WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Equus przewalskii ATBW00000000.1 (ATBW01) 232 12 23 18 86 53 19 21
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Equus przewalskii V44 trav ATBW01008918.1 13687 AHTQVVQVNDSMYGFIGTDVVLHCSFANLLPGVKITQVTWQKATNGSKQNVALYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Equus przewalskii V242 trgv ATBW01052574.1 10892 IQLSSNLEGTQMSVTRQAGSSVVITCDIKESSDYVHWYRYQNRMAPQRLLYYQFSSSNDVLDSEISSRKYHAYEGTGRTSKLLIKILEESDSGVYYCAAWE
Equus przewalskii V243 trgv ATBW01052574.1 26893 GLGLSDVEQSQISISTEVKKSINIHCKITSSDFEGDYIHWYRQKPKKALEHLISVSSTKSPARASLGGRKNKLEARKYSQTSTSVLTVNFIENEDVAIYYCAGW
Equus przewalskii V245 trgv ATBW01052574.1 93370 GLGLTKVEQSQISITKAVKKSVNIYCKITSSDFEGEYIHWYRQKPNKALEHLIYVRFTGSPALANLGGKKNKLEARKDSQTSTSMLTIHAIENEDVAIYYCAGW
Equus przewalskii V246 trgv ATBW01052575.1 70268 TWISSNVEGTQMSITKQAGSSVVFTCDIKQRITYVHWYRHKEGIAPQRIVYYHHQDSRLVSDPGIRLERYRVYESTERNRKIEIRKLEQSDSGVYYCAIWE
Equus przewalskii V247 trgv ATBW01052577.1 15834 TQVSSNLEGKQMSLTRQAGLSAVITCDIEHTSNYIHWYQYQEGMAPRRLLYYQVFSSNVVVESRITSGKYHAYGGTGRTCKFSLENLEESDSGVYYCAVWE
Equus przewalskii V255 trbv ATBW01054037.1 14584 HTSAGVTQFPSHRVVEKKQSVTLRCDPVPGHQALFWYQRAVGKEITFLIYFLRENKQDESGMSNKRFSAERTNGTFSTLKIQPAELEDSGVYFCASSQ
Equus przewalskii V256 trbv ATBW01054037.1 21242 ALDAEVTQTPGHLVEGKEQKVKMYCVPKKGHSYVFWYQQNLAKKFKFLISFQYENIFGETEMPKERFSAECPPNSPCSLEIPPTELQDSAVYLCANSE
Equus przewalskii V257 trbv ATBW01054037.1 28012 PIDSGVTQEPRHQVTKMGQDVTLRCEPISSHTDLFWYRQTSVQGLEFLIYFSNQAVIDQTGMPKDRFSAEMPNRSFSTLKIQHTEPRDSAVYLCASSL
Equus przewalskii V258 trbv ATBW01054037.1 44107 PVDSGVTQTPKHLIKAKGQQMTLRCSPISTHLSVYWYQQALGQGPQFLIQYYDGEEREKGNISGRFSGQQFRDRSSELNVSILELTDSALYLCASSL
Equus przewalskii V259 trbv ATBW01054037.1 49082 AVNAGVIQTPKFQVLKTGQNTTLRCTQDMNHDSTYWYRQDLGHGLRLIHYSVGAGVTANRDVPDGYRVSRSNTENFPLILVSATPSQTSVYFCASS
Equus przewalskii V260 trbv ATBW01054038.1 17757 HTDAGVSQSPRHRVTERGQDVAFKCDPISGHTHLYWYRQTRGQGLEFLMYFQDDFASDTSGMLKDWFSAERPEGSSSTLKIQHAEQGDSAVYLCQQL
Equus przewalskii V261 trbv ATBW01054038.1 24086 PADAGVIQFPKHLIKGMGGNAVLKCYPSSGHSSVCWFQQALGQGPQFLIKYYEKEQGEKRNIPDRFSAQQFSDYSSELDVSSLELEESALYLCASSS
Equus przewalskii V262 trbv ATBW01054038.1 33242 LTEGGVTQSPRHMITGKGQAVALWCDPISGHRALYWYQQTLGQGLGLLISFEDEAVADDSQLPKHRFSAERSKGGDSPLQIKPAELGDSAMYFCASSLAS
Equus przewalskii V263 trbv ATBW01054038.1 41669 HMGAMVTQNPRYQITRKGNPVNLSCSQNLNHDTMYWYQQKPSQAPKLLFYYYDKEFNNETDTSNNFQSSRPNTSFCSLSIRSPGVGDSAVYLCASR
Equus przewalskii V264 trbv ATBW01054038.1 46160 VLDAAVTQTPGQLIKGKEQKVKMYCVPKKGHPFIFWYQQNLAKEFKFLISFQNENILDETEMPKERFSAECPPNSPCSLEIPPTELQDSAVYLCASGE
Equus przewalskii V265 trbv ATBW01054038.1 58980 TMDGGITQSPKSLFREEGRDVTLECEQNLDYSAKYWYRQDLGQGLRLIYYSHIVNAVQKGDVTEGHRASQEKKAFFPLTVTSTQKNQTALYLCASSR
Equus przewalskii V266 trbv ATBW01054038.1 64986 GLGLGALVSQHPSKAICMNGTSVKIECRAMDFQARTMFWYRQLPKQGLTLMVASNDNSSITYEQGFTRAKFPINHLNRTFSTLTVMSVHPADSGLYFCSAS
Equus przewalskii V267 trbv ATBW01054039.1 12096 SMDTKVTQRPGHLVKGKEQKAKMDCFPIKTHIHVYWYRRKLEGEFEFLVYVRNGEITDKIEGFDQQFSVERSQDECYSLEIKSTEPGDSALYFCASSE
Equus przewalskii V268 trbv ATBW01054040.1 16096 SMDTKVTQRPGHLVKGKEQKAKMTCVPIKAHIHVYWYRRKLEGEFEFLVYLQNNDVIDKIEGFDQQFSAQCPKNASCSLEIKSTEPGDSALYFCASSE
Equus przewalskii V270 trbv ATBW01054041.1 290 SMDTKVTQRPGHLVKGKEQKAKMDCVPIKTHSYVYWYRQKLEGEFDFLVYLGDGKITDKIEGFDQQFSAQCPQDASCSLEIKSTEPGDSALYFCASSE
Equus przewalskii V271 trbv ATBW01054041.1 15834 TMDGRITQSPKYLIREERRDVSLECEQNLDYNAMYWYRQDPGQGLRLIHYSLFVKGVQKGDISEGYSASREKKASFPLTVKSTQKNQTALYLCAYSR
Equus przewalskii V272 trbv ATBW01054041.1 20579 SGLGALVSQHPSRAICKKGSSVEMECRTVGLQADTVFWYRQLPKQGLTLIATSIQGSGPKYEQGFSEAKFPISHPNLKVSTFMVTSAHPADSSLYLCGAS
Equus przewalskii V273 trbv ATBW01054041.1 32520 SGLGALVSQQPSRAVCKNGSSVKIDCRPVDFQAQIVCWYRQLPNQGLTLIAISNQGSDPTYEQDFPKVKFPISHPDRTISTLTIMSAHPADSSLYFCGAS
Equus przewalskii V274 trbv ATBW01054041.1 45198 GSGLGVLVSQHPSRAICKNGSSVEMECRTVDLQAQTVCWYQQLPNQGITLIATSNQGSDPTYEQGFPKVKFPISHPNLTFSTLTILSLHPANSGLYFCGAS
Equus przewalskii V275 trbv ATBW01054041.1 58266 GLGLGALVFQHPSRAICKNGTSVKIECHPQGLQLPTVFWYRQLPKQGLTLIATSNKGSKATYEEGFDEAKFPINYHNETFSTLTVTSAHPADSSLYFCSAS
Equus przewalskii V276 trbv ATBW01054041.1 69849 SMDTKVTQSPGHLVKGKEQKAKMDCVPIKTHSYVYWYRQKLEGEFDFLVYLGDGKITDKIEGFDQQFSAQCPQDASCSLEIKSTEPGDSALYFCASSE
Equus przewalskii V277 trbv ATBW01054041.1 75382 DANITQTPGHLVKSKGQKARMDCMPQKGHTSVYWYQQIQKKEFKFLIYLEDGQVLDQIELVKERFSPQCPKNLTCSLEIKSSEPGDLALYFCASSR
Equus przewalskii V284 trbv ATBW01055337.1 4684 FMDTNVTQTPRYLVKRIREKVVMECSQNMDHETMLWYRQDPALGLQLLHFSIGIDDKQEGDAPEGYSVSRKKENFTLILESASTNQTSVYLCASSL
Equus przewalskii V285 trbv ATBW01055337.1 11715 FMDATVTQTERYLVKRRGDKVVMDCQQNMDHNSMFWYRQDPALGLQLLHFSYRIDDEQKGDAPEGYSVSRKKKENFTLILEPASTNQTSVYLCASSL
Equus przewalskii V286 trbv ATBW01055337.1 17816 SVFGALLSQKPSRAICQRGTTMKIQCEVDTELTLMFWYSQLPGQSLTLIATANQGSEATYESGFTKDKFPISRPTLRFSTLTVNNTSPEDSSFYFCSAG
Equus przewalskii V310 igkv ATBW01060140.1 23152 SSGDIVMTQTPLCLAVTLGEPVSISCRSSQSLLRSDDYTYLDWYLQKPGQSPRLLIYEVSKLVSGVSDRFSGSGSGTDFTLQISRVEAEDVGVYYCMQG
Equus przewalskii V338 iglv ATBW01064741.1 17839 ADSQAVVIQDPSFSVSLGGTVILTCGLSTGSVSTSNYPRWYQQTPGKAPRTLTYSTNNRPSGIPERFSGSISGNKAALTITGAQPEDEADYYCDLYVDRGV
Equus przewalskii V351 trav ATBW01067403.1 31181 GLRAQSVTQPDDLVTITEGNPLTVKCTYSISGSPYLFWYVQYPNQGLQFLLRYISGDNLVKGSYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Equus przewalskii V352 trav ATBW01067404.1 4990 TLSLAKTTQPIFSDSYEGQEVNITCNHTDIATNEYILWYRQFPNQGPQFVIQGFNTKVENEVASLFIPDDRKSSTLSLPQATLRDTAVYYCIVS
Equus przewalskii V353 trav ATBW01067404.1 18025 GTGAQSVTQPDVHVTVSEGAPLELRCNYSSSVSLYLFWYVRYPNQGLQLLLKYTSGNSLVPGIKGFKAEFRKNETSFHLKKPSAHWSDSAEYFCAVS
Equus przewalskii V354 trav ATBW01067404.1 28662 GSNEEMVTQTDGLVTFPKGPLLTLNCTYQTSDSVFLLWCVQYYNKAPKLLLNYSFLSSTENQWTEHQGFQANHVKSDGSFYLQKPSVQMSDSTVYYCDLR
Equus przewalskii V355 trav ATBW01067404.1 34910 DARAQSVTQPDGHVLVSEGSSLDLRCSYSYGTTPYLFWYVQYPRQGLQLLLKHLSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCALS
Equus przewalskii V356 trav ATBW01067551.1 8859 VRSQEVEQSPQSLIIQEGENVTINCSFSKTLYALHWYWQKHGEGPIFLMMLMKDGDEKSHDRIAAILNEKNQQSSLFITASQCSHSGTYFCGVE
Equus przewalskii V357 trav ATBW01067552.1 16972 IMSDSKTTQPNAMECAEEEPVHLPCNHSTISGNEYIYWYRQIPHQGPVYMIHGIKNNVTNGMLSLTMTADRKSSTLILPQVTLRDAAVYYCIVRK
Equus przewalskii V358 trdv ATBW01067552.1 54257 SSNTQSVYQAANVMSAQVGESVTLDCKITVSYTYYNMYWYRQLSSGEMTHIIRLYSANRNSREGRYSVVFQKPTLTLTISALTPGDSAVYFCAV
Equus przewalskii V359 trav ATBW01067552.1 69723 GVQGVKVEQSPSALNLHEGTSSTLRCNFSTTVYSVQWFRQNPGNGRISPFFMTSGMKQNRRLSSTMNSKEVCSTLHFTDSQVEDSATYLCAVE
Equus przewalskii V360 trav ATBW01067552.1 79544 SSIAQKVTQVQPAMLVQEKEAVTLNCRYDTSDTIYSLFWYKQSSSGAMMFLIRQDSYNQQIATEGRYSLNFQKANKSINLAISASQLQDSAVYFCALRE
Equus przewalskii V361 trav ATBW01067552.1 85377 QAHGDSVTQMEGQVILSEGASLNMTCTYSATGYPTLFWYIRYPGEGPQLLLSAKKDNEMGRNKGFEATYNKEAASFHLVKASVLESDSARYYCALS
Equus przewalskii V362 trav ATBW01067552.1 94172 VRSQQKGVEQSPGSLSVPGGDVASLNCTYSDSASQTFMWYRQYSGKGPELLMYTYSSGDEDKGRFTAHLNKAGQYVSLLIRDSQPSDSATYLCAV
Equus przewalskii V374 iglv ATBW01070037.1 19859 SLASSELTQPLGVSVALAQTATITCQGESIESYNANWYQQKPGQAPVLLIYANSEWPSGIPERFSGSSSEGSATLTISGALAEDEADYHCQVFDFSGNE
Equus przewalskii V375 iglv ATBW01070038.1 10187 GCAVSSELTQPPSVSVAPGQTAMITCGGNNIGGKYSYWYQLKPGQAPVLVIYSDGKRPSEISSRFSGSNSGNMSALIIGGARTEDEADYYCAVADGSGSS
Equus przewalskii V376 iglv ATBW01070038.1 59681 SVTTYDLTQPHSTSVALGQTATITCSGDNLEDEYAYWYQQKTGQSPALVIYKDSEHPSGIPDRFSGSNSGNTATLTIRGAKTEDKADYYCQSWSSAN
Equus przewalskii V377 iglv ATBW01070038.1 75101 SVASSMLTQPLTLSVAFGSTVTITCQGELLDSYYAEWYQQKPDQAPVLVIYYGSKRPSGISTRFSGSYSSKMATLTLSGALAEDEADYYCQVWDSSGNQ
Equus przewalskii V380 trav ATBW01070569.1 9053 KSDQQQVKQSPQSLIIQEGEISILNCTYENSAFDYFPWYRQYPGEGPAFLIAIHSIVSTKEDGRCTVSFNKSTKQFSLTITASQPGDSATYFCAAS
Equus przewalskii V381 trdv ATBW01070569.1 15958 STVAQTVTQGQTATSKQEGTTVTLDCRYETGWSRYSLFWYKQLPNGEMIFLIRQDSSSRDAKNGRYSTNFWKAAQFITLTISTLQLEDSAKYFCALC
Equus przewalskii V382 trav ATBW01070570.1 32381 GLRAQSVTQPKDQITVAEGNPLTVKCTYSFSGSPYLFWYVQYPNQGLQFLLKYITGDSLVKGSYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Equus przewalskii V383 trav ATBW01070570.1 40316 TLSLAKTTQPIFIDSYEGQEVNITCNHTNIATNEYILWYRQFPNQGPQFVIQAFKETVKNEVAILFIPHDRKSSTLSLPLATLRDTAVYYCIVN
Equus przewalskii V384 trav ATBW01070570.1 48040 GTGAQSVTQPDVHITVSEGAPLELRCNYSSSVSLYLFWYVQYPNQGLQLLLKYTSGNSLVPGIKGFKAEFRKNETSFHLKKPSAHWSDSAEYFCAVS
Equus przewalskii V385 trav ATBW01070570.1 63691 DARAQSVTQPDGHVLVSEGARLELKCIYSYDRAPALFWYVQYPSQGLQLLLKYFSGDTLVKGIKEFEAEFRKNESSFNLRKSAAHWSDSAVYFCVLS
Equus przewalskii V386 trav ATBW01070570.1 79270 DARAQSVTQPDGHVLVSEAASLELRCTYSYGATPYLFWYIQYPNQGLQLLLRYFSGDTLVEGIKGFKAELKKNESSFNLRKSSAHWSDSAEYFCAVS
Equus przewalskii V391 trdv ATBW01071395.1 21303 VSVDIILEPVTKTLIVLAGETATFRCNITGGDLKNYRMSWYKKNEDNSLTLVYGPRNNSNDDLRKSFKGEINILKNQYILDIQKATTKDVGTYYCGSD
Equus przewalskii V394 trgv ATBW01071849.1 22700 TQVSSNMEGIQIVFTRQAGSSVLITCDLKQSSDYIHWYRFQEGMAPRRLLYYHLSSSKVVVESGISSQKYQAYQGTGRTCNLYIQSLEESDSALYYCASWE
Equus przewalskii V395 trgv ATBW01071849.1 26445 TQVSSNMEGTQMSLTRQAGSSAEITCGIQQTSDYIHWYQHQEGTAPQRLLYYQLSSSKVVAASGITSRKYHVSRGTGMTCKLSIKNLEESDSAVYYCAAWE
Equus przewalskii V396 trgv ATBW01071849.1 78374 GLGLTKVEQSQISISAEVKKSIDIYCKITSSDFEGEYIHWYWQKPNEALEYVITVSSTKSPARANLGGKKNKLEARKDSQTSTAILTVNFIEKEDVAIYYCAGW
Equus przewalskii V402 trgv ATBW01075171.1 12041 TQISPNLEGTQMSVIRQAGSSVAITCDIKQSSDYIHWYRFQKRMAPRHLLYYQFSSSKFVESGTSSQKYHAYEGPGRTCKLYIRFLEESDSGVYYCAVWE
Equus przewalskii V403 trgv ATBW01075171.1 14036 NQAAVSLEQPPSVTARLGSSAILPCVASTTVSYIHWYRHQEGKAPERLLLLAMFQSDVQWDSVVKADKVTAMEAKDGTSCTLSILKLEKSNEGVYYCAAWD
Equus przewalskii V404 trgv ATBW01075171.1 33996 GLGLTKVEQSQISISAEVKKSIDIHCKITSSNFEGEYIHWYRRKTYEALEHLIYVSSTKSPAQANLGGKKNKIEARKDSQTSTAILTVNFIENEDVAIYYCAGWY
Equus przewalskii V405 trgv ATBW01075171.1 53844 TSEDILITQLITSITKKKGNTAFLECKVKRDDLKKNAHIHWYRQKPGQPLRRILYISSNENVVHERGVSEDRYEARRRQGDPSASLRIHHVEEADAGLYYCACW
Equus przewalskii V415 trbv ATBW01077012.1 23718 PLDTAVSQTPKYLISQVGNKKTLNCEQTLGHNAMYWYKQDSKKLLKIMFIYYNKERDLNETVPSRFSPEAPDKAHLNLHVSSLEPGDSAVYFCASSQ
Equus przewalskii V416 trbv ATBW01077012.1 43809 PVDSGVTQTPRHLIKARGQQVTMRCSPISGHKSVFWYQQPLGQGPQFLVQYYNEKENEKADTANRFLGKQFSNYSSELNVSFLELTDSALYLCASSV
Equus przewalskii V417 trbv ATBW01077012.1 52591 AVNAGVTQTPKFHILETGQNTTLICAQDMNHDYMYWYRQDLGHGLRLIHYSRTSGVTEARDIPDGYRVSRSNTENFLLTLVSPTPSKTSVYFCASSY
Equus przewalskii V419 trav ATBW01077180.1 3468 GTRAQSVTQPDVHITVSEGAPLELKCRYSSSLPSSLFWYVQYPNQGLQLLLKYTSGNSLVSGIKSFEAEFKKSDTSFHLRKPSAHWSDSAEYFCVLV
Equus przewalskii V420 trav ATBW01077180.1 23486 GTNGDSVTQTEGPVILPEGAPLTLNCTYQSSYSFSLFWYVQYQNKEPQLLLKSSSENQGADSRGFQATLNRSDSSFHLQKASVQMSDSAVYYCALR
Equus przewalskii V421 trav ATBW01077180.1 36249 GTKGDSVNQTEGPVTLSEGAPVILNCTYQTTYSASFLFWYVQYLNKSPQLLLKSSTGNQRTEPQGFQANHVKSDSSFHLRKPSVQMSDSAVYYCAVR
Equus przewalskii V422 trav ATBW01077180.1 48792 LSGDEVEQSPQTLRRQEGDSLSLNCSYTVSYFRGLQWYRQDPGKGPELLFLLSSAEREKEKERLRATLSKNGSSLHITAPKPEDSATYLCAVE
Equus przewalskii V423 trav ATBW01077180.1 60195 VSSKQQVEQSPEALSVREGDSLALNCSYTDSAILFLQWFRQDPGKGLTSLLLIQSNRREQISGRMKVSLDKSSRHSALYIAASQPGNSATYLCAV
Equus przewalskii V424 trav ATBW01077180.1 62975 GTGDQSVTHPDVHITVSEGAPLEVRCNCSSFVLPDLFWYVQYPNQGLHLLLKYTSRNSVVSEIQNFEAEFKKSDTSFHLRKSSTHWSDSTKYFCAPS
Equus przewalskii V425 trav ATBW01077180.1 68694 VRGAQVEQSPPALSLQEGASSTLRCNFSISVKNVQWFRQHPGGRLIDLFYIPSGEKQSGRLNAMTVMKERRSSLYISSSQTTNSAIYFCAVKPQC
Equus przewalskii V429 trgv ATBW01078025.1 26109 TQVSSNLEGTQMSVTRQPGSSVVITCDIKQSSDYVHWYRYQEGMAPQRLLYYQLSSSKVVVDSAFSSWKYHASKDTGGTYKLLIKFLDESDSAVYYCAVWE
Equus przewalskii V430 trgv ATBW01078025.1 40528 TQVSSNLEGTQMSVTRQAGSSAVITCDIKQSNNYVHWYRYQEGTAPQRLLYYQLSSSKFVMDSGFSSQKYHAYAGTGKTCELLIKILEESDSGVYYCAVWE
Equus przewalskii V431 ighv ATBW01078070.1 3526 VQCEVQLVESGGGLVKPGGVSETLLCSLWIHLQQLWHELGPPGSREGVAGINSDGGGTHYADSVKGRFPISRDNAKNTLCLQMNSLRDEDTALYYCAG
Equus przewalskii V432 ighv ATBW01078070.1 22585 VLSQVQLKESGPGLVKPSQTLSLTCPVSRFPLTNHHVHWTHQAPGKGLEWLGDSRSGESTYYNLTLKSQLSIPSDTSKSQIYLTLNRLRGDDMAMYYCAR
Equus przewalskii V433 ighv ATBW01078070.1 30294 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFDDYALHWVRQAPGKGLEWVSFISWSGGSTHYADSVKGRFTISRDNAKNTLYLQMNSLRDEDTAVYYCAK
Equus przewalskii V434 ighv ATBW01078070.1 48759 VSSEVQLVQSGAEVKKPGASVKVSCKASGDSFTYYSMSWVRQAPGQGLEWTGYIYPEYDAMGYPQKFQGRVTMTADKSTSTVYMELSSLASEDTAVYYCAT
Equus przewalskii V435 trgv ATBW01078713.1 5072 TWISSNVEGTQMSITKQAGSSVVFTCDIKQRITYVHWYQHKEGIAPQRIVYYHHQDSRLVSDPGIRLERYRVYESTERNRKIEIRKLEQSDSGVYYCAIWE
Equus przewalskii V436 igkv ATBW01079270.1 29481 ACGDIVMTQSPDSLSVSAGQRVDMKCRASQSASNELSWYQQKPGQAPKLLIYAASNRASVVPDRFSGGGSGTDFTLTISSLQAEDVAVYYCLQHYNNP
Equus przewalskii V437 igkv ATBW01079272.1 9612 ACGDVVMTQSPDSLAASLGQRVEMKCKASQSVSSYLAWYQHKPGQAAKQLIYSASSRASGVPDRFSGSGFGSGTDFTLTISSLQAEYLAVYYCMQYNSAP
Equus przewalskii V439 trav ATBW01079506.1 3959 TVGQDVHQPSELTGMEGAFVQVNCTYQTSGFNGLSWYQQHDGGAPIFLSYNVLDGWERKGHFSSFLSRSDTYSYLFVKELRVEDSASYLCAVS
Equus przewalskii V443 trav ATBW01080560.1 890 QSVTQPDDHITVSEGAPLELKCNFSYSTSLYFFWYVQCPSQGLQLLLKYITGDNRMVKGIKGFEAEFKKSETSFHLRKQSAHLGDSGKPSTYLNDSAEYFCALG
Equus przewalskii V444 trdv ATBW01080560.1 47351 FSNTQSVDQPKREEYKREGESVTLDCTIVVSYTYYIMYWYRQASSGEMTHIINLDSNKKDSRQGRYSVVFQKPNLKLTISALTLRDSAVYFCAVEQA
Equus przewalskii V446 trdv ATBW01080710.1 9099 SSNTQSVNQPINVVYTQEGESVTFDCKITVSFSVYVVYWYQQLSSGEMTHLIHLRSDNKNTAEGRYSMVFQKSDVKFTISNLMHRDSGVYFCAVAEC
Equus przewalskii V449 iglv ATBW01081306.1 16676 SWAQSALTQPASVSGALGQSVTITCAGSSSDIGGYNAVSWLQQHPGTAPKVLIYSVNTRASGIPDRFSGSKSGNTASLTISGLQVEDEADYYCYSLVSG
Equus przewalskii V451 iglv ATBW01081534.1 26505 PVVSSEVTQPTAVSVALGQTASITCQGSDFENYYASWYQQKPGQAPVLVINANNERPSGIPERFSGSSSGETATLTISGAHAEDEADYYCLATDAYAAE
Equus przewalskii V454 trgv ATBW01081820.1 12324 TQESSNLEGTQISVTRQAGSSVAITCDILKRSDNYVHWYRYQEGMAPQRLLYYDFSSSKAVWDSGISSGKYHAYEAIGRTCKFLIENLEESDSGVYYCAVWE
Equus przewalskii V455 iglv ATBW01082685.1 25612 ADSQSVVTQEPSLSVSSGGTVTLTCGLNSGSVSSSNHPSWHQQTPGQAPRTLIYYTNTRASGVPNRFSGSISGNRTTLTITGAQREDEADYYCALYTGS
Equus przewalskii V460 trdv ATBW01083477.1 12974 STVAQTVTQSQTATSKQEGATVTLDCWYQTSWSTYYIFWYKQLPNGEMIFLIRQGSSSQNAKNGRYSINLEEAAKFITLTISSLQLEDSAKYFCALV
Equus przewalskii V461 trdv ATBW01083477.1 13978 STVAQIVTQGQTATSMQEGTTATLDCLYETSWSTYYIFWYKQLPNGEIVFLINQHSASQNAKNGRYSTNLQKAAKFITLTISALRLEDSAKYFCALY
Equus przewalskii V462 igkv ATBW01083498.1 8734 SSGDIVMTQTPLSLPVVPGELASNSCRFSQSLLHSNGNTYLHWFLQKPGQSPRRLTYRVSNRNSGVPDRFIGSGSGTDFTLKISKVEAEDGGVYYCSQG
Equus przewalskii V469 ighv ATBW01085741.1 6665 VLSQVQLQESGPGLVKPSQTLSLTCSVSEVSITSSGDWWSWIRQPPGKGLEWMGYISYSGSAYYTTSLKSRLSISRDTSKDQFSLQLSSVTAEDTAVYYCAR
Equus przewalskii V474 trdv ATBW01086732.1 5467 SSICQKVTQSQPAMSVQEMEAVTLNCTYDTSSGTYSLFWYKQPSSGAMIFLIRQDSYQQNATEGRYSLNFQKAKKSINLVISAAQLEDSAVYFCALIE
Equus przewalskii V475 trav ATBW01086732.1 16394 QTHGESVTQMEGQVTLSEGASLTVNCTYSATGYPILYWYVQYPGEGPQLLLRATKANEKGKNKGFEATYKTETTSFHLEKASVQESDSAMYYCAVS
Equus przewalskii V476 iglv ATBW01086872.1 397 SWAQSALTQPASVSGTLGQSVTISCAGSSSNIGSYNYVSWYQQHPGTAPKLLIYSASSRASGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYINADP
Equus przewalskii V481 trav ATBW01089891.1 2209 DARAQSVTQPDGHVLVSEAASLELRCNYSYGAAVYLFWYVQYPRQGLQLLLKHFSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCAVS
Equus przewalskii V483 ighv ATBW01090433.1 3760 VLSQVQLKESGPGLVKPSQTLSLTCTVSGFSLSSYAVYWVRQAPGKGLEFVGAIYGSANYNPALKSRASITKDTSKSQVYLTLNSLTSEDTAVYYCAG
Equus przewalskii V486 trbv ATBW01091859.1 787 PVEAGVTETPRYLIKTTGQAVTLRCSTISKHSGVSWYQQALSQDPHLLFEFYENVQRAKGEIPNRFSAQQLRDYRSELNVSVLELMDSALYLCASSV
Equus przewalskii V487 trav ATBW01092289.1 1913 VGAQMKVEQSPGVLILQEGSNASLTCNCSNTMSRVQWFQQNPGGPLIALFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYLCAV
Equus przewalskii V492 trav ATBW01096024.1 681 VRGAQVEQSPPVLSLQEGASSMLRCNFSISVSNLQWFRQNPGGRLISLFYVPSGTQQNGRLNTTKVAKERHSSLHISSSQTTDSGIYFCAVEPQCSP
Equus przewalskii V493 trav ATBW01096939.1 992 GTGAQSVTQPDVHVTVSEGAPLKLRCNYSTSLPPYLFWYVRYPNQGLQLLLKYKSENNLVSGIKGFEAELNRSDTSFHLRKPSAHWSDSAKYFCALS
Equus przewalskii V496 iglv ATBW01100271.1 221 VDSQMVVTQEPSLSLSSGGMVTLTCGLSSGSVSSGYDPSWYQQTPGQVRCTLIYSTNSRLSGVPNHFPGSISGNKATLTTTGAQPEDEADYYCALVMGS
Equus przewalskii V499 trav ATBW01105710.1 209 AQQQVKQSPQSLIIQEGEISILNCTYVDSTFDYFPWYRQYPGEGPALLIAIRSVRNEIESGRFTVFFNKSTKQFSLTIKASQPGDSATYFCAAS
Equus przewalskii V502 trav ATBW01111185.1 413 KGAQQQVKQSPRSLIVQEGEISVLNCTYEDSAFSYFLWYRQYPREGPTLLIAIRSGSGVNTSEGRFTVSLDESAKQFSLTITASQPGDSATYFCAAS
Equus przewalskii V503 trgv ATBW01112908.1 361 TQVSSNLEGTQMPIIRQAGSSVQFTCDIKQSVTYVHWYRYQEGIALQRLVYYHYQYSRLMTDPGISSGKYHTFGGTDKNRNIEVRSLEERDSGVYYCAVWE
Equus przewalskii V506 trav ATBW01126169.1 419 FIGDAKTTQPNAMESTEEESVRLPCNHSTISGSEYIYWYRQIPHQGPEYVIYGLKSNVTNGIASFSMKTDIKFSILILPLVTLKDTTVYYCIMRE
Equus przewalskii V509 trav ATBW01133974.1 59 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSWSSTLFWYVQYPKQGLQLLLKHTSGESIKGFTANLNNDEGSFHLKKPSAQEEDSAMYYCALS
Equus przewalskii V613 igkv ATBW01018298.1 78342 ACGDVVMTQSPDSLAASLGQRVEMKCKASQSVSSYLAWYQQKPGQAPKRLIYAASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAIYYCMQHYNNP
Equus przewalskii V614 igkv ATBW01018298.1 64387 ACGDIVMTQSPDSLAASLGQRVEMKCKASQSASSSLDWYQHKPGQAPKLLIYRASSRASGVPDRFSGGGSGTDFTLTISSLQVEDVAVYYCMQSNTAP
Equus przewalskii V615 igkv ATBW01018298.1 16939 ACGDIVLTQSPESLAVSLGQRVEMKCKASQSVSSSLDWYQQKPGQAPKRLIYAASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYNSAP
Equus przewalskii V798 trdv ATBW01049025.1 91079 KDVICNEVTQSPPELTVASGNKVTLFCTYKTAYSNPDLYWYRIRPDYSFQFILYRDNARSHDADFTQGRFSVQHGKTQKTFHLVISSVRTEDSAVYYCAIL
Equus przewalskii V822 ighv ATBW01053657.1 14184 VLSQVQLKKSGPGQVKPSQTLSLTCTVTGGSITSRYYGWSWIRQTPGKGLEYIGSITYSGSTYYSPSFKSRASISRDTSKNQFSLQLSSVTTEDTAVYYCAS
Equus przewalskii V823 ighv ATBW01053658.1 114997 VLSQVQLQESGPGQTNPSQTLSLTCTVTGYSITSGYGWNWIRQPPNKGLEWMGSISYSGRTNYSPSLRSRITISRDTSKNQFLLQLSSVTTEDTAVYYCAT
Equus przewalskii V824 ighv ATBW01053658.1 99579 VLSQVQLQESGPGQVKPSQTLSLTCTVTGGSITSSYSSWSWLRQPPGKGLEYMGYIYYDGRTYYNPSFKSRTSISRDTSKNQFSLQLSSVTTEDAAVYYCAR
Equus przewalskii V825 ighv ATBW01053658.1 96400 VEAEDPLVQWGGGVVVSSQTLSLTCAAYKRKVSEYSLWWIRLLPGKGLECVGVIWAKGDTQCSPHLQSRVSISRDTTKNQVFLQLSSVMPEDSGVYYCAQ
Equus przewalskii V826 ighv ATBW01053658.1 79920 VSSEVQLIQSGPELKKPGSSVKISCKASGYTFTEYAMHWVRQANGKGIEWMGSISPHDDDTSYAPKFQGRVTITVDKSTSTVYMELSSLTSEDTAMYYCAK
Equus przewalskii V827 ighv ATBW01053658.1 9356 VSSEVQLVQSGAEVRKPGASVKVSCKASGDSFTYYSMSWVRQAPGQGLEWMGGILPIVDDTSYVQKFQGRVTMTADKSTSTVYMELSSLTSEDTAVYYCAK
Equus przewalskii V843 trbv ATBW01057732.1 64846 PVNAGVTQNPKFQVLGTGQNMTLRCAQDMNHSYMYWYRQDLRHGLRLIHYSRAANVTEKGDIPEGYRVSRPNTENFLFTVESATPSQTSVYFCASNY
Equus przewalskii V844 trbv ATBW01057732.1 7033 PVDSGVTQTPRHLVKTRGQQVTLRCSPMSGHDTISWYRQPLGQGLQFLIQYYRGEENGKGDFPGRFKGQQLDNYSSELSVSVLELVDSALYFCASSL
Equus przewalskii V845 trbv ATBW01057732.1 1742 PVNAGVTQTPRFQVLRRGENTTLRCTQDMNHNSMYWYRQDLGHGLRLIHFSVGADATANRDVPDGYRVSRSDTKNFALMLESATPSQTSVYFCASS
Equus przewalskii V846 trbv ATBW01057733.1 3622 AVDSGVTQTPRHLIKTKGQQVTLRCSPISGHPRVSWYQQALGQGPQFLFQYYMGRENGKGDIPDRFKGQQFSNYCSELTDSALYLCASSAAQPCR
Equus przewalskii V847 trbv ATBW01057734.1 89624 PLDTSVSQTPEYLISQVGNKKTLKCEQNLNHDAMYWYIQDSKKLLKIMFSYNNKQPIVNETASNRFSPEAPDKAHLHLHINSLEPGDSAVYFCASSK
Equus przewalskii V848 trbv ATBW01057734.1 81856 HMETGISQTPSHYIREMGQNISLRCEPISSHFYFYWYRQTLEKGVEFLISVYNKVPSEKADFLKDRFSAEMPDGSRFTLKIQPVQLGDSAVYLCASSL
Equus przewalskii V849 trbv ATBW01057734.1 72081 PVDSGVIQTPRHLIKAKGQQMTLRCSPISTHPYVYWYQQVLVQGPRFLIQYFDEKENDRGDSSDRFSGKQFSNYSSELKVSVLELVDSALYLCASSL
Equus przewalskii V850 trbv ATBW01057734.1 67035 AVNAGVTQTPKFHILETGQNTTLRCAQDMNHDSMYWYRQDLGHGLRLIRYSAGAGVTEKRDVPDGYRVSRSNTENFSLTLESATPSQTSVYFCASS
Equus przewalskii V851 trbv ATBW01057734.1 51569 HTDAGISQSPRHRVTERGQDAALKCDPISGHTYLYWYRQTLGQNLEFLTYFQDDLASDTSGMPNDRYSAKRPEGSSSTLKIQHAEQGDSALYLCASSS
Equus przewalskii V852 trbv ATBW01057734.1 41985 QVDAGAGITQSPHKITATGKRVTLTCHQTQKHDYMYWYRQDLGHGLKLIHYSYDILKTEEGEVPDGYNVSRSNIEDFPLTLESATPSQTSVYFCASSY
Equus przewalskii V853 trbv ATBW01057734.1 24925 PTDAGVIQTPRHQLTKMGQTVTLTCEPISTHDTVFWYRQTSVKGLEFLIYFRDQAPMDKTGMPNDRFSAEMPNGSFSTLKIQRTEPGDAAVYLCASSL
Equus przewalskii V855 trbv ATBW01057734.1 15272 GSRLDALISQHPGRGVCKNGTSMKIACFSMDFQARTMLWYHQLPKHSLTLMATSNHGSSATYQQGFTEAKFPISHPNQTFSNLMVMSVHPADSSLYFCGAS
Equus przewalskii V856 trbv ATBW01057734.1 8621 PLDTAVSQTPKYLISRVGNEKTLKCEQNLSHNAMYWYVQDSKKLLKIMFSYNNKQPIVNETASNRFSPHAPDNAHLNLHINSLEPSDSAVYFCASSQ
Equus przewalskii V864 trav ATBW01059894.1 21817 VRSQQKGVEQSLGSLRVPEGANASLNCTYSDSASQTFMWYRQYSGKGPELLMYISSNKVKDEGRFTAQHSRAGQYVSLLIRDSQPSDSATYLCAV
Equus przewalskii V865 trav ATBW01059894.1 14579 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSGSPDLFWYVQYPKQGLQLLLKHTSGESIKGFTANLNKGEKSFHLKKLSAQEEDSAMYYCALS
Equus przewalskii V866 trav ATBW01059894.1 5177 VNSQQEERNLQALSVQEGENATMNCSYQTSIENLQWYRQDAGRGLARLILIGSNEKHKTKGRLRVTLDTSSKSSSLSITASRAADAATYFCAED
Equus przewalskii V867 trav ATBW01059896.1 694 QTYGESVTQMEGQVTLSEGASLTVHCTYSAIVYPALYWYVQYPGKGPQLLLRATKANEKGSNKGFEATYNKETTSFHLEKASVQESDSAMYYCAV
Equus przewalskii V868 trdv ATBW01059897.1 13552 SSNTQSVFQPTNVMYTRVGESVTLDCKITVSYSYYYMYWYRQLSNGEMTYLIQLYSSRSSSREGRYSVAFQKPTLTLSISALTPGDSAVYFCAV
Equus przewalskii V869 trav ATBW01059897.1 1920 GVKGVNVEQSPSTLSLQEGTSSALRCNFSTTVRYVQWFLQNSGGNLISLFFVTSEMKNSGRLNATINSKELYSTLHITASQMEDSATYLCAVE
Equus przewalskii V870 trav ATBW01059898.1 33595 GVLGVNVEQSPSALSLQEGTSSTLRCNFSTTVDNVQWFRQNPGGSLINLFVIVSDTKQNGRLNGTVNSKELYSTLLITASQLEDSATYLCAV
Equus przewalskii V871 trdv ATBW01059898.1 8383 SSMAQKVTQDEATLTRQEGEDVTMNCTYEIYWRSHYNLYWYKQPASGEMVFLVYQDYYKPSGKQDRFSVDFQKEKNFISLTISPLQLVDSATYFCVLGI
Equus przewalskii V872 trav ATBW01059898.1 907 FLNPSGTVGDAKTTQPNAMECTEEETVHLPCNHSTISGNEYIYWYRQIPHQGPEYVIHGLKKNETNEMASLTMTTDRKSSTLILPQVTLRDTAVYYCMLRE
Equus przewalskii V873 trav ATBW01059899.1 9320 QTHGNSVNQMEGPVTLSEGAFLTMDCTYSTTGYSTLLWYVQYPGKGPQLLLRATKAGEKGRNDGFEALCNEESTSFHLEKASVQESDSAMYYCVLG
Equus przewalskii V874 trav ATBW01059900.1 6196 SSIAQKVTQAQPAMLVQEKEAVTLKCRYDTSDGRYSLFWYKQPSSGAMIFLIRQDSYNQQNATEGRYSLNFQKANKSINLAISASQLEDSAVYFCALME
Equus przewalskii V875 trav ATBW01059901.1 42678 VNVKQNPPAEQSPSALNLHEGTSSTLRCNFSTTVYSVQWFRQNPGGSLISLFFMTSVMRQNGRLNCTLNSKELYSTLYIMASQPEDSATYLCAVE
Equus przewalskii V876 trdv ATBW01059901.1 20776 SSNTQSVSQPVSVMYTQEGESVTLDCKITVSYAYYNMYWYRQLPNGEMTHIIQIYSGSRNSREGRYSVEFQKPTLTLSISALTPRDSALYFCAIVKL
Equus przewalskii V877 trdv ATBW01059902.1 15649 SSNTQSVSQPTNVMYTRVGESVTLDCKITVSYSYYYMYWYRQLSSGEMTHIIQLHSLNRNSRDGRYSVVFQKPTLKLTISAVIPGDSAVYFCAV
Equus przewalskii V879 trav ATBW01059947.1 48068 PRQLEQSPQFLSIQEGANFTVYCNSSSIFTTFRWYKQEPGEGPVLLTMLTKGGQMRKLERLRAEFGKERKDSSLLITAAHPGDAGIYLCAGAQCSW
Equus przewalskii V880 trdv ATBW01059947.1 4836 SSNSQSVSQPTNVMSAQVGKSVTLDCKITVSYTYYNMYWYRQLSSGEMTHLIRLYSANRNSRQGRYSVVFQKPTLKLTISALTPGDSAVYFCAV
Equus przewalskii V881 trav ATBW01059948.1 27620 TANSSQQIPPSLLLQEGENFTTYCNSSSTLNRLQWYKQRPGGSPVLLMMVVTGGDVQKQERLTARFGETRKHSSLHITAAQTADVGTYFCAGAQSSR
Equus przewalskii V882 trav ATBW01059948.1 20365 TVTDAKTIQPNSMDCAEGEDANLPCNHSTISGYDYIHWYRQNSNKSPQYIIHSLRDNVTNNIASLTIATDRRSSTLILPQVTLRDTAVYYCMLRE
Equus przewalskii V883 trav ATBW01059948.1 10373 GTRAQSVTQPDDHITVSEGNSLELRCNFSYSGTPYLFWYVQYPSQGLQLLLKDITRDTLVEGIKGFEAEFNKSETSFHLRKPSAHLGDSAVYFCAVS
Equus przewalskii V884 trav ATBW01059949.1 89827 GVRALKVEQRPSALSLQKGTSSTLRCNFSATVNRVQWFRQNPGSGLINLLFLTSVTKQNGRLNSTINTKELYSNLHITDSRLEDSATYLCAV
Equus przewalskii V885 trav ATBW01059949.1 70909 MRSQQKGVEQSPGSLRVPEGANASLNCTYSDSASQYFTWYRQYSEKGPQLLIYIYSNEGKNEGRFRAQHNKAGQYVSLLIRDSQPSDSATYLCAV
Equus przewalskii V886 trav ATBW01059949.1 59167 GARAQTVTQPEESTSVIEGAPVQVKCNYSSSGSPYLFWYVQYPNQGPQLLLKHTSGESIKGFTANLNKGEKSFHLKKLSAQEEDSAMYYCALS
Equus przewalskii V887 trav ATBW01059949.1 50550 VNSQKVEQNLQALSIREGENVTMNCSYKTTITNLQWYRQDAGRGLALLILIRSHEKLKPGGRLQVTLDSSSKSSSLSITASRAADTATYFCAVE
Equus przewalskii V888 trav ATBW01059949.1 45291 GTNGDSVTQTEDPVILPEGALLTLNCTYQSSYSVFLFWYVQYQNKEPELLLKSSSENQEEDSRGFQAKLVTSDSSFHLRKASVQVSDSAVYYCALR
Equus przewalskii V890 igkv ATBW01060142.1 758 STGDIVLTQSPASLTVSPGQSATISCRASQSVLSPPSYDLHWYQQKPGQRPKLLISSASNLGSGVPARFSGSGSGTDFTLTINPVEEADAANYYCQQGKESP
Equus przewalskii V891 igkv ATBW01060143.1 26896 ACGDIVMTQSPGSLAVSPGQRVTISCKASQSVSNYLDWYQQKPGEAPMLLIYVASSRASGVPDRFSGGGSGTDFALTISSLQAEDVAVYHCQQHYTNP
Equus przewalskii V892 igkv ATBW01060144.1 10206 STGDIVLTQSPASLTVSPGQSATISCRASQSVLSPPSYDLHWYQQKPGQRPKLLISSASNLGSGVPARFSGSGSGTDFTLTINPVEEADAANYYCQQGKESP
Equus przewalskii V911 iglv ATBW01064749.1 19768 SVISSELTQPPSVSVTLIQTVSTICQGEILKTYYANWYHQKPGQVSVLNIYKDNVRPSGISDRFTGSKSENTATLTIGGTQTEDEADYYCQSQDSSGN
Equus przewalskii V915 trav ATBW01065328.1 102955 ARAQTVTQPEDRISVIEGAPVQVKCNYSYSLSPVLFWYVQYPNQGPQLFLTHTSRKSIKGFTANLNKGEKSFHLKKLSAQKEDSAMYYCALS
Equus przewalskii V916 trav ATBW01065328.1 83674 AQQQVKQSPQSLIFQEGEISVLNCTYENSAFDYFPWYRQYPGEGPAFLIAIRSGSRVNTSEGRFTVSFNKSAKQFSLTITASQPGDSATYFCAAS
Equus przewalskii V917 trav ATBW01065328.1 60558 LNGQQIQQIPPSLLLQEGENFTMYCNSSSTLASFQWYKQRPGGSPVFLILVSGREVQKQERLAAQFGETRKDSFLHITAAQTADVGTYFCAGAQSSR
Equus przewalskii V918 trav ATBW01065328.1 54311 TVIDAKTTQPNSMDCTEGEDANLPCNHSSIGIADYIHWYRQNPSQSPQYIINGLQGNVTNNMASLTIATDRKSSTLILPRVTLRETAVYYCMLRE
Equus przewalskii V919 trav ATBW01065328.1 44270 GTGAQSVTQPDDHISVSEETSLELKCNYSSGNLYFFWYVQYPSQGLQLLLRYSSGPTLVKGIKGFEAELKKNETSFHLRKSSAHLGDSAVYFCAAS
Equus przewalskii V920 trdv ATBW01065328.1 27013 SSMAQKVTQAQTVITGKESEAVTMDCKYETSWSRHHLHWYKQPPSGEMIFLIYQDTDKPSAKQGRFSVNLQKTKKIISLTISSLQLADSATYFCALED
Equus przewalskii V921 trdv ATBW01065330.1 8104 SSNTQSVDQPKKEEHKREGESVTLDCRITVSYAYYVMYWYRQASSGEMPHIIYLLSDSRNSRRGRYSVVFQRPNLKLTISALTLTDSAVYFCAV
Equus przewalskii V923 trbv ATBW01066449.1 113734 HTVESAGVTQFPNHRVIEKKQAVTLRCDPISGHEALYWYRRAVGKEIKFLVYFLGEDKQDDSGMPNKQFSAERIGGTFSTLNIQHAELEDSGVYFCASSQ
Equus przewalskii V924 trbv ATBW01066449.1 111833 HMGAMVTQEPRYQVTRKGKTVTLGCSQNLSHEYMYWYQQKPSQPPKLLFYYYDKDFNNETDTSDNFQSSRPNTSFCSLSIRSPGMGDSAVYLCASKR
Equus przewalskii V925 trbv ATBW01066449.1 73723 PVDSGVIQTPRHVVKAKRQQVMLKCSPISEHDTVSWYQQALGQGPKFLIQYYNGEVREKGDIPDRFSGQQFGNRSSELNLTILELTDSALYLCASSL
Equus przewalskii V926 trbv ATBW01066449.1 68996 PVNAGVTQTPRFQILGTGQNTTLRCAQDMNHNSMYWYRQDLGHGLRLIRYSAGAGVTEEDGPDGYRVSRSDTKNFSLTLVSATPSQTSVYFCASSY
Equus przewalskii V927 trbv ATBW01066449.1 50544 STDAGVTQEPRHYVTKMRQAVTLTCEPVSNHTALFWYRQTSVKGLKFLIYLRNQAPIAQTGMPKDRFSAEMPNRSLSTLKIQRTEPGDSAMYICASSL
Equus przewalskii V928 trbv ATBW01066449.1 44963 PVDSGVTQTPRHLIKARGQQVTLRCSPISGHNRVFWYQQPLGQGPQFLFYYYNGKENEKGDVPARFSGQQFSDYRSELNVSVLELKDSALYLCASSS
Equus przewalskii V929 trbv ATBW01066449.1 28789 HTDTGVSQSPRHRVTKYGEDVAFRCDPISEHTRLYWYRQTPGQNMEFLTYFQNDFASDTSGMPSDRFSAERPKGSYSTLKIQRAEQRDSAVYLCASSL
Equus przewalskii V930 trbv ATBW01066449.1 12327 HTVESAGVTQFPNYRVIEKKQAVTLRCDPISGHASLYWYRRAVGKEIKFLVYFLRKDKQDDSGMPNERFSAERTEGTFSTLKVQHSELEDSGVYFCASSQ
Equus przewalskii V940 igkv ATBW01070986.1 1809 TRAEITVTQSPESMLVIPGDKVIITCKASQDIGDDVNWYQRKPGEAPKLIIKEATTLWSGVPSRFSGTVHGVDFTLTIDDVKSEDAAYYFCLQHDRIP
Equus przewalskii V941 igkv ATBW01070987.1 66804 STGDTVLTQTPLSLSVIPGESASISCKSSQSLLHGNGNTYLHWYLQKPGQSLQRLISMVSNRASGVPDRFSGSGSGTDFTLIISKLEAEDVGVYYCMQA
Equus przewalskii V942 igkv ATBW01070987.1 43370 RMLCDVVMTQTPLSLSVVPGEPASISCKSSQSLKYSDGKTYLYWFLQKPGQSPKLLIYLVSTRYSGVSDRFSGSASEADFTLKISRVEPEDVGVYYCFQALYAS
Equus przewalskii V943 igkv ATBW01070987.1 19733 SSGDVVMTQTPLSLSVVPGEPASISCKSSQSLKHSDGKTYLYWFLQKPGQSPKCLIYLVSTRVSGVSDRFSGSGSETDFTLKISRGEPEDVGVYYCVQALYAS
Equus przewalskii V955 trdv ATBW01073666.1 14958 SSMAQKVTQTQTIMTRKEGESVTMDCKYELGWSNYYYALYWYKQLPSGEMVFLIYQDSSKPSAKQGHFSVNFQSSKNFISLTISPLKLADSATYFCALWD
Equus przewalskii V956 trav ATBW01073666.1 5227 IIGDAKTTQPNAMDCTEEETVHLPCNHSTISGNEYIYWYRQIPHQGPEYVIYGLKSNVTNGMASLTITTDRKSSILILPQVTLRDTAVYYCIVRE
Equus przewalskii V957 trav ATBW01073667.1 34564 VNGEQMKQIPPSLLLQEGENFTTYCKSSSTLSSLQWYKQRPGGSPVFLMILAKRGEAKKQERLTAQFGETRKHSSLHITAAQTADVGTYFCAG
Equus przewalskii V958 trav ATBW01073667.1 27884 TVIDAQITQPNSVDCAEGEDVNLPCNHSTIVREEYVYWYRQNPNQSPQFIIHGLRNNVTNNMASLTIATDRKSSILILPQVTLRDTAVYYCAVRE
Equus przewalskii V959 trav ATBW01073667.1 19935 GTRAQSVTQPDDHIIVSEGAPLELKCSYSYTGTPTLFWYVQYPSQGLQLLLGYFSGPTLVKGIKGFEAELKKNETSFHLRKQSAHLGDSAVYFCALR
Equus przewalskii V960 trav ATBW01073668.1 3668 VSSMLNVEQSPQLLHVQEGESTNFTCKFPSSSFYALHWYRWEPAKSPKILLIITVNGDEREEGRASATLNTNEGYSYFYIKGAQPEDSATYLCAS
Equus przewalskii V971 iglv ATBW01077728.1 7723 SVSSSELTQSTAVSFSLGQTATITCQGETLRSHYASWYQKNPGQAPVLVIYGNNNRPSGIPARFSSSYSEDTGTLTISGVQIEDEADYYCQSLGSDY
Equus przewalskii V972 iglv ATBW01077729.1 10211 SWGQSALIQPSSVSVALGQSVTISCAGSSSDIGYYNSISWYQQHPGTTPKLLIYYTNKKHSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCCSYAGSGN
Equus przewalskii V973 trav ATBW01077776.1 47071 VSSQEVQQSPQSLNIREGEDFIINCNASKTLYAFHWYRQKHGEGLISLMVLQKSGEEIHYEKMTAKLDEKKQQSSLHITASQPSHSGIYLCGAE
Equus przewalskii V974 trav ATBW01077776.1 42221 VSGQQLNQSPQSVSVQEGEDVSMNCNSSSTLSTFLWYKQDVGEGLVLLIALYKIGEWTRNGKLAAQIARTRKDSFLNISVSEPKDAGTYFCAG
Equus przewalskii V975 trav ATBW01077776.1 26703 PGRADWIRPRETELSGTEGKTVNLLCNYGTSSRGLADLYWYRQYPNQALEYILYRGWGYSGKGDASFATERFYSKTTANSTDLYIGNLEPADTAVYYCALK
Equus przewalskii V976 trav ATBW01077776.1 8661 SSTAETVTQPQPEMSVHEAETATLNCVYDTSESNYYLFWYKQPPSGEMILIIRQEAYKQQNATNNRFSVNFQKADKSFSLRISDSQREDAAVYFCAFMR
Equus przewalskii V977 trav ATBW01077776.1 1815 SSMAQTVTQPQPEMSVHEAETATLNCMYDTSDSDYYLFWYKQPPSGEMILIIRQEAYKQQNATNNRFSVNFQKADKSYKSFSLRISDSQLEDAAMYFCAFMR
Equus przewalskii V978 igkv ATBW01077860.1 39763 SSGEIVLTQSPAFLSGTPGEKATITCRANQGISNYLHWYQQKPNQPPKPIIKYVSESISGVPARFSGSRSGTDFTLTISRPEAEDAATYYCQHSYYHL
Equus przewalskii V979 igkv ATBW01077860.1 21609 ARCEIQMTQSPASLSASLGDRVTITCQATQGINTWLAWYQQKPGKALKFLISKATILHTGVSSRFSGSGTWTDFTLTISSLEPEDAATYYCQQYNSSP
Equus przewalskii V980 igkv ATBW01077861.1 9094 SSGDVVMTQTPLSLPVVPGEPASISCKSSQSLLDSDGKTYLYWYLQKPGQSPKLLIYSVSNRDSGISDRFSGSGSGTDFTLKISRVEPEDVEVYYCVQA
Equus przewalskii V984 trav ATBW01078782.1 47770 GVRGVNVEQSPSALTLQEGTSSTLRCNFSTTVNNVQWFRQNPESGLINLFFTASGTEQKGRLNCTVNSKELYSTLHITSSQLEDSATYLCAV
Equus przewalskii V985 trav ATBW01078782.1 17142 VNSQQGEQNLQTLSIQEGENVTMNCSYKTTITNLRWYRQDAGRGLAQLILIRSNEREKPGGRLQVTLDTSSKSSSLSITASRAADSAAYFCAVE
Equus przewalskii V986 trav ATBW01078782.1 11548 LLLFHRRDQWRLGDPDRRPCYSPRQGTSDPNCTYQSSYSFFLFWYVQYQNKEPELLLKSSSENQDVNSRGFQANHVKSDSSFHLQKPSVQVSDSAVYYCALR
Equus przewalskii V989 trav ATBW01079259.1 44392 TVIDAQTTQPNSMDLDCAEGEDVKLPCNHSTISVDDYIHWYRQNPSQSPQYIIHGLRDNVTNNKAFLTIATDRKSSTLILPRVTLRDTAVYYCIVRK
Equus przewalskii V990 trav ATBW01079259.1 34556 GTGAQSVTQPDDHITVSEGAFLQLKCNYSYGGSLALFWYIQYPSQGLQLLLKYITGDHLVKGIKGFEAEFKKSETTFHLRKPSSYLNDSAEYFCALG
Equus przewalskii V991 trdv ATBW01079259.1 1338 SSMAQKVTQAQIIITRQEGEAVTMDCKYEISWTSYDLYWYKLPPSGEMVFLIYQDYYKPSAKQGRFSVNFQSTQKSISLTISSLQSADSAMYFCALWI
Equus przewalskii V1002 trbv ATBW01080720.1 43721 LMDADVFQTPKHCVTGTGKKITLECFQSMNHDNMYWYRQDAGRELQLLHYSYGVNNTEKGDVPSESTVSRLRKDRFSLTLESASPSQTSLYLCASS
Equus przewalskii V1003 trbv ATBW01080720.1 25000 PGLGLKLIHYSTNVEDLIAETGKKLTVNCSQDMNHDAMYWYRQDPGLGLKLIHYSINEILYNGDVPDGYTVSRKDKGNFSLTLESASINQTSLYLCASSE
Equus przewalskii V1004 trbv ATBW01080720.1 13457 LMEAKVTQAPRHLIAETGKKLTVNCSQDMNHDAMYWYRQDPGLGLKLIHYSINEILYNGDVPDGYTVSRKDTGEFPLTLESASINQTSLYLCASSE
Equus przewalskii V1005 iglv ATBW01080932.1 998 PVASSKLTQPSSVSVALGQTATITCKGGDFESFVGSWYQQKPGQAPVLVIDPSNERPSGIPERFSGSSSGDTATLTISGAQAEDEADYYCLAADASDYE
Equus przewalskii V1006 iglv ATBW01080933.1 7133 PMASSEVTQPSAVSVALGQTATLTCQGDYYERYIVNWYQQKPGQAPVLVIYANSERPSGIPERFSGSSSLGTSTLTISGAQAEDEADYYCQPADAHSSE
Equus przewalskii V1007 iglv ATBW01080934.1 838 PVASSELTQPSEVSVALGQRATLTCQGSNFEFFSPSWYQQKPGQAPVLLININNERHSGIPERFSGSSSGDTSTLTISGAQAEDEADYYCLAADDLSSE
Equus przewalskii V1009 trgv ATBW01081612.1 3745 TQVYSNLEGPQISVTKQARSSVVITCDIKQSSDYVHWYRYQEGTAPQRLLYYQFSSAKFVVDSGISSEKYHAFEDTGRTCKLFIKILEERDSAVYYCAAWE
Equus przewalskii V1012 trav ATBW01082666.1 6124 GTNGDSVTQTEGPVILSEGAPVILNCTYQTSYSMPFLFWYVQYLNNAPQLILKSSTENQRTENQDFHATLIKSDSSFHLQKPSVQMSDSAVYYCALR
Equus przewalskii V1013 trav ATBW01083214.1 33433 VNGQQIQQIPPSLLLQEGENFTMYCNSSSTFNSLQWYKQRPGGSPAFLMILVKGGQVEKQERLTARFGETRKHSSLHITAAQTADVGTYFCAG
Equus przewalskii V1014 trav ATBW01083214.1 15637 GTGAQSVTQPDDHISVSEGAPLELRCIYSYSGTPTLFWYVQYPSQGPQLLLKYYSGNTRVKGIKDFEAEFKKNETSFHLRKSSAHWSDSAEYFCALS
Equus przewalskii V1015 iglv ATBW01083473.1 12349 SWAQSVTQPASVSGTLGQTVTITCTGSSSNIVAYVGWYQQIPGTAPKTLIYGNNKRASGVPDRFSGSKSGSTATLTITGLQAEDEADYYCGTSSSSGSS
Equus przewalskii V1016 trav ATBW01083688.1 18882 SSISQKVTQAKPALLVQEKEVVTLHCSYDTSDPTYSLFWYKQSSSGAMMFLIRQDSYNQQNAAEGRYLLNFQKANKSINLVISAAQLEDSAVYFCALSE
Equus przewalskii V1019 iglv ATBW01083916.1 10188 SWAQSALTQPASVSGTLGQSVTITCAGSTGSYKYISWYQQHPGTAPKLLIYNGNNRASGIPDRFSGSTSGNTMSLTISGLQAEDEADYYCHAYVGSYN
Equus przewalskii V1022 trdv ATBW01084753.1 19315 STVAQRVTQGRTATSMQEGATVTLDCVYETSWSAYYIFWYKQLPNGEIVFLIHQDSYSPIAKNGRYSTNLQKAAKFITLTISSLRLEDSAKYFCALY
Equus przewalskii V1023 igkv ATBW01085167.1 2186 CRGQIILTQSPETLAASQGSFISITCRSSIEVGTSMAWYQQKPNEAPRLLIFGASARAEGTPSRFRGSGSGSVFSLTIHGLEAKDFGVYYCQ
Equus przewalskii V1024 iglv ATBW01085286.1 8236 SWAQSVTQPASVSGTLGQTVTISCTGSSSNIGSGHVSWYQQIPGTAPKRLIYSSTNRASGVPDRFSGSRSGNTATLTISGLQAEDEADYYCGTLYSSWSN
Equus przewalskii V1025 trav ATBW01085337.1 4776 AQQQVKQSPQSLIIQEGEISILNCTYVDSTFDYFPWYRQYPGEGPALLIAIRSVRNEIESGRFTVFFNKSTKQFSLTIKASQPGDSATYFCAAS
Equus przewalskii V1026 trdv ATBW01085338.1 2618 STVAQTVTQSQTATSKQEGATVTLDCVYETSWSTYSLFWYKQLPNGEMIFLIRQDSSSQNAKSGRYSTNFWKEANFVSLTISSLQLEDSAKYFCALV
Equus przewalskii V1027 iglv ATBW01085457.1 1122 SWAQSLTQPASVSGTLGQTVTISCSGSSSNIGYSSSYGGWYQQIPGTAPKLLIYEGNKRASGVPDQFSGSKSGNTATLTISGLQAEDEADYYCVSYDSSLSS
Equus przewalskii V1032 trdv ATBW01085737.1 14048 SSSAQKVTQDQSSMLVQEKEAVTLNCRYDTSSSSYSLFWYKQSSSGVMMLLIRQDSYNQQNATEGRYSLNFQKANKSIQLVISTSQLADSAVYFCALIE
Equus przewalskii V1033 trav ATBW01085737.1 8361 QTYGESVTQMEGQVTLSEGASLTLNCTYSTSTSGYPTLFWYVQYPGEGPQLLLRATKANKKEPSKSFEATYNTETTSLHLEKASVQESDSAMYYCAMS
Equus przewalskii V1042 trav ATBW01089109.1 5833 RSNGDSVTQTKGQVTLSEGASLTVNCSYETTQYPALLWYVQYPRKGPQLLLRASKANDKDRNKGFEATYNTETTSFHLEKASVQESDSAMYYCALS
Equus przewalskii V1044 trav ATBW01089901.1 703 LNGEVRVEQSPPALSPQEGENCTIYCNYSGTTTARVYWYRQELGKSLGHLFSLVSNGIVKQEGLFTASLDTKACRSALHITATQGGLSACYICAVD
Equus przewalskii V1045 iglv ATBW01090241.1 1833 SWAQSVLTQPASVSGTLGQTVTISCSGSSSNIGYSSTYVGWYQQVPGTALKTLIYATNTRASGVPDRFSGSKSGNTATLTISGVQAEDEADYYCSEGDSSLSS
Equus przewalskii V1046 iglv ATBW01090606.1 3143 SWAQSVTQPASVSGTLGQTVTISCSGSSSNVGSGYVSWYQQIPGTAPKLLIYYATSRASGVPDRFSGTRSGNTATLTISGLQAEDEADYYCGTSGSSWSS
Equus przewalskii V1057 trav ATBW01100637.1 1348 VSSKQQVEQSPEALSVREGDSLALNCSYTDSAIYSLQWFRQDPGKGLASLLLIQSNQREQISGRMKASLDESSRHSALYIAASQPGDSATYLCAV
Equus przewalskii V1058 iglv ATBW01102161.1 764 WVTQEASVSGSVGQKVTLSCAGNSNNVGIFDVGWYQISHSAPKTVMLRSSWPSGIPARLSSSKSGNMAYLTISGLQPEDEADYYCSAWDDSISN
Equus przewalskii V1061 trgv ATBW01109519.1 345 HLGKPQLSSNKCLSKISHIGCVVSHVTISTMPIYWYQESPGQALLPLQHVSPDNTVRMESGILMGKFEVDEIPEPSASTLTTHSGGKEDSATYYCAFWK
Equus przewalskii V1064 trav ATBW01112287.1 836 VSQGENVDQHPPSLSVQEEKSCVINCTYSDSYSTYFSWYKQEPGKGPQLIIDVLSNVDKKENPRLTVLLNKTAKYLSLHIAATQPGDSAVYFCAV
Equus przewalskii V1068 trav ATBW01128284.1 428 GLSGEDQVEQSPQTLRPQEGDSISLNCSYTVSNFRGLLWYRQDPGKGPELLFLLSSVGKPEHKERIRATLFEKGSSLHITDSKPEDSATYLCAVE