WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Chlorocebus sabaeus AQIB00000000.1 (AQIB01) 271 64 44 62 36 53 7 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Chlorocebus sabaeus V34 trgv AQIB01018214.1 163726 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDTSNSRVVLESGISSGKYDSYGSTRRNLRLILRNLIENDSGVYYCANWD
Chlorocebus sabaeus V35 trgv AQIB01018215.1 1473 SQKSSNLEGRTKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKAPQRLLYYDVSNSRDVLESGLSPGKYYTHTRKRWSWILILRNLIENDSGVYYCANWN
Chlorocebus sabaeus V36 trgv AQIB01018217.1 6285 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISSGKYNSYESTRRSLRLRLQNLIENDSGVYYCANWD
Chlorocebus sabaeus V37 trgv AQIB01018219.1 13843 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCILYDGTVRKESSIPSGKFEVDRIPKTSTSTLTIHNVQKQDIATYYCALWE
Chlorocebus sabaeus V38 trgv AQIB01018219.1 30986 EQFQLSISTEVKKSIDISCKIRSTNFENDVIHWYWQKPNQALEHLIYIVSTKSAVHGSMGKRSNKVEARKNSRTLTSVLTIKSVEKEDMAIYYCAGWD
Chlorocebus sabaeus V39 trgv AQIB01018220.1 3596 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Chlorocebus sabaeus V40 trgv AQIB01018220.1 5607 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTVVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Chlorocebus sabaeus V202 trav AQIB01109542.1 10091 MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQQDQLLAICNADLGWHISPAFKDRVDPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGT
Chlorocebus sabaeus V370 igkv AQIB01144236.1 33227 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINKELSWYQQKPGKAPTLLIYAASSLQTGVPSRFSGSGSGTDFTLAISSLQPEDVATYYCLQDYTTP
Chlorocebus sabaeus V371 igkv AQIB01144236.1 51258 SSGDIVMTQTPLFLPVTPGEPASISCRSSQSLMDSDVGFTYLHWYLQIPGQSPQLLMYFTSYRASGVPDRFSGSGSGTDFTLEISKVEAEDIGVYYCMQGRELP
Chlorocebus sabaeus V372 igkv AQIB01144236.1 99007 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQTIEYP
Chlorocebus sabaeus V373 igkv AQIB01144237.1 7570 TSGDILLTQTPLSLPVTPGQLASISCRSSQSLLHSNGNTYLHWYLQEPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKINLVEAEDVGVYYCMQ
Chlorocebus sabaeus V374 igkv AQIB01144237.1 12521 SSGDIVMTQTPLSLPVTLGEQASISCRSSQSLVYSDGKTYLNWYLQKPGQSPQLLMYLVSKRASGVPDRFSGRGSGTDFTLKISRVEAEDVGVYYCMQALRSP
Chlorocebus sabaeus V375 igkv AQIB01144237.1 20595 ARCDIQMTQSLSSLSASVGDRVTITCRASQGINNELAWYQQKPGKAPMLLLYSGSSLHTGVPSRFSGSGSGTDFTLAISSLQPEDVAPYYCLQDYTTP
Chlorocebus sabaeus V376 igkv AQIB01144237.1 28739 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSYGYTNLNWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISGVEAEDVGVYYCMQGIQLP
Chlorocebus sabaeus V377 igkv AQIB01144240.1 12920 TSGDIVMTQTPFSLPVNPGEPASISCRSSQSLSDSDGYTYLYWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Chlorocebus sabaeus V378 igkv AQIB01144242.1 6925 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLYWYVQKPGHSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGIQLP
Chlorocebus sabaeus V379 igkv AQIB01144242.1 18232 ARCDIQMTQSPSSLSASVGDRVTITCQGSQSLSNFLNWYQQKPGKIPKLLIYRASSLQSGIPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGYSYP
Chlorocebus sabaeus V380 igkv AQIB01144242.1 33677 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLDWYVQKPGQSPQLLIYLVSSRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQG
Chlorocebus sabaeus V381 igkv AQIB01144243.1 9277 TSGDIVMTQIPLSLPVTPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIYELSNRASGVPDRFSGSGSGTDFTLKISGVEAEDVGVYYCMQGIQLP
Chlorocebus sabaeus V382 igkv AQIB01144243.1 18761 ARCDIQMTQSPSSLSASVGDRVTITCQASQGITNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHYYSTP
Chlorocebus sabaeus V383 igkv AQIB01144243.1 52386 ARCDIQMTQSPSSLSASVGDRVTISCRASQNIYSNLAWYQQKPGKTPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDYATYYCQHHYGTP
Chlorocebus sabaeus V384 igkv AQIB01144244.1 12761 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGRTYLYWYLQKPGQPPRLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Chlorocebus sabaeus V385 igkv AQIB01144247.1 9076 SIGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Chlorocebus sabaeus V386 igkv AQIB01144251.1 6850 ARCDIQMTQSPSSLSASVGDRVTITCHASQGISNWLAWYQQKPGKAPKLLIYYASNLETGVPSRFSGSRSGTDFTVTISSLQPEDIATYYCQQYDNFP
Chlorocebus sabaeus V387 igkv AQIB01144251.1 16411 STGDVVMTQTPLSLPVTPGEPASISCRSSQSVLHSNGNTYLEWYLQKPGHSPRLLIYKVTKRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQGTKL
Chlorocebus sabaeus V388 igkv AQIB01144257.1 11970 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINNYLSWYQQKPGKAPKPLIYYASSLETGVPSRFSGSGSGPDYTLTISSLQPEDIATYYCQQYDNFP
Chlorocebus sabaeus V389 igkv AQIB01144258.1 1399 FSADVVMTQSPLSLPVTPGQPASITCRSSQSLLHSNGNTYLNWFLQKPGQPPRRLIYTVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQV
Chlorocebus sabaeus V390 igkv AQIB01144262.1 3453 SSGDVVMTQSPLSLPVTHGQPLSISCRSSQSLVNSDGNTYLSWLQQKPGQPPRPLIYQVSNRHSGVPDRFSGSGAGTDFTMKISRVEAEDVGVYYCLQATYRP
Chlorocebus sabaeus V391 igkv AQIB01144263.1 12288 SSGDVVMTQSPLSLPVTLGQPVSISCRSSQSLVHSDGKTYLNWLQQKPGQPPRLLIYQVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQG
Chlorocebus sabaeus V392 igkv AQIB01144263.1 20714 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSDGKTYLNWFQQKPGQPPRRLIYQVSSRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCVQG
Chlorocebus sabaeus V393 igkv AQIB01144263.1 50628 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLVYSDGKTYLDWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISSVEAEDVGVYYCMQAIQTP
Chlorocebus sabaeus V394 igkv AQIB01144263.1 59033 TRCAIQMTQSPSSLSASVGDRVTITCWASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLSISSLQPEDVATYYCQKCDSAH
Chlorocebus sabaeus V395 igkv AQIB01144263.1 96225 STGDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSSGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFTGSGAGTDFTLKISRVEAEDVGVYYCMEG
Chlorocebus sabaeus V396 igkv AQIB01144264.1 29332 STGDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSSGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFTGSGAGTDFTLKISRVEAEDVGVYYCMEG
Chlorocebus sabaeus V397 igkv AQIB01144264.1 45681 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Chlorocebus sabaeus V398 igkv AQIB01144264.1 72123 TTGEIVLTQSPATLSLSPGETATLSCRASQSVGSSLAWYQQKPGQVPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLQPEDFAVYYCQKYSSSP
Chlorocebus sabaeus V399 igkv AQIB01144264.1 77622 VRCDIQMTQSPSFLSASVGDRVTITCQASQSISNDLAWYQQKPGKSPTLLICDATNLHTGVPSWFSGSGSGADYYLTISSLELEDFAAYYCQQEYSYP
Chlorocebus sabaeus V400 igkv AQIB01144264.1 103472 SSGDIVMIQTPLSLPVTPGEPASISCRSSQNLLHSDGNTYLHWYLQKPGQSPQLLIYGGSNRFAGVPDRFSGSGSATDFTMKISRVEAKDVGVYYCMQGIQFP
Chlorocebus sabaeus V401 igkv AQIB01144265.1 9154 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLLIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Chlorocebus sabaeus V402 igkv AQIB01144265.1 25382 VRGDIQMTQSPSSLSASVGDRVTITCQASQSFSSSLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSKAGTDFTLTISSLQPEDVATYYCQQYYSTP
Chlorocebus sabaeus V403 igkv AQIB01144265.1 40573 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGIPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Chlorocebus sabaeus V404 igkv AQIB01144265.1 60995 ARCDIQMTQSPSSLSASVGDRVTVTCRASQGISNYLSWYQQEPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHN
Chlorocebus sabaeus V405 igkv AQIB01144265.1 75666 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQYNNWN
Chlorocebus sabaeus V406 igkv AQIB01144265.1 84908 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYSASRLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCEQFKNYL
Chlorocebus sabaeus V407 igkv AQIB01144269.1 1729 STGEIVMTQSPATLSLSPGETTTLSCSASQSVGSYLAWYQQKPGQAPKLLIHSAYFRATGIPDRFSGSGSRTVFTLTISSLEPEDVGVYYCQQYNDLP
Chlorocebus sabaeus V408 igkv AQIB01144269.1 40449 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYDASNLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQRNSLP
Chlorocebus sabaeus V409 igkv AQIB01144273.1 1761 ARCDIQMTQSPSSLSVSVGDRVTITCRASQGISNYLSWYQQKPGKAPKLLIYSASSLESGVPSRFSGSGSGTDYTLTISSLQPEDFAAYYCLQYQSIP
Chlorocebus sabaeus V410 igkv AQIB01144273.1 12274 TTREIVFTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKSGQAPRLLVYHASSRATGIPARFSGSGSGTDFTLTISSLEPEDVGVYYCQKYNDWP
Chlorocebus sabaeus V411 igkv AQIB01144273.1 55409 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNALAWYQQKPGKVPKLLIYAASSLQSGLPSGFSGSGSGTEFTLTISSLQPEDFATYYCQQGYSTP
Chlorocebus sabaeus V412 igkv AQIB01144273.1 67092 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNNLAWYQQKPGKAPKLLIYDATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSYP
Chlorocebus sabaeus V413 igkv AQIB01144273.1 86430 TTGEIVMTQSPATLSLSPGETATLSCKTSQSVGSKLAWYQQKPGQAPRLLIYGASSRATGIPARFSGSGSGTDFTLAISSLEPEDVGAYYCQETSSLS
Chlorocebus sabaeus V414 igkv AQIB01144274.1 43135 ARCDIQMTQSPSSLSASVGDTVTITCPASQGISSYLNWYQHKPGKAPKLLIYYATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYKSLP
Chlorocebus sabaeus V415 igkv AQIB01144274.1 49579 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQITSAP
Chlorocebus sabaeus V416 igkv AQIB01144274.1 65784 TTGEIVMTQSPATLALSPGERATLSCRTSQSVSSRLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQDYSWP
Chlorocebus sabaeus V417 igkv AQIB01144276.1 2594 SSGDTVMAQPPYSLPIIPSEPASISCRNSHSPLHSNGYTYLNWDLQKPSQPPWLPIYLISNRDPGVLDMFSGSGSVADFMLKISRVDAEDVGVYYCQQS
Chlorocebus sabaeus V418 igkv AQIB01144276.1 25004 ARRDIQMSQSPSSLSASVGDRVTITCHASQGISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQYDSNP
Chlorocebus sabaeus V419 igkv AQIB01144276.1 29447 TTGEIVMTQSPATLALSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Chlorocebus sabaeus V420 igkv AQIB01144276.1 40185 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNYLAWYQQKPGKAPKLLIYYASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSNP
Chlorocebus sabaeus V421 igkv AQIB01144276.1 56523 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNYLAWYQQKPGKAPKPLIYKASTLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQRNSYP
Chlorocebus sabaeus V422 igkv AQIB01144282.1 3102 TTGETVVTQSPATLSLSPGERATVSCRTSQSVSNRLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSGTDFTLTISSLELEDAAVYYCQQDNDWK
Chlorocebus sabaeus V423 igkv AQIB01144282.1 46330 CNGDIVLTQSPASLAVSPGQKATITCRASESVSLFGINFIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAANYYCLQSKTSP
Chlorocebus sabaeus V424 igkv AQIB01144282.1 64257 SNGEIVLTQSPTSMAVSQGERVTISCTASSSISTSYLHWYQQKPGFPPRLLVYTTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQGSSI
Chlorocebus sabaeus V437 iglv AQIB01146107.1 51376 WSMLTQLPSVSGGPGQRVTIFCTGSSKNVTNTYPVNWYQYLPGVCLDCSSLVIVIDPQESLTDFSGSKSGRLASLTITGLWPEDEADYHCQS
Chlorocebus sabaeus V438 iglv AQIB01146108.1 7853 CADSAALPVCIPGSNGQTPCTLSSDLSVGGKNMYWYQQKPGSAPRLFLYYYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYDSSA
Chlorocebus sabaeus V439 iglv AQIB01146109.1 4714 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNEGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Chlorocebus sabaeus V440 iglv AQIB01146109.1 46748 SLSQPVLTQPPSLSASQGASARLSCTLSSGFGADFYWIYWYQHKPGSRPRYLLSLYQNSLHDLGSGVPRRFSGLMEGWSNKGLLLISDLQPEDEADYYCMM
Chlorocebus sabaeus V441 iglv AQIB01146109.1 79029 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYNIAWHQQQQGKAPRYLMRLNSDGSHSKGDGIPDRFSGSSSGADRYLTISNLQSEDEADYYCHTWDTG
Chlorocebus sabaeus V442 iglv AQIB01146122.1 12220 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSSFVYWYQQRPGSAPTTVIYNDNRRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSDDSSG
Chlorocebus sabaeus V443 iglv AQIB01146122.1 51575 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCW
Chlorocebus sabaeus V444 iglv AQIB01146122.1 69510 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYNVHWYQQLPGTTPKLLIYGNNQRPSGVSDRFSGSKSGTSASLTITGLQSEDEADYYCQSYDSSLS
Chlorocebus sabaeus V445 iglv AQIB01146122.1 85426 SLSQPVLTQPPSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Chlorocebus sabaeus V446 iglv AQIB01146122.1 92191 SLSQPVLTQPTSLSASPGASARLTCTLRSGISVGSYRVLWYQQKPGNPPRYLLNYHTDSDKDQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCAI
Chlorocebus sabaeus V447 iglv AQIB01146122.1 97015 CWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNSVYWYQQFPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLTISGLQSEDEADYYCAAWDDSLSG
Chlorocebus sabaeus V448 iglv AQIB01146122.1 105975 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYPNWFQQKPGQAPKILIYDTSNKLSWTPARFSGSLHGGKAALTLSGAQPEDEAEYYCWLYYSGA
Chlorocebus sabaeus V449 iglv AQIB01146122.1 110607 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPPRYLLRYKSDSEKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Chlorocebus sabaeus V450 iglv AQIB01146122.1 120770 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHYFHWFQQKPGQAARTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGVQPEDEAEYYCW
Chlorocebus sabaeus V451 iglv AQIB01146122.1 126869 SLSQPVLTQPTSLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSASKDASANAGILLISGFQSEDEADYYCTT
Chlorocebus sabaeus V452 iglv AQIB01146122.1 131667 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIGSNYVSWYQQLSGKAPKLLIYKNSQRPSGVPDRFSGSKSGTSASLTISGLRSEDEADYYCAAWDDSLNG
Chlorocebus sabaeus V453 iglv AQIB01146122.1 142911 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGHSPHWCQQKPGQAPRTLIYNTNYKHSWTPARFSGSLLGGKAALILSGAQPEDEAEYYCWLYYSGA
Chlorocebus sabaeus V454 iglv AQIB01146122.1 150001 SLSQPVLTQPASLSASPGASARLSCTLSSGINVGSYSIYWYQQKPGSPPRYLLYYYSDSSKGQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Chlorocebus sabaeus V455 iglv AQIB01146122.1 159133 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYYVQWYQQLSGTAPKLLIYGNNQRPSGVSDRFSGSKSGTSASLTITGLQSEDEADYYCETWDNSLNG
Chlorocebus sabaeus V456 iglv AQIB01146122.1 164966 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGGYDVHWYQQLPGTTPKLLIYDNNKRPSGVSDRFSGSKSGTSASLTITGLQTEDEADYFCQSYDSSLG
Chlorocebus sabaeus V457 iglv AQIB01146122.1 187793 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPPRYLLWYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Chlorocebus sabaeus V458 iglv AQIB01146123.1 2183 SWAQSVLTQPRSASEATRKSITISCSGSSSNIGSNYVSWYQQLPGTAPKLLIYYNDWRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Chlorocebus sabaeus V459 iglv AQIB01146124.1 30277 LTSQAEVIQETSQTTNPGETITLTCGSSAGAVTTSNYADWFQQNPNQVPRGLIGDNTYRNPNVPEWFSGSLRAGKAVLTITGAQPEDEAFYYCALW
Chlorocebus sabaeus V461 iglv AQIB01146133.1 15767 SVASYELTQPPSVSVSPGQTAKITCSGDTLAKIYARWFQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQAEDEADYYCYSGDDNN
Chlorocebus sabaeus V462 iglv AQIB01146133.1 25441 SWAQSALTQSPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Chlorocebus sabaeus V463 iglv AQIB01146133.1 37915 SAASYDLTQPHSVSVSPGQTARITCGGDDIGSEAVHWYQQKPAQAPVLVIYDNSDRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDISSDH
Chlorocebus sabaeus V464 iglv AQIB01146133.1 45026 SVVSSELTQEPALSVALGHTVTMTCQGDSLSSYYASWYQQKPGQVPVLVIYGNTNRPSGISGRFSGSWSGNTASLTITGAQVEDEADYYCGSWDNSANH
Chlorocebus sabaeus V465 iglv AQIB01146135.1 5644 SAASYELTQPPSVSVSPGQMARITCRGDSIGSKYVQWFQQKPAQAPVLVIYSDSKRPSGIPERFSGSNSGNTATLTISGVQAGDEADYYCQVWDSSSKH
Chlorocebus sabaeus V466 iglv AQIB01146136.1 1667 SWAQSAPTQPRSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTAPKLMIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Chlorocebus sabaeus V467 iglv AQIB01146137.1 9888 SVASYELTQPPSVSVSPGQTARITCSGDVLKENYADWYQQKPGQAPVLLIYEDSKRPSGIPERFSGSTSGDTTTLTISSTLSEDGADYYCFSGDENN
Chlorocebus sabaeus V468 iglv AQIB01146137.1 18235 SAVSYELTQPRSVSVSPGQTARITCGGDSIGSKYVHWYQQKPAQAPVLVIYDNSNRPSGIPERFSGSNSGNTATLTISGVQAGDEADYYCQVWDSSSKH
Chlorocebus sabaeus V469 iglv AQIB01146137.1 25866 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSSYASWYQQKPGQAPVLVVYGNNNRPSGIPERFSGSSSGNTASLTITGAQVEDEADYYCNSWDSSGNH
Chlorocebus sabaeus V470 iglv AQIB01146138.1 15716 SWAQAALTQPPSVSKSLGQSVTISCTGTSSDIAAYNDVSWYQQHPGTAPRLLIYSVSNRPSGVSDCFSGSKSGNTASLTISGLQAEDEADYYCCSYRSG
Chlorocebus sabaeus V471 iglv AQIB01146138.1 24131 SAVSYELTQPRSVSVSPGQTARITCGGDSIGSKYVHWYQQKPAQAPVLVIYDNSNRPSGIPERFSGSNSGNTATLTISGVQAGDEADYYCQVWDSSSKH
Chlorocebus sabaeus V472 iglv AQIB01146140.1 2760 SWAQAALTQPHSVSGSPGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASSSN
Chlorocebus sabaeus V473 iglv AQIB01146140.1 9670 SEASYELTQPPSVSVSPGQTARITCSGEILAKKYARWFQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGVQAEDEADYYCQSADSSGNH
Chlorocebus sabaeus V474 iglv AQIB01146140.1 26016 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVNKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Chlorocebus sabaeus V475 iglv AQIB01146141.1 2347 SVASYELTQPPSVSVSPGQTARITCSGDALPDNYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSADSSGN
Chlorocebus sabaeus V476 iglv AQIB01146141.1 10121 SVASYELTQPLSVSVALGQMARITCGGNNIGRKNVQWYQQKPDQAPVLVIYQDSKRPSGIPERFSGSNSGNTATLTIDRAQAGDEADYYCQVWDS
Chlorocebus sabaeus V477 iglv AQIB01146141.1 13493 SWAQAAPTQSPSVSGSAGQSVTISCTGTSSDIGGYNRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Chlorocebus sabaeus V478 iglv AQIB01146141.1 50604 SWAQSAPIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYRQQPGTTTKLTMYNVNTRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYETS
Chlorocebus sabaeus V479 iglv AQIB01146141.1 55802 FVAFSELTQLPEVSAALGQMARITCHAEDLESYYAHWYQQKTVQTPKLIVYNDRKLRSEIAERFSGSCSGVTVILTITRAQVEDYYCFSGDK
Chlorocebus sabaeus V480 iglv AQIB01146141.1 69741 LCALPVLTQAPSASASLGASVKLTCTLSSEHSNYYIIWYQQRPGKSPRYIMKVNSDGTHSKGDGIPDRFLGSSSGVDRYLTISNLQSDDEAEYYCGE
Chlorocebus sabaeus V517 ighv AQIB01153480.1 7303 VLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSYWWGWIRQAPGKGLEWIGNIYGSGGSTEYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Chlorocebus sabaeus V518 ighv AQIB01153481.1 29871 VQCEVQLVESGGGLIQPGGSLRLSCAASGFTFSDYAMSWVRQASGKGLEWVGYIRSKSNNYATEYAASVKGRFTISRDDSKNTLYLQMSGLKTEDTAVYYCTI
Chlorocebus sabaeus V519 ighv AQIB01153482.1 4670 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKSITSLQMNSLKTEDTAVYYCTR
Chlorocebus sabaeus V520 ighv AQIB01153482.1 18680 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFGDYAMSWVRQAPGKGLEWVSSISNTGKTTYYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Chlorocebus sabaeus V521 ighv AQIB01153482.1 23776 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSNYYMHWVRQAPGKGLEWVSSINTGGGSTYYADSVKGRFTISRDNSKNTLSLQMDSLRAEDTAVYYCAK
Chlorocebus sabaeus V522 ighv AQIB01153484.1 24205 AQSQVQLVQPGAEMRKPGDSVKVSCKASGYTFTNHDVDWVRQAPGQGPEWMGGINTNTGGTSCAQTFQGRVTMTRDTTTSTAFMELSSLRSEDTAVYYCAR
Chlorocebus sabaeus V523 ighv AQIB01153484.1 33460 AHSQVQLVQSGAEIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Chlorocebus sabaeus V524 ighv AQIB01153485.1 163 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYHMHWVRQAPGKGLQWVSAINSGGGSTWYADSVKGRFTISRENAKNTLYLQMDSLRAEDTAVYYCAK
Chlorocebus sabaeus V525 ighv AQIB01153486.1 415 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMHWVRQAPGKGPEWVGFIRSKAYGGTAEYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTI
Chlorocebus sabaeus V526 ighv AQIB01153489.1 27644 AHSEVQLVQSGAEVRKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGVDPVYGETIHAEKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAR
Chlorocebus sabaeus V527 ighv AQIB01153491.1 2236 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLTTSGMGVGWIRQPPGKALEWLAHIYWDDDKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Chlorocebus sabaeus V528 ighv AQIB01153491.1 11515 VHSQVQLVQSGAEVKKPGASVKLSCKASGFTLGSYAISWVRQAPGQGLEWMGGIIPLVGITNYAQKFQGRVTITADTSTTTAYMELSSLRSEDTAVYYCAR
Chlorocebus sabaeus V529 ighv AQIB01153491.1 20599 AHSQVQLVQSGAEVEKPGASVKVSCKATGYTFTNYFMQWVRQAPGQGLEWMGWVYLGNGNTNYVQKFQGRVTMTRDVSTNTAYMELGSLRSKDMAVYYCAR
Chlorocebus sabaeus V530 ighv AQIB01153492.1 6794 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSYWSWIRQSPGKGLEWIGDIYGSSGGSTSYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Chlorocebus sabaeus V531 ighv AQIB01153498.1 780 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMQWVRQAPGQGLEWMGRINPKTGGTDYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Chlorocebus sabaeus V532 ighv AQIB01153498.1 3704 AAGGVWGRLGPAWRVPETLCAASGFTFSDHYMQWVRQAPGKGPEWVGLIRNKANGGTTAYAASVKGRFTISRDDSKNVTYLQMSSLKTEDTAVYYCTR
Chlorocebus sabaeus V533 ighv AQIB01153501.1 4569 VQCEVQLVESGGGLVQPGASLRLSCAASGFTFGDYAMSWVRQAPGKGLEWVSYISSASSTIYYADSVKGRFTISRDNAKNSLYLQMNSLKTEDTAVYYCTR
Chlorocebus sabaeus V534 ighv AQIB01153501.1 18761 VQCEVQLVESGGGVVQPEGSLRLSCAASRFTFDDYAMSWVRQAPGKGLEWVSVISWTRRSTYYADSVKGRFTISRDNTKNSLYLQMDRLRAEDTALYYCAKD
Chlorocebus sabaeus V535 ighv AQIB01153501.1 26954 VLCEVQLVESGGGLVQPGASLRLSCAASGFTFRSYDMHWVRQAPGKGLEWVSAISTGGGTYYPDSVKGPFTISRDNPKNSVYLQMHSLRAEDTAVYYCAR
Chlorocebus sabaeus V536 ighv AQIB01153501.1 33861 AHAQVQLVQSGAEVKQPGSSVKVSCKASGYTFTISVMQWVQQAPGQDLQWIGRIYPYNGNTKYAQNFQGRVTMTTDTSTSTAYMELSSLRSEDTPVYYCGK
Chlorocebus sabaeus V537 ighv AQIB01153504.1 6986 AHSQVQLVLSRAEVEKPGASVKVSCKASGYTFTSYFMQWVGQAPGQGREWMGWVYLGNGNTNYEQKFQGRVTITRDVSTSTTYMELSTLRSEDMAVYYCA
Chlorocebus sabaeus V538 ighv AQIB01153506.1 6409 AHSQVQLVLSRAEVEKPGASVKVSCKASGYTFTSYFMQWVGQAPGQGREWMGWVYLGNGNTNYEQKFQGRVTITRDVSTSTTYMELSTLRSEDMAVYYCA
Chlorocebus sabaeus V539 ighv AQIB01153507.1 14781 ALSQVQLQESGPGVVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYGSGGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTATDTAVYYCA
Chlorocebus sabaeus V540 ighv AQIB01153507.1 24716 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSLINSDGGSTRYADSVKGRFTISSENAKNSLYLQMNSLRAEDTAVYYCAR
Chlorocebus sabaeus V541 ighv AQIB01153507.1 32455 VQCEVQLVQSGGGLVQPGGSLRLSCAASGFTFSEYAMAWVRQASGKGLEWVGRIRSKSNNYGTAYAASVKGSFTISRDDSKNTLYLQMSSLKTEDTAVYYCTR
Chlorocebus sabaeus V542 ighv AQIB01153507.1 42170 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYYMDWVRQAPGKGLEWVGRIRNKANSHTTEYAASVKDRFTISRDDSKNTLYLQMSGLKTEDKAVYYCAR
Chlorocebus sabaeus V543 ighv AQIB01153509.1 6084 VQCEVQLVESGAGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVSRISSGSGSSTYYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Chlorocebus sabaeus V544 ighv AQIB01153509.1 13580 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYMHWVRQAPGKGQEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSITSLQMNSLKTEDTAVYYCTR
Chlorocebus sabaeus V545 ighv AQIB01153509.1 29999 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYDMSWVRQAPGKGLEWVSFISYTGKTTYYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCTR
Chlorocebus sabaeus V546 ighv AQIB01153509.1 45358 AHSEVQLVQSGAEVKKPGASVNVSCKASGYTFTDYYLHWVRQAPGKGLEWMGRIDPENGESKYAQKFQDRLTMTADTSTDTAYMELSSLRSEDTAVYYCAT
Chlorocebus sabaeus V547 ighv AQIB01153511.1 7982 VQCEVQLVESGRGLVQPGGSLRLSCAVSGFTFSDHYMSWVREAPGKGLEWVGFMRNKANGGRTEYAASVKGRFTISRDDSKSIASLQMSSLKTEDTAVYYCAR
Chlorocebus sabaeus V548 ighv AQIB01153511.1 11097 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGLEWVSSISTGSGSTTLYPDSVKGRFTISRDNAKNTLYLQMNSLRADDTAVYYCA
Chlorocebus sabaeus V549 ighv AQIB01153511.1 27557 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYWWGWIRQPPGKGLEWIGYIHGSGGSTNYNPSLKSRVPISKDTSKNQFSLKLSSVTAADTAVYYCAR
Chlorocebus sabaeus V550 ighv AQIB01153511.1 40800 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWISAINSGGSNTWYTDSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Chlorocebus sabaeus V551 ighv AQIB01153514.1 1202 VLSQVTLKESGPVLVKPTQTLTLTCTFSGFSLSTSGVGVSWTRQPPGKALEWLALIYWHDDKNYSPSLKSRLTISKDTSNNQVVLTMTNMDPVDTATYYCARR
Chlorocebus sabaeus V552 ighv AQIB01153517.1 603 VLSQVQLQQWGGGLVKPSETLSLTCAVYGGSISGYYYWSWIRQPPGKGLEWIGNIDGNSGSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Chlorocebus sabaeus V553 ighv AQIB01153522.1 389 VLSQVQLQESGPGLLKPSETLSLTCAVSGGSISGGYGWGWIRQPPGKGLEWIGSIYTSSGNTYYNPSLKSRVTISTDTSNNQFSLKLNSVTAADTAVYYCAR
Chlorocebus sabaeus V554 ighv AQIB01153537.1 1708 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYGMHWVRQAPGKGLEWVSDISWDGDSTYYADSVKGRFTISRDDAKNSLYLQMDSLRAEDTALYYCAKD
Chlorocebus sabaeus V555 ighv AQIB01153538.1 4313 AQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYNINWVRQAPGQVLEWMGWINPSNGNTGYAQKFQGRVTMTRDTSTSTAYMELSSLISEDTAVYYCAR
Chlorocebus sabaeus V556 ighv AQIB01153538.1 21431 AHSQVQLVQSGVEVKKPGASVKVSCKASGYTFSIYAISWVRQAPGQGLEWMGAIIPLVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Chlorocebus sabaeus V557 ighv AQIB01153538.1 31033 AHSQVQLVQSGAEGKKPGSSVKVSCKASGYTFTNSAVQWVRQSPEQGLEWIGVIIIGNDNTGYAQKFQGRVTITMDVSMSTAYVELSSLRSEDMAVYYCAA
Chlorocebus sabaeus V558 ighv AQIB01153541.1 19821 AHSQEQLVQSGAEVKKPGASVKVSCKASGYIFTGYIISWLRQAPGQGFEWMGGINPSDGSTSYAQKFQGRVTMTRDTSTSTVYVELSSLRSEDTAVYYCAA
Chlorocebus sabaeus V559 ighv AQIB01153541.1 23912 AHSEMQLVQSEAEVKKPGASVKVSCKVSGYTFTYPYLHWVRQTPGQGLEWMGWITPYNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAVYYCAR
Chlorocebus sabaeus V560 ighv AQIB01153543.1 7058 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMGWVRQAPGKGLEWVSGISWNSGSTGYADSVKGRFTISRDNAKNSLYLQMNRLRAEDTALYYCAKD
Chlorocebus sabaeus V561 ighv AQIB01153550.1 2977 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSAYDWSWIRQPPGKGLELIGYIYGNSASTSYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Chlorocebus sabaeus V562 ighv AQIB01153553.1 7963 VQGEVQLVESGGGLAKPGGSLRLSCSASGFTFSDYYMHWVRQASGKGLEWVSRINTGGGSTWYADSVKGRFTISRENAKNTLYLQMDSLRAEDTAVYYCAR
Chlorocebus sabaeus V563 ighv AQIB01153553.1 15673 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGLIRNKVDGETTDYAASVKGRVTISRDESKSITYLQMNNLKTEDTAVYYCAR
Chlorocebus sabaeus V564 ighv AQIB01153553.1 22332 VQGEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWARQAPGKGLEWVSYISSGGGNTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAR
Chlorocebus sabaeus V565 ighv AQIB01153555.1 4671 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSSWISWVRQMPGKGLEWMGRIYPGDSDTEYSPSFQGQVTISADKSISTTYLQWSSLKASDTATYYCAK
Chlorocebus sabaeus V566 ighv AQIB01153555.1 23905 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLKWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCTR
Chlorocebus sabaeus V567 ighv AQIB01153555.1 39961 VQCEVQLVESGGGLVQPEGSLRLSCVASGFTFSNYDMAWVRQAPGKGLEWVSRISSPSGSSTYYPDSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Chlorocebus sabaeus V568 ighv AQIB01153556.1 2511 VQCEVQLVEYGGGLVQPGGSLRHSCGFTFSDHYMSWVHPAPGKGLEWVGFMRNKANGGRTEYAASVKGRFTISRDDSKSIASLQMSSLNTEDTVLYYCAR
Chlorocebus sabaeus V569 ighv AQIB01153557.1 2990 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSRISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAR
Chlorocebus sabaeus V570 ighv AQIB01153557.1 15137 VQCEVQLVESGGGLVQPGGTLRLSCAASGFTFGNSDLIWIRQAPGKGLEWVSYISSGGSTYYSDSVKGRFTISRENAKNTLYLQMSSLRVEDTAVYYCVR
Chlorocebus sabaeus V571 ighv AQIB01153558.1 4804 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSWMSWVRQAPGKGLEWVARIKSKADGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTI
Chlorocebus sabaeus V572 ighv AQIB01153561.1 997 VQCEVQPVESGGGLVQPGGSLRLSCTASGFTFSSTRMNWIRQSPGKRLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVR
Chlorocebus sabaeus V573 ighv AQIB01153564.1 5747 VSAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQIPGKGLEWIGTIYPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAK
Chlorocebus sabaeus V574 ighv AQIB01153565.1 7318 VCAEVQLVQSGAEVKKPGESLKISCKTSGYSFTSYWISWVRQIPGKGLEWIGAIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKSSDTATYYCAK
Chlorocebus sabaeus V575 ighv AQIB01153566.1 30568 VQCEVQLVESGGGLVQPGGTLRLSCAASGFTFSNYWMDWVRQAPGKGLEWVGFIKNKADGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Chlorocebus sabaeus V588 igkv AQIB01156901.1 3350 AKCDIQMTQSPSSLSASVGDKVTITCQASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSAP
Chlorocebus sabaeus V590 igkv AQIB01158310.1 1188 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLNWYLQKPGQSPLLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQDIKLP
Chlorocebus sabaeus V608 trbv AQIB01162308.1 21253 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLYFYWYRQILGQKVEFLVIFFDNNISEKSEIFDDRFSVGRPDGSDFTLKIKSTKLEDSAMYFCASSE
Chlorocebus sabaeus V609 trbv AQIB01162311.1 7783 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVYFYNDKILEKSEIFDDRFSVERPDGSNFTLKIKSTKLEDSATYFCASSE
Chlorocebus sabaeus V610 trbv AQIB01162311.1 11770 SLDTAVSQTPKYLVTQMGKKVSLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKELTINETVSTRFSPESPDKAHLILHIKSLELGDSAVYFCASSQ
Chlorocebus sabaeus V611 trbv AQIB01162312.1 4221 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFVYQYEKLSINESVPSRFSPECSKSSLLYLHLQALQPEDSALYLCASSQ
Chlorocebus sabaeus V612 trbv AQIB01162312.1 12156 HTEPEVTQTPSHQVTQMGQEVILWCVPISNHFYFYWYRQILGQKVEFLVYFYNGEISEKSEIFDDRFSVGRSDGVHFTLKIKSTKLEDSATYFCASSE
Chlorocebus sabaeus V613 trbv AQIB01162312.1 18646 PLDTAVFQTPKYLVTQMGKKVSLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNEEPILNETVPNRFSPESLGKAHLNLHIKPVELGDSAVYFCASSQ
Chlorocebus sabaeus V614 trbv AQIB01162312.1 22991 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFVYNYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Chlorocebus sabaeus V615 trbv AQIB01162312.1 33926 PVEAGVTQTPRSLIKMRGQQVTLSCSPISGHRSVSWYQQTPGQGLQLLFEYFSETQRQKGNFPNRFSGRQFSNSHSEMNVSTLELGDSALYLCASSL
Chlorocebus sabaeus V616 trbv AQIB01162312.1 41445 PANADVTQSPKFQILKTGQNMTLKCAQDMNHNSMYWYRQDPGMGLRLIHYSATEDTTDTGEVPDGYSVSRLNKKEFLLRLESAAPSQTSVYFCASSE
Chlorocebus sabaeus V617 trbv AQIB01162312.1 55585 SLDTAVSQTPKYLVTQTGKNESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYSNKEPVLNETVPNRFSPKSPDKAHLNLYITSVELGDSAVYFCASSQ
Chlorocebus sabaeus V618 trbv AQIB01162312.1 59015 PMETGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKERAENNSVPSRFSPECPDSSLLYLHLRALQPEDSALYLCASSQ
Chlorocebus sabaeus V619 trbv AQIB01162312.1 70732 PVNAGVTQTPKFQILKTGQNMTLKCAQDMNHDRMYWYRQDTGMGLRLIHYSVGEGNTEKGEVPSGYNASRLNKKDFLLRLELAAPSQTSIYFCASSE
Chlorocebus sabaeus V620 trbv AQIB01162312.1 74327 HTDAGVSQSPRNKVTEEGKDVVLRCDPISGHIALYWYRQSLGKGLEFLIFFQGNDAPDKSGLPSGRFSAERLEGSVSTLKIQRTQQGDSAVYLCASSS
Chlorocebus sabaeus V621 trbv AQIB01162313.1 10116 HTGAGVSQSPSNKVTEKGNVALRCDPISGHAVLYWYRQNLGQGLEFLIYFQGTSAVDDSGLRSDRFSATRPEGSVSTLKIQRTEQGDSATYFCASSL
Chlorocebus sabaeus V622 trbv AQIB01162313.1 15116 PVDTGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFKYANELRTSEGNFPHRFSGRQFRDYHSEMNVSALELGDSALYLCASSL
Chlorocebus sabaeus V623 trbv AQIB01162313.1 17799 SVDSGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGAERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSL
Chlorocebus sabaeus V624 trbv AQIB01162314.1 7363 HRDAEITQSPRHKITETGRQVTLKCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNEEDFPLTLESAASSQTSVYFCASSE
Chlorocebus sabaeus V625 trbv AQIB01162314.1 17006 LTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQNDGVVDDSQLPKDRFSAERLKGVNSTLRIQPAELGDSAMYLCASSL
Chlorocebus sabaeus V626 trbv AQIB01162316.1 5794 HRDAGITQSPRYKVTEIGRQVTLTCHQTWNHSNMFWYRQDLGHGLNLIYYSAGASITDKGEVPDGYAVSRSKTEDFPLTLESATRSQTSVYFCASSE
Chlorocebus sabaeus V627 trbv AQIB01162317.1 5957 LTEAGVAQSPRYKVIEKSQAVTFWCNPGHATFTGTGHATLYWYRQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAKLGDSAVYLCASSL
Chlorocebus sabaeus V628 trbv AQIB01162317.1 23072 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDCMYWYRQDPGMGLRLIHYSFGKGSTDKGEVPDGYNVTRSSTEDFTLRLESAAPSQTSVYFCASSY
Chlorocebus sabaeus V629 trbv AQIB01162317.1 27283 HTGAGVSQSPRYRVTKRGQDVALRCDPISGHDYLYWYQQAPGQGPAFLTYFQNDAQRDKSGLPNDRFSAERPEGSLSTLKIQRTQQGDSAVYLCASSL
Chlorocebus sabaeus V630 trbv AQIB01162317.1 35257 PVQAGVTQSPTHLIKTRGQQVTLRCSPISGHSSVYWYQQALGQGLQFILSYDEEEERDRGTFPHRFSGHQFPNYSSELNVNASEVGDSALYLCASSL
Chlorocebus sabaeus V631 trbv AQIB01162317.1 46600 HTGAGVSQSPSYKVTKRGQDVALRCDPISGHVALYWYRRTLGQGPELLTYFQNDAQPDKSGLPSDRFSAERPEGSVSTLKIQRTQQGDSAVYLCASSL
Chlorocebus sabaeus V632 trbv AQIB01162318.1 2951 LVNAGVTQTPKFQVLKTGQSMTVQCAQDMNHDYMFWYRQDPGMGLRLIHYSGAAGTTDKGEVPSGYNVSRLNTEDFPLRLESAAPSQTSVYFCASSY
Chlorocebus sabaeus V633 trbv AQIB01162319.1 8581 PVDAGVTQSPTHLIKMRGQQVTLRCSPISGHNTVSWYQQALGQGPQFIFQYYEKEEREKGNFPGRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Chlorocebus sabaeus V634 trbv AQIB01162319.1 25284 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPQLIFQYYEKEEREKGNFPGRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Chlorocebus sabaeus V635 trbv AQIB01162319.1 33231 HTGAGVSQSPRYRVTKRGQEVAFRCDPISGHEYLYWYQQAPGQGPEFLTYFQNDAQLDKSGLPSGRFSAERPEGSVSTLKIQRTQQGDSAMYLCASSL
Chlorocebus sabaeus V636 trbv AQIB01162319.1 42072 PVEPGVTQSPTHLIKTRGQQVILRCSPISGHSSVSWYQQSLGQGPQFIFEHYEKEERGRGNFPGRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Chlorocebus sabaeus V637 trbv AQIB01162319.1 49538 PGNADVTQTPKFQLLKTGQSLTLQCAQDMNYNYMFWYRQDPGVGLRRIHYSVAAGITDKGEVPNGYNVSRLNREDFPLRLESAALSQTSVYFCASSD
Chlorocebus sabaeus V638 trbv AQIB01162320.1 3377 PVDTGVTQSPTHLIKMRGQQVTLRCSPISGHSSVYWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Chlorocebus sabaeus V639 trbv AQIB01162320.1 10670 PVNAGVTQTPKFQVLKTGQSMIVQCAQNMNHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRRNTEDFLLRLESAALSQTSVYFCASSY
Chlorocebus sabaeus V640 trbv AQIB01162320.1 14922 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYKDQPDKSGLPNNRFSAERPEGSFSTLTIQRTEQQDSAVYLCASSL
Chlorocebus sabaeus V641 trbv AQIB01162320.1 23597 SVDAGVTQSPMHLIKTRGQQVTLRCFPISGHNTVSWYQQTLGQGPQLIFQYYREEERGKGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Chlorocebus sabaeus V642 trbv AQIB01162320.1 39065 SVAAGVTQSPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQRDKGSIPDRFSAQQFSDYHSELNMSSLELGDSAVYLCASSL
Chlorocebus sabaeus V643 trbv AQIB01162320.1 46878 HMDARITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGHGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATRSQTSVYLCASSE
Chlorocebus sabaeus V644 trbv AQIB01162320.1 57862 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLVRYENEEAVDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Chlorocebus sabaeus V645 trbv AQIB01162320.1 63468 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHNSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Chlorocebus sabaeus V646 trbv AQIB01162320.1 66750 HTDAGVIQSPRHEVIEMGKEVTLRCEPISGHTYLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAEMPEASFSILKIQPSEPRDSAVYFCASSL
Chlorocebus sabaeus V647 trbv AQIB01162320.1 82429 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTIFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAEMPNASLATLKIQPSEPRDSAVYLCASGL
Chlorocebus sabaeus V648 trbv AQIB01162320.1 89343 HIEAGVTQFPSHRVIEKGQAVTLRCEPISGHDYLYWYRRVMGKELKFLIYFLRASMQDEFGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Chlorocebus sabaeus V649 trbv AQIB01162320.1 94445 HGDVMVIQNPRYQVTQLGKPVTLSCSQNLNHRVMYWYQQKPSHAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDISSPGLEDAAVYLCASSK
Chlorocebus sabaeus V650 trbv AQIB01162320.1 99413 SPGEEVTQTPKHLVKGEGQKAKLYCAPITGHSYVFWYQQVLRKEFKFLISFQNKNVFDETGMPKERFSAKCPPNSPCSLEIQATKLKDSAVYFCASSQ
Chlorocebus sabaeus V651 trbv AQIB01162321.1 2364 TVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQTVNDIQKGDTAEGYSVSRERKQSFPLTVTSAQRNPTAFYLCASSI
Chlorocebus sabaeus V652 trbv AQIB01162321.1 10261 GSGLAAVVSQYPSRVICKTGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNEGSSVTYEQGIKRDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Chlorocebus sabaeus V653 trbv AQIB01162321.1 20390 STDTKVTQRPRLLVKANEQKAKMDCVPVKGHSYVYWYRKKLDEELKFLIYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDAALYFCASSK
Chlorocebus sabaeus V654 trbv AQIB01162321.1 29354 SFHAEVTQTPGYLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFTFLISFQNEQVLQETELHKKRFSSQCPKNPPCSLEIPSSEPGDTALYLCASSQ
Chlorocebus sabaeus V655 trbv AQIB01162321.1 41540 SMDADVTQTPRNKIAKTGKRIMLECSQTKSHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYNVSRQEQAKFSLSLESATPNQTALYFCATSD
Chlorocebus sabaeus V656 trbv AQIB01162321.1 50023 LMEADIYQNPRHCVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Chlorocebus sabaeus V657 trbv AQIB01162321.1 81252 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEMVDKGDIPEGYIVSRKEKRNFLLILESPSPSQTSLYFCASSL
Chlorocebus sabaeus V658 trbv AQIB01162321.1 86585 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKLNEKGDIPEGYNVSREKKERFSLILGFASTNQTSMYLCASSL
Chlorocebus sabaeus V659 trbv AQIB01162321.1 106453 SVFSAVVSQKPSRDVCQRGTSVTIQCQVDSQVTMMFWYRQQPGQSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Chlorocebus sabaeus V798 ighv AQIB01086294.1 25539 VRCEVQRVESGGGLVQPGGSLRLSCAASGFTISSSWMNWDFQAPGKGLECVSHISSVGSTDYPDSIKGQFTISRDNTKNTLYVQMNSLRAEDMAVYYCAR
Chlorocebus sabaeus V885 trdv AQIB01128634.1 37307 VSLDIILKPDTKALTVLIGEAATFHCSITGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Chlorocebus sabaeus V886 trdv AQIB01128634.1 16443 VMSAIELVPEHQTVIVSVGDPATLRCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDMDTEENQAVLKILAPSERDEGSYYCASD
Chlorocebus sabaeus V887 trav AQIB01128636.1 100583 LSGELKVGQNPLFLSTQEGKNDTIYCNYSTASDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRFMASLDTKARLSTLHITAALQDLSATYFCAV
Chlorocebus sabaeus V888 trav AQIB01128637.1 76381 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQRPSQGPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHHATLRDAAVYYCILR
Chlorocebus sabaeus V889 trav AQIB01128637.1 71659 VSSQELEQSPQSLIVQEGRNLTINCTSSKTLHGLHWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKRQQSFLHITACQPSHAGIYLCGGD
Chlorocebus sabaeus V890 trav AQIB01128637.1 58110 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNNLLWYKQDPGEGPVLLMALFKPGELTSNGRLFAQFGITRKDSFLNISASVPSDVGTYFCAG
Chlorocebus sabaeus V891 trav AQIB01128637.1 53365 VSSEDKVVQNPLSLVVHDGDTVTLNCSYEVVNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTRDSAVYLCAVE
Chlorocebus sabaeus V892 trav AQIB01128637.1 50433 SGRADWIEPREREVSGTEGKTVNLLCNYGTSSGSYLDLYWFRQYPSQAPEYILFRGWGYSGKGDANFAIGKFYSKSTAKSTNLYTRNLVPADTALYYCVL
Chlorocebus sabaeus V893 trav AQIB01128637.1 20294 SGMAQTVTQSQPEMSVREAETVTLSCTYDTSESDYYLFWYQQPPSRQMTLIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Chlorocebus sabaeus V894 trdv AQIB01128637.1 11114 SGMAQTVTQSQPEMSVREAETVTLSCTYDTSESYYYLFWYKQPPSRQMTLIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAARYFCAYR
Chlorocebus sabaeus V895 trav AQIB01128641.1 88776 VRGIQVEQSPPDLILQEGANSTLRCNFSATVSNLQWFHQNPWGQLINLFYIPSGTKQNGRLIATTVTKERYSLLHISSSQTTDSGIYFCAVESQCSP
Chlorocebus sabaeus V896 trdv AQIB01128641.1 65882 SSVAQKVTQAQSSVSMTVGKAVTLNCQYETSWWSYYLFWYKQLPSKEMIFLIRQGSSEQNARNGRYSVNFEKAASSIALTISALQLEDSATYFCALWE
Chlorocebus sabaeus V897 trav AQIB01128641.1 57032 VRSILNVEQSPQSLHAQEGDSTNFTCSFPSSSFYALHWYRWETAKIPKALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Chlorocebus sabaeus V898 trav AQIB01128641.1 49630 VNGQQIMQIPQYQHVQEGEDFTTYCNFSTTLNNIQWYKQRPGGHPVFLMMLVKSGEVKKQKRLTFRSGEAKKNSSLHITASQTTDVGSYFCA
Chlorocebus sabaeus V899 trav AQIB01128641.1 38658 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISANEYIHWYRQIHSQGPQYVIHGLKNKETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Chlorocebus sabaeus V900 trav AQIB01128641.1 19105 VSTQQLEQSPWFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLVRLVTGGEVKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Chlorocebus sabaeus V901 trav AQIB01128642.1 16703 LSGEDQVTQSPEALSLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Chlorocebus sabaeus V902 trav AQIB01128642.1 4777 VSGKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYITASQPTDSATYLCAV
Chlorocebus sabaeus V903 trav AQIB01128643.1 30420 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPKKEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLR
Chlorocebus sabaeus V904 trdv AQIB01128643.1 27204 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRETTYYLFWYKQPPSGELVFLIRQNSFNEQNEINGRYSSNFQKSTSSFNLTITASQVMDSAVYFCALNE
Chlorocebus sabaeus V905 trav AQIB01128644.1 311636 MCLVLGTTGQNIDQPTEMTAMEGAIVQINCTYQTSGFNGLSWYQQHDGEAPILLSYNVLDGLEQKDRFSSFLSNSKRYSYLLLKELQMKDSASYLCAVR
Chlorocebus sabaeus V906 trav AQIB01128644.1 225965 GLRAQLVTQPEDQVTVAEGNPLTGKCTYSVSGNPYLFWYVQYPNQGLQFLLKYITGDNLVKGNYGFEAEFNKSQTSFHLKKPSVLVSDSALYFCAVR
Chlorocebus sabaeus V907 trav AQIB01128644.1 213354 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATSDYIMWYQQFPNQGPRLIIQGYKANIANEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Chlorocebus sabaeus V908 trav AQIB01128644.1 184908 MSRGDDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLIYILSNTDLKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Chlorocebus sabaeus V909 trav AQIB01128644.1 174954 VKSQKIEQNSETLNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRSPVFLLLIRENEKEKWKERLKVTFDTTLKKSLFHITASQPADSATYLCAL
Chlorocebus sabaeus V910 trav AQIB01128644.1 139570 GINGDSVVQTEGQVLLSEGNSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKAMKDNDKESNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Chlorocebus sabaeus V911 trav AQIB01128644.1 126387 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGLISLTIMTFSDNTKSNGRYTATLDADTKQSSLYITAAQLSDSASYICVVS
Chlorocebus sabaeus V912 trav AQIB01128644.1 122713 VNRLRTLEQSPSFLSVQEGMHAILNCTFQVRTFFNFHWCLQDPGKGFVSLTLIQSSQKEQGDKYFQELLGKQKFYSVWNLPDSHPGDSATYFCALWQCLP
Chlorocebus sabaeus V913 trav AQIB01128644.1 110808 VWGQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Chlorocebus sabaeus V914 trav AQIB01128644.1 105344 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFPPNLFWYVQYPNQGLQLLLKYISGTALVKGINGFKAEFKKSETSFHLTKASAHVSDAAEYFCAVS
Chlorocebus sabaeus V915 trav AQIB01128644.1 99828 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Chlorocebus sabaeus V916 trav AQIB01128644.1 85919 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQSIIDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Chlorocebus sabaeus V917 trav AQIB01128644.1 80072 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLIRQESYDKQNATEGRYSLNFQKARKSVNLVISASQVEDSAMYFCAMR
Chlorocebus sabaeus V918 trav AQIB01128644.1 62147 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAVKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Chlorocebus sabaeus V919 trav AQIB01128644.1 53429 VNRLRTLEQSPSFLSVQEGMHAILNCTFQVRTFFNFHWCLQDPGKGFVSLTLIQSSQKEQGDKYFQELLGKQKFYSVWNLPDSHPGDSATYFCALWQCLP
Chlorocebus sabaeus V920 trav AQIB01128644.1 37610 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYRQYSRKGPQLLIYIYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Chlorocebus sabaeus V921 trav AQIB01128644.1 24626 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSARISDTAEYFCAVS
Chlorocebus sabaeus V922 trav AQIB01128644.1 12758 GTRAQSVTQPEKLLSVFKGAPVELKCYYSYSGSPNLFWYVQYPRQRLQLLLRHISRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Chlorocebus sabaeus V923 trav AQIB01128644.1 2881 VNSQQGEEDPQTLSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLTLIRSNERQKNSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Chlorocebus sabaeus V1019 igkv AQIB01144282.1 129504 AKCDIQLTQSPTFLSASVGDRATIACRASQSINKGLAWYQQKPGKVPKLLISYASDLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Chlorocebus sabaeus V1020 igkv AQIB01144282.1 80754 TTGQVILTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYYSGY
Chlorocebus sabaeus V1021 igkv AQIB01144282.1 71957 ARAETILTQSLAFVSATPGDKVTISCKASQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPRFSGGRYGVDFTLTINNVESEDAAYYFCQQHDNFP
Chlorocebus sabaeus V1022 igkv AQIB01144284.1 12012 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPTLLISWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQHYSSP
Chlorocebus sabaeus V1030 ighv AQIB01145361.1 3619 VQCEVQLVESGGGLVQPGRFLRLSCAASGFTFSNCYMHWAHQAQGRGLEWVSLMRKKANSYATEYAVSVKDRFTISRDDSKNTLYLQMNSLKTEDTAVYYCA
Chlorocebus sabaeus V1031 ighv AQIB01145362.1 1875 VQCEVQLVESGGGLVQPGRFLRLSCAASGFTFSNCYMHWAHQAQGRGLEWVSLMRKKANSYATEYAVSVKDRFTISRDDSKNTLYLQMNSLKTEDTAVYYCA
Chlorocebus sabaeus V1039 iglv AQIB01146043.1 2292 VDSETVVTQEPSLSVSSGGTVTITCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDGFSGSILGNKAALTIMGAQADDESDYYCTLYMGSGI
Chlorocebus sabaeus V1080 trav AQIB01152720.1 278416 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Chlorocebus sabaeus V1083 ighv AQIB01153518.1 6013 VLSQVQLQESGPGLLKPSETLSLTCAVSGGSISDSYRWSWIRQPPGKGLEWIGNIYGNSASTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Chlorocebus sabaeus V1096 ighv AQIB01158235.1 1374 VQCEVQLVESGGGLVQPGGSLRLSCVASGFTFSDHYMHWVRQALGKGLEWVSRISSGSGSSTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Chlorocebus sabaeus V1097 igkv AQIB01159121.1 2106 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSDGNTYLSWFQQKPGQPPRLLIYQVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCVQGTKVP
Chlorocebus sabaeus V1119 trbv AQIB01162337.1 61420 VRSQTVHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVGQISSEVPQNLSASRPQDGQFILSSKKLLLSDSGFYLCAWS