYYNQKVRGEAHLLDRFSGKQFSDSRSELNLSSFELMYSARYLCASSE
Bos mutus V128 trbv AGSK01187399.1 1708 LVDSEVTQTPKYLIKSRKQQVILRCSPESGHRSVYWYQQVLGQGPQFLIQYFNTQENEKGNISDRFSGKQFSDSSSELNLTSLELKDSAVYLCASSQ
Bos mutus V129 trav AGSK01187529.1 4100 TVVDAKTTQPNSMDCAEGENVNLPCNHSTTRGDEYIHWYQQNPNQSTQYVIHGLRGTVNSSMVSLTIASDRKSSTLVLPQVTLRDATVYYCIMRD
Bos mutus V130 trav AGSK01187529.1 1883 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIRGDEYIHWYQQNHNQSPLYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDTAVYYCIG
Bos mutus V131 trdv AGSK01187627.1 2377 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIDSQNKHSREGRYSVEFYKPNQMLKLTISALTLNDSAAYFCAVRE
Bos mutus V132 trbv AGSK01188241.1 3173 LVDSGVTQTPRYLIKARGQRGTLRCSPVSGHLSVYWYQQALGQGPEFLIQYYSQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bos mutus V133 trbv AGSK01188662.1 506 LVDSEVTQTPKYLIKSRKQQVILRCSPESGHTSVYWYQQALGQGLQFLIQYYNRAEYEKGNISDRVSGKQFSDSSSELNLTSLELKDSAVYLCASSQ
Bos mutus V134 trdv AGSK01188885.1 17814 TQDQPDITSQVGQSVTLNCQYEVNWYRISYSIFWYKQLLSGQMTYLIRQYSEDGNARDGRYSVYSEDGNARDGRYPVNFQKADNSVSLTIPALQLEDTAKYFCA
Bos mutus V135 trav AGSK01188885.1 7996 VQGLDVEQSPPVLSLQEGASHVLRCNFSASVNNVQWYLQNPSGRLIHLFYIPSGTKQDGRLNATTIPTERRRSLHISSSQTTDSGTYFCAVQHSAPQ
Bos mutus V136 trdv AGSK01189174.1 2512 SSVAQRVAQDQPDISSQVGEVVTLNCQYDTRLSSFRIFWYKQLPSGEMIYLIGQVSSSQKARDGRYTTDLQRSRKSISLTISDLQLEDSAKYFCAVWE
Bos mutus V137 trdv AGSK01189180.1 10712 SGVAQSVTQDQPDILSEVGKAVTLNCRYETSWDMFYYYIFWYTQLPSGQMTYLIRQYSDAGNARDGRYSVNFQKAQKSISLTISALELEDSAMYFCVLR
Bos mutus V138 trdv AGSK01189269.1 2652 SYSRPARHNLQVGQSVTLNCQYEVSWYINSYYIFWYKQLPSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTISALQLEDTAKYFCALRE
Bos mutus V139 trav AGSK01189270.1 5000 TVVDAKTTQPNSMDCAEGENVNLPCNHSTIGGEDYIHWYRQNPSQSPQYVIHGFRGTVNSNMASLTIASDRKSSTLVLPQVTLRDTAVYYCTLRE
Bos mutus V140 trav AGSK01189270.1 1966 VRGVDVEQSPPALSLQEGASYTILCNFSTSPQSVIWYLQNSGGHIIQLFYIPSGTKQDGRLTATTVPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bos mutus V141 trdv AGSK01189274.1 1375 SGVAQKVTQDQPYVTSQIGQSVILNCWYEVSWSGYTHYLYWYKQLPSGEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVRE
Bos mutus V142 trav AGSK01192073.1 620 IMVDAEITQLSSMDCAEGEDVNLPCNHSTIDPLDYICWYQQNPNQSPQYVIHGLRDTVNSSMASLNIASDRTSSTLVLPQVTLRDTAVYYCILKG
Bos mutus V143 trav AGSK01192994.1 6317 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVSGSPYLFWYVQHRNQGLQFLLKYIGGDTLVKGNYGFEAEFNKSQTSFHLKKPSVVGSDSALYFCAVR
Bos mutus V144 trdv AGSK01193812.1 6475 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSSGVYYLFWYKQLPSGQMTYLIQQYSEHGNARNDRYSVNFQKADKSISLIISSLQLEDSAKYFCVLRE
Bos mutus V145 trbv AGSK01194209.1 839 LVDSEVTQTPKYLIKSRKQQATLRCSPDSGHRSVYWYQQALGQGPQFLIQYYRGQVSGGKNMPDRFSAKQFSDSSSELNLTSLELKDSAVYLCASSQ
Bos mutus V146 iglv AGSK01194655.1 5084 SWAQAVLTQPSSVSGSLGQRVSITCSGSSNNVGTGNYVSWFQQIPGSAPRTLIYGATSRASGGPDRFSGSRSGNTATLTISSLQAEDEADYFCASYDSSSSD
Bos mutus V147 iglv AGSK01194656.1 12718 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNIGSYNVGWYQQVPGSGLRTVIYGTSSRASGVPDRFSGSKSGNTATLTISSLQAEDEADYFCVAYDSSSSI
Bos mutus V148 trdv AGSK01194700.1 2491 STVAQQVTQVQTAIPSQVGQTVTLNCRYEVSWNMDYYYIFWYKQLPRGEMTFLIHQYSEYGNARNGRYSVNFHKAHKSISLIISALQLGDSAEYFCALWK
Bos mutus V149 trav AGSK01194702.1 2830 VRGVDVDQSPTALTPQEGDSSTLWCIFSTLADSVRWYLQKPGGRLIHLIYIPSGTRQEGRLNATTVLKERRSSLHISSLRTTDSGTYFCAVQHCAPQ
Bos mutus V150 trav AGSK01195635.1 751 ASTQQNTVEQSPASLPVPEGAAASLGCTYSDSTSRYFTWYRQYPGKGPEFLLQVYANNNKEEGKFTAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bos mutus V151 trdv AGSK01196084.1 2880 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWTAYYLYWYKQLPSGQMTYVIRQGSEVTNAKEDRYSVNFKKADKSISLTISALQLEDSAKYFCALRD
Bos mutus V152 trav AGSK01196774.1 3035 VNSQQGEQNLQTLSIQEDENVTMNCSYKSITLTALQWYRQDSRRGFVHLILMRSNERQKHSGRLHFTLDNSIKSSSLSITASQAEDTATYLCAP
Bos mutus V153 trbv AGSK01197537.1 6258 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKAMFSYNNKLLVGNETVPSRFSPESPDKAHLNLHIDSLEPGDSAMYFCASS
Bos mutus V154 trbv AGSK01197537.1 1970 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHNAMYWYKQSAQKPPELMFIHNYQELAGNENVPSRFWPECPDSSQCRLDLNALKPQDSAVYLCASSR
Bos mutus V155 trbv AGSK01201117.1 2579 ISVDPGITQIPKYLVMGMTDKKSLTCEQHLGHNAMYWYKQSAQKPPELMFIHNYQELAGNENVPSRFWPECPDSSQCRLDLNALKPQDSAVYLCASSR
Bos mutus V156 trbv AGSK01202136.1 705 SMDTEVTQSPSHLVKGKDQKAKMDCVPIKGHSYVYWYHKKLEEALEFLVYFQKQDTVEDTAMFKQRFSAECPQNSPCNLEIKSTEAADSALYFCASSQ
Bos mutus V157 trav AGSK01202519.1 647 PSVAQTVTQPQPQESVQETGTVTLDCTYSTRDTDYLFWYKQSPSGEMVFIIRQNAYEQRNATNDRYSVNFQKEAKAFSLKISDSQLEDAAMYFCAYSG
Bos mutus V158 trav AGSK01202777.1 435 GTNGDSVNQTEGPVTLSEGALLTLNCTYQTTYSDPYVFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVRSDSSFHVQKRAVQASDSAMYYCALS
Bos mutus V159 trdv AGSK01203415.1 589 SSVAQQVTQVQTVVSSQVGQTVTLNCRYEVSWNMDYYYIFWYKQLPRGEMTFLIHQYSEYGNARNGRYSVNFHKAHKSISLIISALQLGDSAEYFCALWK
Bos mutus V160 trav AGSK01229076.1 414 LRRADWIRSQESEVSGEEGKTVSLFCNYYTSSKSFISLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVMPSDTALYLCALE