WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Canis lupus familiaris AOCS00000000.1 (AOCS01) 129 32 37 8 21 18 7 6
Canis lupus familiaris AAEX00000000.3 (AAEX03) 220 41 87 29 33 19 7 4
Canis lupus familiaris AACN000000000.1 (AACN01) 100 23 37 6 15 12 5 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Canis lupus familiaris V1 iglv AOCS01037172.1 5924 AVSSYVLTQLPSVTVTLRQPARITCGGDSFGSRNVDWYQQKPGQAPVLIIYRDSNRPTGIPERISGSNSGNTATLSISGALAKDEADYYCQVWDSSAD
Canis lupus familiaris V2 iglv AOCS01048427.1 8974 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNHPSWYQQTQGKAPRMLIYNTNNRPSGIPNCFSGSISGNKASLTITGAQPEDETDYYCLLYMGSNI
Canis lupus familiaris V3 ighv AOCS01051377.1 4060 VQGEVQLVESGGNLVKPGGSLRLSCVASGLTVYSYAIYWVHEAPGKGLQWVAAITTDGSSTYYTDAVKGRFTISRDNAKNKLYLQMNSLRAEDTPVYYCAR
Canis lupus familiaris V4 ighv AOCS01051393.1 5718 CVVSASVQGEVQLVESLRLSCVASGFTFSSYWMHWVCQAPGKGLGWVAIINSGGGSTYYADTVKGQFTIFRDNAKNMLYLQMNSLRAQDTTAYYCVS
Canis lupus familiaris V5 ighv AOCS01051398.1 6428 AQGEVQLVESGGDLMKPGGSLRLSCVASGFTISSNYMNWVRQAPGKGLQWVGYISSDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCVK
Canis lupus familiaris V6 ighv AOCS01051401.1 631 VAGGVWGRPGEACGDPETLLCGSGFTFISYYMSWVRQPPGKGLQWLAAISGSGGSTYYTDAVKGRFTISRDNAKNTLYLQMNSLRAENTAVYYCAS
Canis lupus familiaris V7 ighv AOCS01051402.1 12883 VQCEVQLVESGGDLVKPGVSLRLSCVASGVTFSSYEMTWVRQVPEKGLQWVANINSGGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAS
Canis lupus familiaris V8 ighv AOCS01051403.1 1923 VQGEMQLVESGGDLVKPRGSLRLSCVDSGVTFSSCWMSWVQQAPGKGLQWVAYINSGGSSTYYADAVKGQFTISRDNAKNTLYLQMNSLRAEDTAIYYCAR
Canis lupus familiaris V9 ighv AOCS01051408.1 3879 AAGGVWGRPGEAWGSLRLSCVASGFTFSSYAMHWVRQAPGKGLQWVAVISRDGSSTYYADAVKGRFTISRDNAKNMLYLQMNSLRAEDTAMYYCAK
Canis lupus familiaris V10 igkv AOCS01060105.1 112 SSGDIVMTQTPLSLSVSPGEPASISCKASQSLLHSNGNTYLFWFRHKPGQSPQSLIYKVSNRDPGVPDRFSGSGSGTDFTLKISRVEADDAGVYYCGQG
Canis lupus familiaris V11 igkv AOCS01060110.1 1322 SGGDIVMTQTPPSLSVSPRETASISCKASQSLLHSDGNTYLDWYLQKPGQSPQLLIYLVSNRFTGVSDRFSGSGSGTDFTLRISRVEANDTGVYYCGQG
Canis lupus familiaris V12 ighv AOCS01063473.1 645 VQCEVQLVESGGDLVKPGVSLRLSCVASGVTFSSYEMTWVRQVPEKGLQWVANINSGGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAS
Canis lupus familiaris V13 iglv AOCS01073210.1 2967 SWAQSVLTQPASVSGSLGQRVTISCTGSTNNIGGDNYVHWYQQLPGKAPSLLIYGDDNRESGVPERFSGSKSGSSATLTITGLQAEDEADYYCQSYDDSLN
Canis lupus familiaris V14 iglv AOCS01073216.1 8198 SWAQAVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTLIYGSSYRPSGVPDRFSGSSSGSSATLTISGLQAEDEADYYCSSYDSSLSG
Canis lupus familiaris V15 iglv AOCS01073220.1 10765 SWAQSVLTQPASVSGSLGQRVTISCSGRTNIGRFGASWYQQLPGKAPKLLVDSDGDRPSGVPDRFSGSKSGNSATLTITGLHAEDEADYYCLSIG
Canis lupus familiaris V16 ighv AOCS01111005.1 2193 VQGEVPLVESGGDLVKPGVSLRLSCVASGFTFSSYWISWVHQAPGKGLQWVSVINKDGSTTYHADALKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Canis lupus familiaris V17 ighv AOCS01111013.1 5507 VQGEEQLVESRGDMVKPCGSLRLSCVASGFTLSSYIMSWVRQAPGKGLQWVAYINSGGSSTRYTDAVKGRFTISRDNAKNMLYLQLNSLRAEDTAVYYCAR
Canis lupus familiaris V18 ighv AOCS01111014.1 3127 VQGEVQLVESGENLVKTGGSLTLSCVASGFTFSSYWMHSVCQAPGKGLHWVAAITTDGSSTYYTDAVKGRFTISRDNAKNTLYLQVNSLRAEDTAVYYCAR
Canis lupus familiaris V19 iglv AOCS01123605.1 6500 SWAQSVLTQPASVSQSLGQRVTISCTGSSSNVGYNSYVSWYQQLPGTVPRTIIYYTNTRPYGVPDRFSGSKSGNSATLTIAGLQAEDEADYYCSTYDSSLSG
Canis lupus familiaris V20 iglv AOCS01123607.1 3239 SLSQLVLTQPPSLSASLGSTTRLTCTLSSGFSVGGYSIYWHQQKPGSTPWYLLYYYSSTELGPGVPSCFSGSKDTSANVGLLLISGLQPEDETDYYCAI
Canis lupus familiaris V21 iglv AOCS01123607.1 49389 SWAQSVLTQPASVSGSLGQRVIISCTGSSSSIGRGYVGWYQQLPGTGPRTLIYGISNLPPGVPNRFSGSRSGSTATLTIAELQAEDEADYYCSSWDRSLSA
Canis lupus familiaris V22 iglv AOCS01123608.1 23005 SWAQAVLTQPPSVSAALGQRVTISCTGSNTNIGSGYDVQWYQQLPGKSPKTIIYGNSNRPSGVPVRFSGSKSGSTATLTITGIQAEDEADYYCQSSDDNLD
Canis lupus familiaris V23 trav AOCS01145256.1 9592 TSDQEFQVTQPESSISVRAGEILTLGCNVSARSPAGPVLWFRENGQERRLIYNFNGSQFPRVTQVEDTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Canis lupus familiaris V24 igkv AOCS01147945.1 3166 CGGRHILTQFPETLAVSPDSFISITCQSRMDIGTSMAWYQQKPGEAPRLLIFGAYARAAGTPSRFQGSGSGSDFSLTIHGVEAEDMGVYYCQ
Canis lupus familiaris V25 igkv AOCS01147950.1 5212 ITGEIVMTQSPDSLSLSQEKKVTITCRASQSVSSYLAWYQQKPGQAPKLLIYGASNKATGVPSRFSGSGSGTDFSFTISSLEPEDVAVYYCQQYNSGY
Canis lupus familiaris V26 igkv AOCS01147953.1 7964 STGEAVMTQTPLSLAVTPGELATISCRASQSLLRSDGKSYLNWYLQKPGQTPRPLIYEASKRFSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSLHFP
Canis lupus familiaris V27 ighv AOCS01156986.1 2320 IQGEVQLVESGGDLVKPGGSLRLSCVASGFTFNSYDMSWVHQVRGKRLQWVAYFSSDGNSTSSADTVKGQFTISRHNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V28 ighv AOCS01156988.1 328 VQSEMQLVEAGGDLVKPGGSLRLSCVASGFTFSSYWMSWVRQAPGKGLQWVAYINSGGSSTYYADAVKGRFTISRDNAKNTLYLQMKSLRAEDTAVYYCVR
Canis lupus familiaris V29 iglv AOCS01166625.1 16781 SWVQPVLTQPPSVSGFLGQRVTISCTGSSSNILGNSVNWYQQLTGRGPRTVIYYDNNRPSGVPDQFSGSKSGNSATLTISGLQAEDETDYYCSTWDSRLRA
Canis lupus familiaris V30 trgv AOCS01168002.1 3988 GAAGLKLEQTPVVVGRLGTLATLPCTVDTSVSYIHWYFHKEDTAPKRLLYLDMSRSYVQRDIFVKADKVNAKKGRNSYSCNLLLQKLEKNDEGVYYCAAWE
Canis lupus familiaris V31 trgv AOCS01168007.1 686 GGAGLTLEQTPVVVGRLGTSATLLCTVDSSVYYIHWYFHKKFAAPKRLLYLDMSSSSVQRDTSVKAHKVNAKKGKDSYSCNLLVQKLEKSDEGVYYCAAWE
Canis lupus familiaris V32 trgv AOCS01168013.1 866 GGAGLNLEQNPVAVERLDTLAILKCQVDTWVWYINWYFHQEGTAPKWLLYLDMSTGKVQRDAFVNADKVSAQKDKDSYSCALLVQRLRKSDEGVYYCAAWE
Canis lupus familiaris V33 trgv AOCS01168021.1 5174 GGAGLKLEQTPVVVVHLGTSATLPCTVDSSVNYIHWYFHREGIAPKRLLYIYTYSSSVQRDASVNMGKVNAKMDKNNYSCKLLVQKLEKSDEGVYYCAAWEEP
Canis lupus familiaris V34 trgv AOCS01168029.1 18066 GHAETRLEQPAVVVAREKSSASLLCTANVKASYIHWYRYQEGKGLQRLLHLAMFQSDVQWDSVLEADKVTAIETKDGYSCTLLVLKLEKSDEGMYYCAAWR
Canis lupus familiaris V35 trgv AOCS01168031.1 3855 TKADTLITQLMPSVIKKQGNTAFLECQIKTGAFKKNVYIHWYRQKPDQPLQRILYISSNENVVHEQGVSEERYEARKWKQDLPASLRIHRVNEADAGLYYCACWD
Canis lupus familiaris V36 iglv AOCS01180699.1 1918 SWAQSVLTQLASVSGSLGQRVTISCSGSTNDIGIIGVNWYQQLPGKAPKLLIYDNEKRPSGIPDRFSGSKSGNSGTLTITGLQAEDEADYYCQSMDFSLG
Canis lupus familiaris V37 iglv AOCS01180700.1 4891 ADSQTVVTQEPSLSVSLGGTVTLTCGLSSGSVSTSNYPNWSQQTPGQAPRTIIYNTNSRPSGVPNRFTGSISGNKAALTITGAQPEDEADYYCALGLSSSSS
Canis lupus familiaris V38 iglv AOCS01180716.1 1819 SRAQSALTQPSSVSGTLGQTVTISCDGSSSNIGSSNYIEWYQQFPGTSPKLLIYYTNNRPSGIPARFSGSESGNTASLTISGLQAEDEADYYCSAYTGSNT
Canis lupus familiaris V39 iglv AOCS01184129.1 84 SMTSTGLNQAPSVLVALGQMATITCSRDVLGKRYAYWYQHKPSQAPVLLINKNNERASGIPDWFSGSNSGNMATLTISGARAEDKADYYCQSYDSSGN
Canis lupus familiaris V40 iglv AOCS01184131.1 897 SVASYVLTQSPSVSVTLGQTASITCRGNSIGRKDVHWYQQKPGQAPLLIIYNDNSQPSGIPERFSGTNSGSTATLTISEAQTKDEADYYCQVWESSAD
Canis lupus familiaris V41 ighv AOCS01188656.1 3880 VQAEVQLVETEGDLVKPGGSLRLSCVASGFIFSSYDMDWVCQAPGKGLQWVTYISNGGSSTRYADAVKGQFTISRDNARNTLYLQMNNLRDEDMAVYYCVS
Canis lupus familiaris V43 iglv AOCS01191274.1 10357 SWAQSVLTQPTSVSWSLGQRVTISCSRSTNNIGIVGASWYQQLPGKAPKLLVDSDGDQLSGVPDRFSGSKSGNSANLTITGLQAEDKADYYCQSF
Canis lupus familiaris V44 iglv AOCS01194374.1 2120 SWAQSALTQTASMSGSLGQRVTVSCTGSSSNVGYRSYVGWYQQLPGTGPRTIIYNTNTRPSGVPDRFSGSISGSTATLTIAGLQAEDEADYYCSSYDSSLKA
Canis lupus familiaris V45 ighv AOCS01195496.1 3653 VQGEVQLVKSGGDLVKPAGSLRLSCVASGFTFSSYYMSWIRQAPEKGLQWVADINDSGGSTGYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V46 ighv AOCS01196168.1 1106 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSNYEMYWVRQAPGKGLEWVARIYESGSTTYYAEAVKGRFTISRDNAKNMAYLQMNSLRAEDTAVYYCAS
Canis lupus familiaris V47 ighv AOCS01196169.1 2666 VQGEEQLVEFGGHMVNPGGSLGLSCQASGFTFSSYGMSWVRQAQKKGLQWVRHISYDGSSTYYADTLRDRFTISRDNTKNMLYLQMNSLRAEDTAVYYCMR
Canis lupus familiaris V48 trav AOCS01197654.1 12762 GGSVLNVEQNPPWLHVQEGENTNFTCHFPSSNFYSLQWYRQEPAKSLKFLFTIALNGDEKEEGRVRATLNTREGYSSLYIKRSQPEDAAVYLCA
Canis lupus familiaris V49 trav AOCS01197656.1 4225 INGQEIKQNPQFLLLQEVEDFTIYCNSSSTLNGLQWYKQRPGDGPVLIKLFKGGEVKQKRRTAQLGETRKDSSLHKAASQTADAGTYFCAGSTVLS
Canis lupus familiaris V50 trav AOCS01197659.1 8916 IRVQMKVEQSPGVLILQEGRNASMMCNYSIAVTSVQWFQQNHEGHLTPLLYIVSGMKQKGRLKFTVDTKERNSHLYITDSQPGDSVTYFCAVE
Canis lupus familiaris V51 trdv AOCS01197661.1 7413 ASLAEKVIQTQNTVTKQEGEAATFNCNYETTWSDYYTLYWYKQPPGGEMIFLIYQDENKPNEKQGRLSTSFQKAAKSISLTISSLQLTDSATYFCALDN
Canis lupus familiaris V52 trav AOCS01197662.1 1060 IMSETKTTQPNVMESTEEEPVHLPCNHSTISGNEYIHWYRQIPQQSPEYMIHGLKDNVTNGMATLIIAVDRKSSTLILPWITLRDAAVYYCIVRE
Canis lupus familiaris V53 trav AOCS01197663.1 1485 VSSQELEQSPQSLIIQEGENFTINCHSSKPVYALHWYRQKNSEGLISLMILWENGEKSHEKTTATLNEKKQQSSLHITASQSSDSGIYFCAA
Canis lupus familiaris V55 trdv AOCS01197671.1 9833 SSMAQKVTQTQPDISVRDTETVTLNCMYDTSDSNYLFWYKQPPSREMILIIRQEVYRQDNATNNRFSVNFQKGNKSFSLKISDSRLEDAATYFCALME
Canis lupus familiaris V56 trdv AOCS01197672.1 1241 SSMAQKVTQTQPEMFVQETETVILHCTYDTSDSDYYLFWYKQPPSREMILIIRQEVYRQDNATNNRFSVNFQKGNKSFSLKISDSRLEDAAMYFCVLAG
Canis lupus familiaris V57 trav AOCS01197675.1 8061 RTHGNSVKQTDQITVLEGTSVTMNCIYTFTQYPTLFWYVQYPNKALQLLHKETMENSKNFGARNIKDKNSPITKSSVQVSNSAMYYCLLRDTHNAK
Canis lupus familiaris V58 trdv AOCS01197678.1 4864 SSNSETVRQSQNKVYKQEGESVTLDCSFTLSFNYYVMNWYQQPFGERMTEVMSIYSDSTSSSKGRYSVSFQKGNKILTLTITGLTLTDSGVYFCAVGEV
Canis lupus familiaris V59 trdv AOCS01197681.1 11585 VSLDIILEPETKTLTVLVGEPATFRCNVTGGDLKNYQVSWYRKNEDNSLTLIYRQSNNTNDNLRSNFKGNTDASKSQCILDIEKATTANAGTYYCAAD
Canis lupus familiaris V60 iglv AOCS01199265.1 6618 SWAQSVLTQPSSVSGTLGQRVTISCTGSSSNIGGDYGVNWYQQLPGKAPKTIIYASTNQPSGVPERFSGSRSGSSGSLSITGLQAEDEADYYCSAWDSKLSA
Canis lupus familiaris V61 trav AOCS01201638.1 580 QTHGDSVKQMEGQVTLSEEASLTINCTFSTSVTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFHLKKGSVEMSDSAVYYCALS
Canis lupus familiaris V62 trav AOCS01204149.1 1088 VSSKQEVKQSPEALSVRERDSVVLSCNFTDSAIYSLQWFRQDPGKGLTLLLLMQSNQKEQTSGRIKVWLDMSSRQSTLYIAASQPSDSATYLCAV
Canis lupus familiaris V63 trav AOCS01204153.1 2263 GTGAQSVTQPDAHITVPEESPLELRCNYSYGATPYLYWYVQYPNQGLKLLLRYFSGDTVVQGIKGFKAEFSKTSFHLKKPSAHWSDSAKYFCAAS
Canis lupus familiaris V64 trav AOCS01204153.1 7333 VTGMEVEQRPLVESVLEGASPTLQCNFSTSATSVQWFRQDPGGHLVHLFYIPSGTKHNGRLNSTTVTKERRSSLYIFSSQTTDSAIYFCAVK
Canis lupus familiaris V65 trav AOCS01204690.1 468 QTHGNSVNQTEGQVTLSEEASLTMNCTYSTSGYPVLFWYVQYLGNGPQLLLKASGDKEKGSNKGFEATLDSSSKSFHLKKGSLHVSDSAVYYCVMS
Canis lupus familiaris V66 trav AOCS01204691.1 4060 VSGKNQVEQNPPSLITLEGKNCTIQCNYTVNPFGSLRWYKHSTGTGPASLIGMTYSDSKKSYGSYTVTLDANSKQSSLHITAAQLSDSASYICVVS
Canis lupus familiaris V67 trav AOCS01204695.1 531 MTSQQKGVEQSPGSLSTPEGTTASLNCNYSDSASQYFMWYRQYSGKGPELLMNIYSKGEKEEGRFAVQVDRAKQYVSLLIRDSQPSDSATYLCAVS
Canis lupus familiaris V68 trav AOCS01204695.1 4701 GTGAQSVTQPDAYVTVSEEAPLELRCSYSSSIQPYLYWFVQYPNQGPQLLLQYTLKGALVKGIKGFEAEFKRNETSFHLRKPSAHGSDTAKYFCALS
Canis lupus familiaris V69 ighv AOCS01019650.1 34786 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSNYMSWIRQAPGKGLQWVSQISSDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRDEDTAVYYCAR
Canis lupus familiaris V70 ighv AOCS01019650.1 14378 VLSELTLQESGPGLVKPSQTLSLTCVVSRGSVTSSYYWNWIRQRPGRGLEWMGYWIGSTSYNPAFQGRISITADTAKNQFSLQLSSMTTEDTAVYYCAR
Canis lupus familiaris V71 ighv AOCS01019654.1 8606 VQGEVQLVESGGDVVKPGGSLRLSCVASGFTFSSYYMYWARQAPGKGLQWVSHINKDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V72 ighv AOCS01019658.1 11092 VQGEVLLVESGGDLVKPGGSLRLSCVASGFTFSSYDMGWVRQAPGKGLQWVAYISNGGSSTRYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAS
Canis lupus familiaris V73 trbv AOCS01036500.1 28044 LLNAQVTQTPRQLIKKVGAKVLLKCSQNMDHERMFWYRQDPGLGLRLLYWSYNIDSVETGDIPYGYSVSRKKKDAFPLILESARINQTSVYFCASS
Canis lupus familiaris V74 trbv AOCS01036500.1 21493 SVFGALVSQKPRRDICQRGTSITIHCEVDTQVTLMFWYRQLPGQSLILIATANQGAEATYESGFTREKFPISRRTLMFSTLTVSNLSLEDTSSYFCSTR
Canis lupus familiaris V75 trbv AOCS01036503.1 22499 SMDAGITQTPRNGIIKKGKNISLECSQTKSHNYMYWYRQDPGMGLRLISYSFGVNYINEGEVSNGYSASRTDLEKFSLSVGTAIPNQTALYFCASSD
Canis lupus familiaris V76 trbv AOCS01036503.1 17223 LMDGSVSQTPRHCISGTGKKITLECSQTMGYDNMYWYRQDPGKALQLLHYSYGVNTTEKAELSSGSTVSRLRKELFSLTLESTSLSQTSLYLCASSE
Canis lupus familiaris V77 trbv AOCS01036503.1 10353 LKDALVNQFPRHRILGTGKKLTLQCLQDMNHVSMFWYRQDPGFGLQLIYYSTGTDNFEKGDAPEGYDVSRNELKSFPLTLVSASTNQTSVYLCASS
Canis lupus familiaris V79 trav AOCS01036506.1 7958 STNAGVTQNPRHLVRRTGQEAILTCSPEKGHSYFYWYQQFLGEGLKFMIYLQKETILDQSGMLKKRFSTEFSEDGLSILKIQPAELGDSAVYFCA
Canis lupus familiaris V81 trbv AOCS01036507.1 7663 HMGAMVIQSPRYQVTKVGKPVTLNCSQNLNHDTMYWYQQKLRQAPKLLLYYYDTELTKETDTSDNFQPSRLSNSLCSLSIRSPGLGDSAVYLCASSK
Canis lupus familiaris V82 trbv AOCS01036507.1 4069 TLNAKVMQTPGHLVKGKGQKAKMECVPIKGHSYVFWYQQIPAKEFKFLISFQDNAVFDKTGMPTQRFLAFCPKNSPCSLEIERTELQDSAVYFCASSE
Canis lupus familiaris V83 trbv AOCS01036508.1 70781 PMDTGITQTPKHLVTGPGRRVTLNCEQHLGHDEVYWYQQSGQKPPKLMFAYRYKELIENETASGRFSPECPDSSRLYLHVDALEPDDSALYLCASSR
Canis lupus familiaris V84 trbv AOCS01036508.1 66814 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHNAMYWYKQDLKQLLKIMFIYFNQGLNLNESVPGRFSPETSDKSHLNLHVDSLETGDSAVYFCASSL
Canis lupus familiaris V85 trbv AOCS01036508.1 63362 PMDTGITQTPKHLVTGPGRRVTLNCEQHLGHDAVYWYQQSGQKPPKLMFAYRYKELIENETASGRFSPECPDSSRLYLHVDALEPDDSALYLCASSR
Canis lupus familiaris V86 trbv AOCS01036508.1 56050 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHNAMYWYKQDLKQLLNVMFIYNNKELILNESVPGRFSPETSDKSHLNLHVDSLETGDSAVYFCASSQ
Canis lupus familiaris V87 trbv AOCS01036508.1 52531 PMDTGITQTPKHLVTGPGRRVTLNCEQHLGHDEVYWYQQSGQKPPKLMFAYRYKELIENETASGRFSPECPDSSRLYLHVDALEPDDSALYLCASSR
Canis lupus familiaris V88 trbv AOCS01036508.1 44307 PMDTGITQTPKHLLTETGRRVTLKCEQHLGHNAVYWYQQSTQKPPKLMFAYSYKVLVENETASGRFSPECPDSSRFYLHMDALEPNDSALYLCASKE
Canis lupus familiaris V89 trbv AOCS01036508.1 30256 GPVESEVIQTPRHMIKARGQTVTLRCSLISGHLSVYWYQQALGQGPRFLIQYYNREERDKGDIPARFSVQQFSNYSSQLEMNSLEPGDSALYLCASSL
Canis lupus familiaris V90 trbv AOCS01036508.1 21458 SVPTGHAEPGVSQSPRHRVTKRGQNVSFTCDPISGHVVLYWYRQTMGQGPEFLVYFQNEEAMDESGLDKTRFSAKRPKGTRSTLQIQRAEQRDSAVYLCASS
Canis lupus familiaris V91 trbv AOCS01036508.1 6066 PVGAGVIQTPRHLIKGSGGKALLECHLVSGHNTVRWYKQAPGQGPQFLFEYYRQEQRDKGDVSARFSAQQFSDASSQLEMNPLELGDSALYLCASSL
Canis lupus familiaris V92 trbv AOCS01036508.1 1267 YMDAGIIQSPRYKVTGTGKRVTLRCHQTDNYDYMYWYRHDLGHGPRLIYYSNGINSTEKGDLSNGYTVSRSNKMDFPLLLDSVTSSQTSVYFCADSY
Canis lupus familiaris V93 iglv AOCS01048435.1 1262 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYSSSVGWYQQFPGTGPRTIIYYDSSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSWDNSLKA
Canis lupus familiaris V94 iglv AOCS01048442.1 1995 SWAQAVLNQPASVSGALGQKVTISCSGSTNDIDIFGVSWYQQLPGKAPKLLVDSDGDRPSGVPDRFSGSSSGNSGTLTITGLQAEDEADYYCQSVD
Canis lupus familiaris V95 iglv AOCS01048447.1 914 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRDYVGWYQQLPGTRPRTLIYGNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDNS
Canis lupus familiaris V96 iglv AOCS01048448.1 1206 SWAQSMLTQPASVSGSLGQKVTISCTGSSSNIGGNYVGWYQQLPGIGPRTVIYGNNYRPSGVPDRFSGSKSGSSATLTISGLQAEDEAEYYCSSWDDSLR
Canis lupus familiaris V97 iglv AOCS01048449.1 17190 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIDRKYVGWYQQLPGTGPRTVIYDNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Canis lupus familiaris V98 iglv AOCS01048449.1 10343 SWAQAVLTQPPSVSAVLGQRVTISCTGSSTNIGSGYDVQWYQQLPGKSPKTIIYGNSNRPSGVPDRFSGSKSGSTASLTITGLQAEDEADYYCQSSDDNLD
Canis lupus familiaris V99 iglv AOCS01048455.1 18507 SWAQSVLTQPASVSGSLGQRITISCTGSSSNIGGNNVGWYQQLPGRGPRTVIYSTNSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDDSLSA
Canis lupus familiaris V100 iglv AOCS01048456.1 5992 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQPEDEADYYCQSIEPMLGA
Canis lupus familiaris V101 trgv AOCS01071586.1 19698 GLGQVKLEQHEISVSRARDKTARISCKVITEDFNSEVIHWYRHKPDQEIEHLIMVQTSSTQASLDGRKNKLEASKNAVTSTSTLSINFLQEEDEAMYYCACWKG
Canis lupus familiaris V102 iglv AOCS01073215.1 4447 SWTQSVLTQPASASGSLGQRVTVSCSSSTNNIGIIGVKWYQQIPGKAHKLLIYDNEKRPSGVPNRFSGSKSGDLSTLTINGLQGEDEADYYCQSMDFSLG
Canis lupus familiaris V103 trbv AOCS01122162.1 11204 VRAQTIHQRPLARVQLVGSLLSLECTVQGASSPYLYWYRQSLGGAPQLLFSSLSVTQIVPETPHNFTASRPQNGQFILSSKKLLLSDSGFYLCAWS
Canis lupus familiaris V104 trav AOCS01136610.1 6495 QTHGDSVNQTEGQVILSEEAFLTINCTYSTTWPPTLFWYVQYLGEGPQLLLKALRDKEKGSSKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALR
Canis lupus familiaris V105 trav AOCS01136610.1 1536 VVTGMKVEQSPSALSLQEGASSILKCNYSSAVKSVQWFRQNPGGVSLTRLFYIASGMKQSGRLNCTLNAKELFSTLHVTASQLEDSATYLCAVE
Canis lupus familiaris V106 trav AOCS01136616.1 3414 VVTGMKVEQSPSALSLQEGASCTLKCNYSSTPDNVQWFRQNPGGGSLTRLFYIASGMKQSGRLNCTLNAKELFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V107 trav AOCS01136618.1 4761 QTHGDLVTQMEGQVTLSEEAFLTVNCNYSASGYLALFWYVQYLREGPQLLLKASRDKEKGSNKGLEATNDRSSRSFHLKKSSVQMSDSAVYYCALR
Canis lupus familiaris V108 ighv AOCS01138813.1 27133 VQGEVQLVESGGDLVKPVASLSLSCVASGFTFSNYAMSWVRQAPGKGLQWVAEISHSGRSTGYTDAVKGRFTITRDNAKNMLYLKMNSLTAKDMAMYYCAR
Canis lupus familiaris V109 ighv AOCS01138813.1 2712 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMFWIRQAPGKGNQWVGYINKDGSSTYYPDAVKGRFTISRDNAKNTLYLQMNSLTVEDTALYYCAR
Canis lupus familiaris V110 iglv AOCS01145273.1 531 FQPGLAQPDALLFFPGQVAQLSCMLSPRHATIGEYGVSWYQQRAGSAPRYLLYYRSEKDYHRSPDIPDRFSAATDAAHNACILTISPVQPEDDADYYCSVG
Canis lupus familiaris V111 igkv AOCS01147954.1 4635 VSGEIVMTQSPGSLAGSAGESVSINCKSSQSLLYSFNQKNYLAWYQQKPGERPKLLIYLASSWASGVPARFSSSGSGTDFTLTINNLQAEDVGDYYCQQHYSSP
Canis lupus familiaris V112 iglv AOCS01169037.1 982 IDSQIVVTQEPSLSPGGTVLLTCGLSSGSVTTSNYSSWYQQTPGRAPRTIIYNTNSHPSGVPDRFSGSISGNKAALTITGAQPEDEADYYCVTEHGSGSS
Canis lupus familiaris V113 trdv AOCS01170470.1 7627 KGVLCEQVIQSSLEQMVASGSKVTLLCTYDTSYSNPDLYWYRIRSDHSFQFILYRDNTQSRNADFTQGRFSVLHNPSQKTFHLVISQVEPEDSATYYCAID
Canis lupus familiaris V114 iglv AOCS01182138.1 1954 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQ
Canis lupus familiaris V115 iglv AOCS01182140.1 779 SWAQSVLSQPASVSGVLGQRVTISCTGSSSNIGGNYVSWHQQVPETGPRNIIYADNYRASGVPDRFSGSKSGSTATLTISVLQAEDEADYYCSVGDDSLK
Canis lupus familiaris V116 iglv AOCS01182152.1 7898 SWAQSVLNQPPSVSGSLGQRITISCSGSTNDIGMLGVNWYQQLPGNAPKLLVDGTGNRPSGVPDQFSGSKSGNSGTLTITGLQAEDEADYYCQSYD
Canis lupus familiaris V117 iglv AOCS01182153.1 1028 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQ
Canis lupus familiaris V118 iglv AOCS01182156.1 7643 ADFQIVVTQEPSLSVSPGGTVTLTCGLSSGSVTISNYPDWYQQTPGRSPRMLIYNTNNRPSGVPNHFSGSISGNKAALTITGAQPEDEAYYYCAVYQGSGSS
Canis lupus familiaris V119 iglv AOCS01189526.1 2628 SVASYVLTQLPSVSVNLGKTASITCEGNNIGDKYAYWYQQKPGQAPVLIIYEDSKRPSGIPERFSGSNSGNTATLTISGARAEDEADYYCQVWDNSAK
Canis lupus familiaris V120 ighv AOCS01190864.1 8197 VQGEVQLMESGGDLVKPGGSLRLSCVASGFTFSSYYMHWVRQATGKGLQWVARISNDGSSTRYADAMKGQFTIFRDNSKNTLYLQMNSQRAEDMALYYCAR
Canis lupus familiaris V121 ighv AOCS01190864.1 2914 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMDWVRQAPGKRLQWVAGISSDGSSTYYPEAVKGRFTISRDNAKNTLYLQMNSLRAEDSAVYYCAM
Canis lupus familiaris V122 ighv AOCS01190865.1 760 VQGEVQLVESGGDLVKSGGSLRLSCVASGFTFSSYYMHWVRQATGKGLQWVARISNDGSSTRYADAMKGQFTIFRDNSKNTLYLQMNSQRAEDMALYYCAR
Canis lupus familiaris V123 igkv AOCS01196171.1 1838 SSGDIVMTQTPLSLSVSPGEPASISCKASQSLLHSNGNTYLFWFRHKPGQSPQSLIYKVSNRDPGVPDRFSGSGSGTDFTLKISRVEADDAGVYYCGQG
Canis lupus familiaris V124 igkv AOCS01196173.1 2918 SSGDIVMTQTPLSLSVSPGETASISCRANQSLLHSNGNTYLDWYMQKPGQSPQGLIYRVSNHFTGVSDRFSGSGSGTDFTLKISRVEADDAGVYYCGQG
Canis lupus familiaris V125 ighv AOCS01198317.1 1707 VQGEVQLVESGGALVKPGASLRLSCVASGFTFSSYDMSWVRQAPGKGLQWVAFISYDGSSTYYADAVRGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCGK
Canis lupus familiaris V126 ighv AOCS01198393.1 3120 FQGEVQLVESGGDLVKPGGSLRLSCVTSGFTFISYYMAWVRQAPGKGLQLVTWISSDGSSTYYPDAVKGRFTISRDNVKNTLYLQMNSLRSEDTAVYYCEK
Canis lupus familiaris V127 ighv AOCS01198394.1 1263 CLVSAGVQGKVQLWGRPGEAWGVPETVLCGLWIHLHSYYMHWVLQAPRKGLQWVARIRSDGSSTYYTDVVKCRYTISRDNSKNTLYLQMNSLRAEDTALYYCAR
Canis lupus familiaris V128 trav AOCS01199550.1 3817 VTGMKVEQSPSALSLQEGASSILKCNYSSAVSSVQWFRQNPGGGSLTRLFYIASGMKQSGRLNCTLNAKERFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V129 ighv AOCS01201929.1 638 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSSDMSWIRQAPGKGLQWVAYISNDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Canis lupus familiaris V130 iglv AOCS01202192.1 594 FWAQSVLTQPPSVFRSLGQRVTISCTGSSCNVGRGYVIWYQQLLGTRPRTLIYGSSNQPSGVPNRFSGSRSGSTDTLTISGLQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V131 iglv AOCS01202764.1 636 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTGNKPGWYQHTPGQAPRRIIYDTSSRPSGVPDRFSGSISENKAALTITEAQPEDEAAYHCSLYMSGGA
Canis lupus familiaris V132 ighv AOCS01204940.1 708 VQGEEQLVEFGGHMVNPGGSLGLSCQASGFTFSSYGMSWVRQAQKKGLQWVRHISYDGSSTYYADTLRDRFTISRDNTKNMLYLQMNSLRAEDTAVYYCMR
Canis lupus familiaris V133 ighv AOCS01205476.1 500 VQGEVQLVESGGDLVKPEGSLRLSCVASGFTFSSFYMSWFRQAPEKGLQWVAEISGSGSSTSYADAVKGRFTISRDNAKNTLYLRMNSLRAEDTAVYYCAR
Canis lupus familiaris V54 trav AAEX03003433.1 48206 TDAQVVQVNDSMYGFIGTDVVLHCSFTNPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Canis lupus familiaris V96 trav AAEX03005601.1 50763 VVTGMKVEQSPSALSLQEGASSILKCNYSSAVNSVQWFRQNPGGGRLTRLFYIASGMKQSGRLNCTLNAKERFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V97 trav AAEX03005601.1 60295 QTHRDLVTQKDGQVTLSEEAFLTVNCNYSASGYLALFWYVQYLREGPQLLLKASRDKEKGSNKGLEATNDRSSRSFHLKKSSVQMSDSAVYYCALR
Canis lupus familiaris V98 trav AAEX03005601.1 73779 VVTGMKVEQSPSALSLQEGASCTLKCNYSSTPYNVQWFRQNPRGGSLTRLFYIASGMMQSGRLNCTLNAKERFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V99 trav AAEX03005601.1 104947 QTHGDSVNQTEGQVTLSEEAFLTMNCTFSTSWTPSLFWYVQYLGEGPKLLLKALTNKAKGSNKGFEATLDSSSKSFHLKKGSVEMSDSAVYYCAMS
Canis lupus familiaris V100 trav AAEX03005601.1 113673 QTHGDSVNQTEGQVILSEEAFLTINCTYSTTWLPTLFWYVQYLGEGPQLFLKAVTDKEKGSNKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALS
Canis lupus familiaris V101 trav AAEX03005601.1 122970 VVTGMKVEQSPSALSLQEGASSILKCNYSSAVNSVQWFRQNPGGGRLTRLFYIASGMKQSGRLNCTLNAKERFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V102 trav AAEX03005601.1 135798 QTHGDSVKQMEGQVTLSEEASLTINCTFSTSTTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFHLKKGSVQMSDSAVYYCALS
Canis lupus familiaris V103 trav AAEX03005601.1 151858 QTHGDSVNQTEGQVTLSEEAFLTMNCTYSATGSLILFWYVQYLGEGPQLLLKALRDKEKGSSKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALR
Canis lupus familiaris V104 trav AAEX03005601.1 163123 VVTGMKVEQSPSALSLQEGASSILKCNYSSAVNSVQWFRQNPGGGRLTRLFYIASGMKQSGRLNCTLNAKERFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V105 trav AAEX03005601.1 174440 QIHGDSVKQMEGQVTLSEEASLTINCTFSTSTTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFHLKKGSVEMSDSAVYYCALS
Canis lupus familiaris V106 trav AAEX03005601.1 190108 QTHGDSVNQTEGQVTLSEEAFLTMNCTFSTSWSPSLFWYVQYLGEGPKLLLKALTNKAKGSNKGFEATLDSSSKSFHLKKGSVEMSDSAVYYCAMS
Canis lupus familiaris V107 trav AAEX03005601.1 197271 QTHGDSVNQTEGQVILSEEAFLSINCTYSTTGSPTLFWYVQYLGEGPQLLLKALRDKEKGSSKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALS
Canis lupus familiaris V108 trav AAEX03005601.1 205649 VTGMKVEQSPSALSLQEGASSILKCNYSSAVRSVQWFRQNPRGGSLTRLFYIASGMKQSGRLNCTLNAKELFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V109 trav AAEX03005601.1 219992 QTHGDSVKQMEGQVTLSEEASLTINCTFSTSVTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFHLKKGSVQMSDSAVYYCVMS
Canis lupus familiaris V110 trav AAEX03005601.1 238117 QTHGDSVNQTEGQVILSEEAFLTINCTYSTTWPPTLFWYVQYLGEGPQLLLKAVTDKEKGSNKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALS
Canis lupus familiaris V111 trav AAEX03005601.1 241232 QTHGDSVNQTEGQVTLSEEAFLTINCTYSTTRSPTLFWYVQYLGEGPKLLLKALRDKEKGSNKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALS
Canis lupus familiaris V112 trav AAEX03005601.1 246181 VVTGMKVEQSPSALSLQEGASSILKCNYSSAVNSVQWFRQNPEGGSLTRLFYIASGMKQSGRLNCTLNAKELFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V113 trav AAEX03005601.1 258521 QIHGYSVKQMEGQVTLSEEASLTINCTFSTSTTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFHLKKGSVKMSDSAVYYCALS
Canis lupus familiaris V114 trav AAEX03005601.1 275162 VSGKNQVEQNPPSLITLEGKNYTIQCNYTVNPFGSLRWYKHSTGTGPASLIGMTYSDSKKSYGSYTVTLDANSKQSSLHITAAQLSDSASYICVVS
Canis lupus familiaris V115 trav AAEX03005601.1 290632 MTSQQKGVEQSPGSLSTPEGTTASLNCNYSDSASQYFMWYRQYSGKGPELLMNIYSKGEKEEGRFAVQVDRAKQYVSLLIRDSQPSDSATYLCAVS
Canis lupus familiaris V116 trav AAEX03005601.1 294830 GTGAQSVTQPDAYVTVSEEAPLELRCSYSSSIQPYLYWFVQYPNQGPQLLLQYTLKGALVKGIKGFEAEFKRNETSFHLRKPSAHGSDTAKYFCALS
Canis lupus familiaris V117 trav AAEX03005601.1 336850 VSSKQEVKQSPEALSVRERDSVVLSCNFTDSAIYSLQWFRQDPGKGLTLLLLMQSNQKEQTSGRIKVWLDMSSRQSTLYIAASQPSDSATYLCAV
Canis lupus familiaris V118 trav AAEX03005601.1 350951 GTGAQSVTQPDAHITVPEESPLELRCNYSYGATPYLYWYVQYPNQGLKLLLRYFSGDTVVQGIKGFKAEFSKTSFHLKKPSAHWSDSAKYFCAAS
Canis lupus familiaris V119 trav AAEX03005601.1 356013 VTGMEVEQRPLVESVLEGASPTLQCNFSTSATSVQWFRQDPGGHLVHLFYIPSGTKHNGRLNSTTVTKERRSSLYIFSSQTTDSAIYFCAVK
Canis lupus familiaris V120 trav AAEX03005601.1 379862 GGSVLNVEQNPPWLHVQEGENTNFTCHFPSSNFYSLQWYRQEPAKSLKFLFTIALNGDEKEEGRVRATLNTREGYSSLYIKRSQPEDAAVYLCA
Canis lupus familiaris V121 trav AAEX03005601.1 394525 INGQEIKQNPQFLLLQEVEDFTIYCNSSSTLNGLQWYKQRPGDGPVLIKLFKGGEVKQKRRTAQLGETRKDSSLHKAASQTADAGTYFCAGSTVLS
Canis lupus familiaris V122 trav AAEX03005601.1 412100 KSTQLLQQSPRSLSIQEGENFTTYCNFTSTFPSFQWYRQKPGAGPVHLMTLSKRGEVKKQKSLTALFGEARKDSSLLIIAAQPGDAAIYFCAGS
Canis lupus familiaris V123 trav AAEX03005601.1 418184 IRVQMKVEQSPGVLILQEGRNASMMCNYSIAVTSVQWFQQNHEGHLTSLLYIVSGMKQKGRLKFTVDTKERNSHLYITDSQPGDSVTYFCAVE
Canis lupus familiaris V124 trav AAEX03005601.1 453352 IMSETKTTQPNVMESTEEEPVHLPCNHSTISGNEYIYWYRQIPQQSPEYMIHGLKDNVTNGMATLIIAVDRKSSTLILPWITLRDAAVYYCIVKE
Canis lupus familiaris V125 trav AAEX03005601.1 467924 VSSQELEQSPQSLIIQEGENFTINCHSSKPVYALHWYRQKNSEGLISLMILWENGEKSHEKTTATLNEKKQQSSLHITASQSSDSGIYFCAA
Canis lupus familiaris V127 trav AAEX03005601.1 513278 SSMAQKVTQTQPDISVRDTETVTLNCMYDTSDSNYLFWYKQPPSREMILIIRQEAYRQENATNNRFSVNFQKGNKSFSLRISDSRLEDAAMYFCALME
Canis lupus familiaris V128 trdv AAEX03005601.1 521015 SSMAQKVTQTQPEMFVRETDTVILHCTYDTSDSDYYLFWYKQPPSREMILIIRQEVYRQDNATNNRFSVNFQKGNKSFSLKISDSRLEDAAMYFCVLAG
Canis lupus familiaris V129 trav AAEX03005601.1 551776 RTHGNSVKQTDQITVLEGTSVTMSCIYTFTQNPTLFWYVQYPNKALQLLHKETMENSKNFGARNIKDKNSPITKSSVQVSNSAMYYCLLRDTHNAK
Canis lupus familiaris V130 trdv AAEX03005601.1 593655 SSNSETVRQSQNKVYKQEGESVTLDCSFTLSFNYYVMNWYQQPFGERMTEVMSIYSDSTSSSKGRYSVSFQKGNKILTLTITGLTLTDSGVYFCAVGEV
Canis lupus familiaris V131 trdv AAEX03005601.1 632002 VSLDIILEPETKTLTVLVGEPATFRCNVTGGDLKNYQVSWYRKNEDNSLTLIYRQSNNTNDNLRSNFKGNTDASKSQCILDIEKATTANAGTYYCAAD
Canis lupus familiaris V210 trbv AAEX03010196.1 32915 VRAQTIHQRPLARVQLVGSLLSLECTVQGASSPYLYWYRQSLGGAPQLLFSSLSVTQIVPETPHNFTASRPQNGQFILSSKKLLLSDSGFYLCAWS
Canis lupus familiaris V233 igkv AAEX03010921.1 172448 CGGRHILTQFPETLAVSPDSFISITCQSRMDIGTSMAWYQQKPGEAPRLLIFGAYARAAGTPSRFQGSGSGSDFSLTIHGVEAEDMGVYYCQ
Canis lupus familiaris V234 igkv AAEX03010921.1 196972 SSGDIVMTQTPLSLSVSPGEPASISCRASQSLLHSNGNTYLYWFRQKPGQSPQGLIYLVSNRFSWVPDRFSGSGSGTDFTLRISRVEADDAGVYYCGQNLQFP
Canis lupus familiaris V235 igkv AAEX03010922.1 8324 SSGEVVMIQTPLSLSVSPGEPASISCRASQSLRHSNGNTYLYWYLQKPGQSPQLLIDLVSNHFTGVSDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQS
Canis lupus familiaris V236 igkv AAEX03010922.1 29799 ITGEIVMTQSPASLSLSQEEKVTITCRASQSVSSYLAWYQQKPGQAPKLLIYGTSNRATGVPSRFSGSGSGTDFSFTISSLEPEDVAVYYCQQYNSGY
Canis lupus familiaris V237 igkv AAEX03010922.1 46265 STGEAVMTQTPLSLAVTPGELATISCRASQSLLRSDGKSYLNWYLQKPGQTPRPLIYEASKRFSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQSLHFP
Canis lupus familiaris V238 igkv AAEX03010923.1 10460 SSGDIVMTQTPLSLSVSPGETASISCRANQSLLHSNGNTYLDWYMQKPGQSPQGLIYRVSNHFTGVSDRFSGSGSGTDFTLKISRVEADDAGVYYCGQG
Canis lupus familiaris V246 trgv AAEX03011201.1 283397 GAAGLKLEQTPVVVGRLGTLATLPCTVDTSVSYIHWYFHKEDTAPKRLLYLDMSRSYVQRDIFVKADKVNAKKGRNSYSCNLLLQKLEKNDEGVYYCAAWE
Canis lupus familiaris V247 trgv AAEX03011201.1 337916 GGAGLKLEQTPVVVGRLGTSATLLCTVDSSVYYIHWYFHKKFAAPKRLLYLDMSSSSVQRDTSVKAHKVNAKKGKDSYSCNLLVQKLEKSDEGVYYCAAWE
Canis lupus familiaris V248 trgv AAEX03011201.1 396891 GGAGLNLEQNPVAVERLDTLAILKCQVDTWVWYINWYFHQEGTAPKWLLYLDMSTGKVQRDAFVNADKVSAQKGKDSYSCALLVQRLRKSDEGVYYCAAWE
Canis lupus familiaris V249 trgv AAEX03011202.1 3623 GGAGLKLEQTPVVVVHLGTSATLPCTVDSSVNYIHWYFHREGIAPKRLLYIHTYSSSVQRDASVNMGKVNAKMDKNNYSCKLLVQKLEKSDEGVYYCAAWE
Canis lupus familiaris V250 trgv AAEX03011203.1 42114 GHAETRLEQPAVVVAREKSSASLLCTANVKASYIHWYRYQEGKGLQRLLHLAMFQSNVQWDSVLEADKVTAIETKDGYSCTLLVLKLEKSDEGMYYCAAWR
Canis lupus familiaris V251 trgv AAEX03011204.1 15800 TKADTLITQLMPSVIKKQGNTAFLECQIKTGAFKKNVYIHWYRQKPDQPLQRILYISSNENVVHEQGVSEERYEARKWKQDLPASLRIHRVNEADAGLYYCACWD
Canis lupus familiaris V252 trgv AAEX03011204.1 77956 GLGQVKLEQHEISVSRARDKSAHISCKVVTEDFNSEVIHWYRHKPDQEIEHLIMVQTSSTQASLDGRKNKLEASKNAVTSTSTLSINFLQEEDEAMYYCACWKG
Canis lupus familiaris V316 iglv AAEX03014800.1 942308 SWAQSVLTQPTSVSGSLGQRVTISCSGSTNNIGIVGASWYQQLPGKAPKLLVYSDGDRPSGVPDRFSGSNSGNSDTLTITGLQAEDEADYYCQSFD
Canis lupus familiaris V317 iglv AAEX03014800.1 966412 ADSQTVVTQKPSLSVSPGGTVTLICGLSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFPGSISGNKAALIITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V318 iglv AAEX03014801.1 35460 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQ
Canis lupus familiaris V319 iglv AAEX03014802.1 3596 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRGYVGWYQQLPGTGPRTLIYDNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSG
Canis lupus familiaris V320 iglv AAEX03014802.1 198271 FWAQSVLTQPPSVFRSLGQRVTISCTGSSCNVGRGYVIWYQQLLGTRPRTLIYGSSNQPSGVPNRFSGSRSGSTATLTISGFQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V321 iglv AAEX03014803.1 30365 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTLGRAPRTIIYRTSSRPSGVPNRFSGSISGNKAALTITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V322 iglv AAEX03014803.1 38814 CADSASLSVWVPGPEVTVSCTGSCFNIGRYSVSWLQQLPGTGPRTIIYYDRSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSYDSSLK
Canis lupus familiaris V323 iglv AAEX03014803.1 48724 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRGYVGWYQQLPGTGPRTLIYGNSNRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V324 iglv AAEX03014803.1 95171 ADSQTVVTQESSVSVSPVGTVTLTCGLSSGSLTTSNYTSWYQQTQGQSPRMLVYDTSSCPSEVPDHFSGSISGNKAALTITGAQPEDEADYYCGMHDVSGSS
Canis lupus familiaris V325 iglv AAEX03014803.1 129286 DSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTGNKPGWYQHTPGQAPRRIIYDTSSRPSGVPDRFSGSISENKAALTITEAQPEDEAAYHCSLYMSGGA
Canis lupus familiaris V326 iglv AAEX03014803.1 176140 SWVQPVLTQPPSVSGFLGQRVTISCTGSSSNILGNSVNWYQQLTGRGPRTVIYYDNNRPSGVPDQFSGSKSGNSATLTISGLQAEDETDYYCSTWDSRLRA
Canis lupus familiaris V327 iglv AAEX03014804.1 1342 SWAQSVLTQPASVSQSLGQRVTISCTGSSSNVGYNSYVSWYQQLPGTVPRTIIYYTNTRPYGVPDRFSGSKSGNSATLTIAGLQAEDEADYYCSTYDSSLSG
Canis lupus familiaris V328 iglv AAEX03014804.1 31996 SLSQLVLTQPPSLSASLGSTTRLTCTLSSGFSVGGYSIYWHQQKPGSTPWYLLYYYSSTELGPGVPSCFSGSKDTSANVGLLLISGLQPEDETDYYCAI
Canis lupus familiaris V329 iglv AAEX03014804.1 78592 SWAQSVLTQPASVSGSLGQRVIISCTGSSSSIGRGYVGWYQQLPGTGPRTLIYGISNLPPGVPNRFSGSRSGSTATLTIAELQAEDEADYYCSSWDRSLSA
Canis lupus familiaris V330 iglv AAEX03014804.1 105369 SWAQAVLTQPPSVSAALGQRVTISCTGSNTNIGSGYDVQWYQQLPGKSPKTIIYGNSNRPSGVPVRFSGSKSGSTATLTITGIQAEDEADYYCQSYDDNLD
Canis lupus familiaris V331 iglv AAEX03014804.1 117114 IDSQIVVTQEPSLSPGGTVLLTCGLSSGSVTTSNYSSWYQQTPGRAPRTIIYNTNSHPSGVPDRFSGSISGNKAALTITGAQPEDEADYYCVTEHGSGSS
Canis lupus familiaris V332 iglv AAEX03014804.1 149036 SWAQSVLTQPTSVSGSLGQRVTISCSGSTNNIGIVGASWYQQLPGKAPKLLVDSDGDRPSGVPDRFSGSKSGNSATLTITGLQAEDEADYYCQSFD
Canis lupus familiaris V333 iglv AAEX03014804.1 171024 ADSQTVVTQKPSLSVSPGGTVTLICGFSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFPGSISGNKAALTITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V334 iglv AAEX03014805.1 19256 SWAQSALTQTASMSGSLGQRVTVSCTGSSSNVGYRSYVGWYQQLPGTGPRTIIYNTNTRPSGVPDRFSGSISGSTATLTIAGLQAEDEADYYCSSYDSSLKA
Canis lupus familiaris V335 iglv AAEX03014806.1 5419 SWAQSVLTQPPSVSGFLGQRVTISCTGSSSNIGRGYVHWYQQLPGTGPRTLIYGISNRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V336 iglv AAEX03014806.1 28285 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTQGRAPRTIIYNTSSRPSGVPNRFSGSISGNKAALTITGAQPEDEADYYCSLYTGS
Canis lupus familiaris V337 iglv AAEX03014806.1 51695 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTIICYTNTRPSGVPDRYSGSKSGSTATLTISGLQAEDETDYYCTTCDSSLNA
Canis lupus familiaris V338 iglv AAEX03014808.1 27956 SWAQSVLTQPASVSGSLGQRVTISCTGSTNNIGGDNYVHWYQQLPGKAPSLLIYGDDNRESGVPERFSGSKSGSSATLTITGLQAEDEADYYCQSYDDSLN
Canis lupus familiaris V339 iglv AAEX03014808.1 80532 SWAQAVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTLIYGSSYRPSGVPDRFSGSSSGSSATLTISGLQAEDEADYYCSSYDSSLSG
Canis lupus familiaris V340 iglv AAEX03014808.1 123612 SWAQSVLTQPASVSGSLGQRVTISCSGRTNIGRFGASWYQQLPGKAPKLLVDSDGDRPSGVPDRFSGSKSGNSATLTITGLHAEDEADYYCLSIG
Canis lupus familiaris V341 iglv AAEX03014810.1 69725 SWAQSVLTQPASVTGSLGQRVTISCTGSSSNIGGYNVGWFQQLPGTGPRTVIYSSSNRPSGVPDRFSGSRSGSTATLTISGLQAEDEAEYYCSTWDSSLKA
Canis lupus familiaris V342 iglv AAEX03014810.1 71719 ADFQIVVTQEPSLSVSPGGTVTLTCGLSSGSVTISNYPDWYQQTPGRSPRMLIYNTNNRPSGVPNHFSGSISGNKAALTITGAQPEDEAYYYCAVYQGSGSS
Canis lupus familiaris V343 iglv AAEX03014810.1 87994 SWAQSVLNQPPSVSGSLGQRITISCSGSTNDIGMLGVNWYQQLPGNAPKLLVDGTGNRPSGVPDQFSGSKSGNSGTLTITGLQAEDEADYYCQSYD
Canis lupus familiaris V344 iglv AAEX03014811.1 29526 SWAQSVLTQPASVSGSLGQRVTISCTRSSSNVGYGNDVGWYQQLPGTGPRTIIYNTNTRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSYDSSLN
Canis lupus familiaris V345 iglv AAEX03014812.1 1524 SWAQSVLTQPASVSGVLGQRVTISCTGSSSNIGGNYVSWHQQVPETGPRNIIYADNYRASGVPDRFSGSKSGSTATLTISVLQAEDEADYYCSVGDDSLK
Canis lupus familiaris V346 iglv AAEX03014812.1 10929 SWAQSVLTQPPSVSGSVGQRITISCSGSTNSIGILGVNWYQLLSGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQPEDEADYYCQSIEPMLGA
Canis lupus familiaris V348 iglv AAEX03014814.1 46929 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRYSVGWFQQLPGKGPRTVIYSSSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Canis lupus familiaris V349 iglv AAEX03014814.1 57343 SWAQAVLTPLPSVSAALGQTVTISCTGNSTQISSGYAVQWYQQLPGKSPETIIYGDSNRPSGVPDRFSGFSSGNSATLAITGLQDEDEADYYCQSLDDNLN
Canis lupus familiaris V350 iglv AAEX03014814.1 83476 SWAQSVLTQPASVSGSLGQRITISCTGSSSNIGGNNVGWYQQLPGRGPRTVIYSTNSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDDSLSA
Canis lupus familiaris V351 iglv AAEX03014814.1 119147 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIDRKYVGWYQQLPGTGPRTVIYDNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Canis lupus familiaris V352 iglv AAEX03014814.1 126099 SWAQAVLTQPPSVSAVLGQRVTISCTGSSTNIGSGYDVQWYQQLPGKSPKTIIYGNSNRPSGVPDRFSGSKSGSTASLTITGLQAEDEADYYCQSSDDNLD
Canis lupus familiaris V353 iglv AAEX03014814.1 143337 SWAQSMLTQPASVSGSLGQKVTISCTGSSSNIGGNYVGWYQQLPGIGPRTVIYGNNYRPSGVPDRFSGSKSGSSATLTISGLQAEDEAEYYCSSWDDSLR
Canis lupus familiaris V354 iglv AAEX03014814.1 155417 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRDYVGWYQQLPGTRPRTLIYGNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDNS
Canis lupus familiaris V355 iglv AAEX03014814.1 176917 SWAQAVLNQPASVSGALGQKVTISCSGSTNDIDIFGVSWYQQLPGKAPKLLVDSDGDRPSGVPDRFSGSSSGNSGTLTITGLQAEDEADYYCQSVD
Canis lupus familiaris V356 iglv AAEX03014814.1 215235 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYSSSVGWYQQFPGTGPRTIIYYDSSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSWDNSLKA
Canis lupus familiaris V357 iglv AAEX03014816.1 10835 SWAQSVLTQLASVSGSLGQRVTISCSGSTNDIGIIGVNWYQQLPGKAPKLLIYDNEKRPSGIPDRFSGSKSGNSGTLTITGLQAEDEADYYCQSMDFSLG
Canis lupus familiaris V358 iglv AAEX03014816.1 26198 ADSQTVVTQEPSLSVSLGGTVTLTCGLSSGSVSTSNYPNWSQQTPGQAPRTIIYNTNSRPSGVPNRFTGSISGNKAALTITGAQPEDEADYYCALGLSSSSS
Canis lupus familiaris V359 iglv AAEX03014818.1 69546 SWAQSALTQPSSVSGTLGQTVTISCDGSSSNIGSSNYIEWYQQFPGTSPKLLIYYTNNRPSGIPARFSGSKSGNTASLTISGLQAEDEADYYCSAYTGSNT
Canis lupus familiaris V360 iglv AAEX03014818.1 121124 FVASYVVTQPPSVSVNLGQTASITCGGDNIASTYVSWQQQKSGQAPVTIIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAEDEADYYCQVWKSGNK
Canis lupus familiaris V361 iglv AAEX03014818.1 125990 SVASSVLTQPPSVSVSLGQTATITCSGESLSRYYAQWYQQKPGQAPMTVIYGDRERPSGIPDRFSSSSSENTHTLTISGAQAEDEAEYYCEIWDASAD
Canis lupus familiaris V362 iglv AAEX03014818.1 170314 SVASYVLTQLPSVSVNLGKTASITCEGNNIGDKYAYWYQQKPGQAPVLIIYEDSKRPSGIPERFSGSNSGNTATLTISGARAEDEADYYCQVWDNSAK
Canis lupus familiaris V363 iglv AAEX03014818.1 207967 SVASSVLTQPPSVSVSLGQTATISCSGESLSKYYAQWFQQKAGQVPVLVIYKDTERPSGIPDRFSGSSSGNTHTLTISGARAEDEADYYCESEVSTGT
Canis lupus familiaris V364 iglv AAEX03014818.1 214075 SVASYVLTQLPSVNVTLRQPAHITCGGDSIGSKSVHWYQQKLGQAPVLIIYGDSNRPSGIPERFSGDNSGNTATLTISGALAEDEAYYYCQVWDSSAQ
Canis lupus familiaris V365 iglv AAEX03014818.1 235255 SVASYVLTQLPSVSVTLRQTARITCGGDSIGSKNVYWYQQKLGQAPVLIIYDDSSRPSGIPERFSGANSGNTATLTISGALAEDEADYYCQVWDSSTK
Canis lupus familiaris V366 iglv AAEX03014818.1 258679 FCALPVLTQPPSASACLETSVKLTCTLSSEHSSYYIYWYQQQQPGKAPRYLMKVNSDGSHSRGDGIPSRFSGSSSGADRYLTISNIQSEDEADYYCGVPAGSS
Canis lupus familiaris V367 iglv AAEX03014818.1 269234 FVASYELTQPPSVNVTLRETAHITCGGDSIGSKYVQWIQQNPGQAPVVIIYKDSNRPTGIPERFSGANSGNTATLTISGALAEDEADYYCQVGDSGTK
Canis lupus familiaris V368 iglv AAEX03014818.1 335571 SVASYVLTQLPSMSVTLRQTARITCEGDSIGSKRVYWYQQKLGQVPVLIIYDDSSRPSGIPERFSGANSGNTATLTISGALAEDEADYYCQVWDSSTK
Canis lupus familiaris V369 iglv AAEX03014819.1 25384 FVASYVLSQPPSATVTLRQTARLTCGGDSIGSKSVEWYQQKPGQPPVLIIYGDSSRPSGIPERFSGANSGNTATLTISGALAEDEADYYCQVWDSSTK
Canis lupus familiaris V370 iglv AAEX03014820.1 11191 SVASYVLTQLPSVSVTLRQTARITCGGDSIGSKSVYWYQQKLGQAPVLIIYRDSNRPTGIPERFSGANSGNTATLTISGALAEDEADYYCQVWDSSTK
Canis lupus familiaris V371 iglv AAEX03014820.1 35771 LPVLTQPPSASASLEASVKLTCTLSSEHSSYYIYWYEQQQPGKAPRYLMRVNSDGSHSRGDGIPSRFSGSSSGADRYLTISNIQSEDEADYYCG
Canis lupus familiaris V372 iglv AAEX03014820.1 67052 SMASTGLNQAPSMLVALGQMETITCSGDILGKRYAYWYQHKPSQAPVLLINKNNERASGIPHWFSGSNSGNMATLTISGARAEDEADYYCQSYDSSGN
Canis lupus familiaris V373 iglv AAEX03014820.1 70553 SVASYVLTQLPSKNVTLKQPAHITCGGDNIGSKSVHWYQQKLGQAPVLIIYYDSSRPTGIPERFSGANSGNTATLTISGALAEDEADYYCQVWDSSAK
Canis lupus familiaris V374 iglv AAEX03014820.1 77845 SVASYVLTQSPSVSVTLGQTASITCRGNSIGRKDVHWYQQKPGQAPLLIIYNDNSQPSGIPERFSGTNSGSTATLTISEAQTNDEADYYCQVWESSAD
Canis lupus familiaris V375 iglv AAEX03014841.1 63241 FQPGLAQPDALLFFPGQVAQLSCMLSPRHATIGEYGVSWYQQRAGSAPRYLLYYRSEKDYHRSPDIPDRFSAATDAAHNACILTISPVQPEDDADYYCSVG
Canis lupus familiaris V456 iglv AAEX03019919.1 975 SWAQAVLTPLRSVSAALGQTVTISCTGNSPQIGSGYAVQWYQQLPGKSPETIIYGDSNRPSGVPDRFSGFSSGNSATLAITGLQDEDEADYYCQSLDDNLD
Canis lupus familiaris V457 iglv AAEX03020755.1 9110 SWAQAVLTPLPSVSAALGQTVTISCTGNSPQIGSGYAVQWYQQLPGKSPETIIYGDSNRPSGVPDRFSGFSSGNSATLAITGLQDEDEADYYCQSLDDNLD
Canis lupus familiaris V458 igkv AAEX03021072.1 5857 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSNGNTYLFWFRQKPGQSPQRLINLVSNRDPGVPHRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQAP
Canis lupus familiaris V459 igkv AAEX03021073.1 2058 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDTGVPDRFSGSGSGTDFTLRISTVEADDTGVYYCGQG
Canis lupus familiaris V460 igkv AAEX03021076.1 846 SSGDIVMTQNPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDTGVYYCGQGIQDP
Canis lupus familiaris V463 igkv AAEX03021909.1 9124 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDTGVYYCMQG
Canis lupus familiaris V464 igkv AAEX03021910.1 1617 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDTGVYYCGQGIQDP
Canis lupus familiaris V465 iglv AAEX03022012.1 2465 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQ
Canis lupus familiaris V466 iglv AAEX03022014.1 3774 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRGYVGWYQQLPGTGPRTLIYDSSSRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSAYDSSLSG
Canis lupus familiaris V467 ighv AAEX03023064.1 1197 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYNMGWVRQAPGKGLQWVAWIYDSGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Canis lupus familiaris V468 iglv AAEX03023209.1 3921 SWAPAVLTPLPSVSAALGQTVTISCTGNSTQIGSGYAVQWYQQLPGKSPETIIYGDSNRPSGVPDRFSGFSFGNSATLAITGLQDEDEADYYCQSLDDNLD
Canis lupus familiaris V604 trdv AAEX03005601.1 709478 KGVLCEQVIQSSLEQMVASGSKVTLLCTYDTSYSNPDLYWYRIRSDHSFQFILYRDNTQSRNADFTQGRFSVLHNPSQKTFHLVISQVEPEDSATYYCAID
Canis lupus familiaris V612 ighv AAEX03006126.1 269071 VQGEEQLVEFGGHMVNPGGSLGLSCQASGFTFSSYGMSWVRQAQKKGLQWVGHISYDGSSTYYADTLRDRFTISRDNTKNMLYLQMNSLRAEDTAVYYCMR
Canis lupus familiaris V613 ighv AAEX03006126.1 252641 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSSDMSWIRQAPGKGLQWVAYISNDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Canis lupus familiaris V614 ighv AAEX03006126.1 224842 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYHMSWVRQAPGKGLQWVAYINSGGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAS
Canis lupus familiaris V615 ighv AAEX03006126.1 172151 VQGEVQLVESGGDMVKPGGSLRLSCVASGFTFSSYYMYWARQAPGKGLQWVSHINKDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V616 ighv AAEX03006126.1 154007 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSNYMSWIRQAPGKGLQWVSQISSDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRDEDTAVYYCAR
Canis lupus familiaris V617 ighv AAEX03006126.1 144479 VLSELTLQESGPGLVKPSQTLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWMGYWTGSTNYNPAFQGRISITADTAKNQFSLQLSSMTTEDTAVYYCAR
Canis lupus familiaris V618 ighv AAEX03006127.1 2048 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSNYEMYWVRQAPGKGLEWVARIYESGSTTYYAEAVKGRFTISRDNAKNMAYLQMNSLRAEDTAVYYCAS
Canis lupus familiaris V619 ighv AAEX03006130.1 13942 VQAEVQLVETEGDLVKPGGSLRLSCVASGFTFSSYDMDWVYQAPGKGLQWVTYISNGGSSTRYADAVKGQFTISRDNARNTLYLQMNSLRDKDMAVYYCVS
Canis lupus familiaris V620 ighv AAEX03006130.1 4017 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYDMDWVRQAPGKGLQWLSEISSSGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Canis lupus familiaris V621 ighv AAEX03006132.1 54416 VQGEEQLVEFGGHMVNPGGSLGLSCQASGFTFSSYGMSWVRQAQKKGLQWVGHISYDGSSTYYTDTVRDRFTISRDNTKNMLYLQMNSLRAEDTAVYYCMR
Canis lupus familiaris V622 ighv AAEX03006132.1 23107 AAGGVWGDLVKPGGSLRLSCVASGFTFSSYYMSWVRQAPGKGLQWVGYINSGGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCGK
Canis lupus familiaris V623 ighv AAEX03006133.1 22569 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMFWIRQAPGKGNQWVGYINKDGSSTYYPDAVKGRFTISRDNAKNTLYLQMNSLTVEDTALYYCAR
Canis lupus familiaris V624 ighv AAEX03006135.1 27044 VQGEVQLVESGGDLVKPAGSLRLSCVASGFTFSSYSMSWVRQAPEKGLQLVAGINSGGSSTYYTDAVKGRFTISRDNAKNTVYLQMNSLRAEDTAMYYCAK
Canis lupus familiaris V625 ighv AAEX03006135.1 4738 VQCEVQLVESGGDLVKPEGSLRLSCVVSGFTFSSYDMSWVRQAPGKGLQWVAYISSDGRSTSYTDAVKGRFTISRDNAKNTLYLQMNSLRTEDTAVYYCAK
Canis lupus familiaris V626 ighv AAEX03006136.1 81600 VQGEVQLVESGGDLVKPEGSLRLSCVASGFTFSSFYMSWFCQAPRKGLQWVAEISSSGSSTSYADIVKGRFTISRDNAKNMLYLQMNSLRAEDMAVYYCAR
Canis lupus familiaris V627 ighv AAEX03006137.1 16305 VQGEVQLVESGGELVKPGGSLRLSCVASGFTFSSYYMSWIRQAPGKGLQWVADISDSGGSTYYTDAVKGRFTISRDNVKNSLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V628 ighv AAEX03006137.1 8708 MHSEVQLVQSGAEVKKPGASVKVSCKTSGYTFINYYMIWVRQAPGAGLDWMGQIDPEDGATSYAQKFQGRVTLTADTSTSTAYMELSSLRAGDIAVYYCA
Canis lupus familiaris V629 ighv AAEX03006140.1 159096 VQGEVQLVESGGDLAKPGGSLRLSCVASGLTFSSYSMSWVRQAPGKGLQWVTAISYDGSSTYYTDAVKGRFTISRDNARNTVYLQMNSLRAEDTAVYYCV
Canis lupus familiaris V630 ighv AAEX03006140.1 152074 VQGEVQLVESGEDLVKPGGSLRLSCVASGFTFSSSEMSWVHQAPGQGLQWVSWIRYDGSSSRYADTVKGRFTISRDNAKNTLYLQMNSLRAEDTAIYYCA
Canis lupus familiaris V631 ighv AAEX03006140.1 143005 QLLESGGDRVKPGGSQRLSCVASRFTFSSYSMHCLRQSPGMGLQWVTYISSNGSSTYYADAVKGRFTISRDKAKNMLYLQMNSLRAQDIALYYCADAVRG
Canis lupus familiaris V632 ighv AAEX03006140.1 137372 VQGEVQLVESGGDLVKPGGSLRLSCVTSGFTFSSYWMSCVRQAPGKELQWVAYINSGGSSTWYTDAVKGRFTISRDNAKNTLYLQMNNLRAEDTAVYYCAR
Canis lupus familiaris V633 ighv AAEX03006140.1 93766 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSNYDMSWVRQAPGKGLQWVAAISYDGSSTYYTDAVKGRFTISRDNARNTVYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V634 ighv AAEX03006140.1 63067 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMSWIRQAPGKGLQWVADISDSGGSTGYADAVKGRFTISRENAKNKLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V635 ighv AAEX03006140.1 47145 VQGEVQLVESGGDLVKPGGTLRLSCVASGFTFSSYDMSWVRQSPGKGLQWVAVIWNDGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V636 ighv AAEX03006140.1 27610 VQGEVQLVESGEDLVKPGGSLRLSCVASGFTFSSSEMSWVHQAPGQGLQWVSWIRYDGSISRYADTVKGRFTISRDNVKNTLYLQMNSLRAEDTAIYYCA
Canis lupus familiaris V637 ighv AAEX03006140.1 3522 VQSEVQLVESGGDLVKPVGSLRLSCVASGFTFSSYDMNWVRQAPGKGLQWVAYISSGGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAG
Canis lupus familiaris V638 ighv AAEX03006141.1 268184 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMYWVRQAPGKGLQWVARISSDGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAK
Canis lupus familiaris V639 ighv AAEX03006141.1 196682 VQSEVQLVESGGNLVKPGGSLRLSCVASGLTFYSYAIYWVHEAPGKGLQWVAAITTDGSSTYYTDAVKGRFTISRDNAKNTLYLQMNSLRAEDMPVYYCAR
Canis lupus familiaris V640 ighv AAEX03006141.1 172007 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSHAKSWVRQAPGKGLKWVAVISSSGSSTGSADTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V641 ighv AAEX03006141.1 121671 AAGGVWGNLVKPGESLRLSCVASGFTFSSYWMHWVCQAPGKGLGWVAIINSGGGSTYYADTVKGQFTIFRDNAKNMLYLQMNSLRAQDMTAYYCVS
Canis lupus familiaris V642 ighv AAEX03006141.1 102233 AQGEVQLVESGGDLMKPGGSLRLSCVASGFTISSNYMNWVRQAPGKGLQWVGYISSDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCVK
Canis lupus familiaris V643 ighv AAEX03006141.1 61464 AAGGVWGRPGEAWGSLRLSCVTSGFTFSSYAMHWVRQAPGKGLQWVAVISRDGSSTNYADAVKGRFTISRDNAKNMLYLQMNSLRAEDTAMYYCAK
Canis lupus familiaris V644 ighv AAEX03006141.1 53771 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSNDMDWVRQAPGKGLQWLTRISNDGRSTGYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V645 ighv AAEX03006142.1 14263 FQGEVQLVESGGDLVKPERSLRLSCVASGFTFSSFYMSWFCQAPGKGLQCVAEISSSGNSTSYADAVKGRFTISRDNAKNTLYLRMHSLRAEDTAVYYCAR
Canis lupus familiaris V646 ighv AAEX03006142.1 2522 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYAMSWVRQAPGKGLQWVAYINSGGSSTYYADAVKGRFTISRDNARNTLYLQMNSLRSEDTAVYYCPK
Canis lupus familiaris V647 ighv AAEX03006143.1 17419 VQGELQLVELGGDLVKPGGSLRLSCVASGFTFSSYAMSWVCQAPGKGLQWVAAISSSGSSTYHVDAVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Canis lupus familiaris V648 ighv AAEX03006145.1 71998 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMEWVRQAPGKGLQWVAQISSDGSSTYYPDAVKGQFTISRDNAKNTLYLQMNSLGAEDTAVYYCAK
Canis lupus familiaris V649 ighv AAEX03006145.1 13940 VQGEVPLVESGGELVKPEGSLRFSCVASGFTFSSYWISWVRQAPGKGLHWVSVINKDGSTTYHADAVKGRFTISRDNAKNTLYLQMNSLRAEGTTVYYCA
Canis lupus familiaris V650 ighv AAEX03006147.1 7331 VQGEVQLVESGGDLVKSGGSLRLSCVASGFTFSSYYMHWVRQATGKGLQWVTRISNDGSSTRYADAMKGQFTISRDNSKNTLYLQMNSQRAEDMALYYCAR
Canis lupus familiaris V651 ighv AAEX03006147.1 2045 VQGEVQLVESGGNLVKPGGSLRLSCVASGFTFSSYYMDWVRQAPGKRLQWVAGISSDGSSTYYPQAVKGRFTISRDNAKNTLYLQMNSLRAEDSAVYYCAM
Canis lupus familiaris V706 trbv AAEX03010196.1 238068 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHNAMYWYKQDLKQLLKIMFIYFNQGLNLNESVPGRFSPETSDKAHLNLHVDSLETGDSAVYFCASSL
Canis lupus familiaris V707 trbv AAEX03010196.1 234584 PMDTGIAQTPKHLVTGPGRRVTLNCEQHLGHDEVYWYQQSGQKPPKLKFAYRYKELIENETASGRFSPECPDSSRLYLHVDALEPNDSALYLCASSR
Canis lupus familiaris V708 trbv AAEX03010196.1 227435 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHNAMYWYKQDLKQLLNVMFIYNNKELILNESVPGRFSPETSDKSHLNLHVDSLETGDSAVYFCASSQ
Canis lupus familiaris V709 trbv AAEX03010196.1 223912 PMDTGITQTPKHLVTGPGRRVTLNCEQHLGHDAVYWYQQSGQKPPKLMFAYRYKELIENETASGRFSPECPDSSRLYLHVDALEPDDSALYLCASSR
Canis lupus familiaris V710 trbv AAEX03010196.1 215687 PMDTGITQTPKHLLTETGRRVTLKCEQHLGHNAVYWYQQSTQKPPKLMFAYSYKVLVENETASGRFSPECPDSSRFYLHMDALEPNDSALYLCASKE
Canis lupus familiaris V711 trbv AAEX03010196.1 203199 GPVESEVIQTPRHMIKARGQTVTLRCSLISGHLSVYWYQQALGQGPRFLIQYYNREERDKGDIPARFSVQQFSNYSSQLEMNSLEPGDSALYLCASSL
Canis lupus familiaris V712 trbv AAEX03010196.1 194399 SVPTGHAEPGVSQSPRHRVTKRGQNVSFTCDPISGHVVLYWYRQTMGQGPEFLVYFQNEEAMDESGLDKTRFSAKRPKGTRSTLQIQRAEQRDSAVYLCASS
Canis lupus familiaris V713 trbv AAEX03010196.1 178974 PVGAGVIQTPRHLIKGSGGKALLECHLVSGHNTVRWYKQAPGQGPQFLFEYYRQEQRDKGDVSARFSAQQFSDASSQLEMNPLELGDSALYLCASSL
Canis lupus familiaris V714 trbv AAEX03010196.1 174175 YMDAGIIQSPRYKVTGTGKRVTLRCHQTDNYDYMYWYRHDLGHGPRLIYYSNGINSTEKGDLSNGYTVSRSNKMDFPLLLDSVTSSQTSVYFCADSY
Canis lupus familiaris V716 trbv AAEX03010196.1 147346 HMGAMVIQSPRYQVTKVGKPVTLNCSQNLNHDTMYWYQQKLRQAPKLLLYYYDTELTKETDTSDNFQPSRLSNSLCSLSIRSPGLGDSAVYLCASSK
Canis lupus familiaris V717 trbv AAEX03010196.1 143752 TLNAKVMQTPGHLVKGKGQKAKMECVPIKGHSYVFWYQQIPAKEFKFLISFQDNAVFDKTGMPTQRFLAFCPKNSPCSLEIERTELQDSAVYFCASSE
Canis lupus familiaris V718 trbv AAEX03010196.1 133151 STNAGVTQNPRHLVRRTGQEAILTCSPEKGHSYFYWYQQFLGEGLKFMIYLQKETILDQSGMPKKRFSTEFSEDGLSILKIQPAELGDSAVYFCA
Canis lupus familiaris V721 trbv AAEX03010196.1 104136 SMDAGITQTPRNGIIKKGKNISLECSQIKSHNYMYWYRQDPGMGLRLISYSFGVNYINEGEVSNGYSASRTDLEKFSLSVGTAIPNQTALYFCASSD
Canis lupus familiaris V722 trbv AAEX03010196.1 98860 LMDGSVSQTPRHCISGTGKKITLECSQTMGYDNMYWYRQDPGKALQLLHYSYGVNTTEKAELSSGSTVSRLRKELFSLTLESTSLSQTSLYLCASSE
Canis lupus familiaris V723 trbv AAEX03010196.1 91994 LKDALVNQFPRHRILGTGKKLTLQCLQDMNHVSMFWYRQDPGFGLQLIYYSTGTDNFEKGDAPEGYDVSRNELKSFPLTLVSASTNQTSVYLCASS
Canis lupus familiaris V724 trbv AAEX03010196.1 73396 LLNAQVTQTPRQLIKKVGAKVLLKCSQNMDHERMFWYRQDPGLGLRLLYWSYNIDSVETGDIPYGYSVSRKKKDAFPLILESARINQTSVYFCASS
Canis lupus familiaris V725 trbv AAEX03010196.1 66862 SVFGALVSQKPRRDICQRGTSITIHCEVDTQVTLMFWYRQLPGQSLILIATANQGAEATYESGFTREKFPISRRTLMFSTLTVSNLSLEDTSSYFCSAR
Canis lupus familiaris V726 trbv AAEX03010197.1 2935 PMDTGITQTPKHLVTGPGRRVTLNCEQHLGHDAVYWYQQRAQKPPKLMFAYRYKELIENEPASGRFSPECPDSSRLYLHVDALEPDDSALYLCASSR
Canis lupus familiaris V737 igkv AAEX03010922.1 53321 VSGEIVMTQSPGSLAGSAGESVSINCKSSQSLLYSFNQKNYLAWYQQKPGERPKLLIYLASSWASGVPARFSSSGSGTDFTLTINNLQAEDVGDYYCQQHYSSP
Canis lupus familiaris V738 igkv AAEX03010923.1 226524 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSNGNTYLFWFRQKPGQSPQRLINLVSNRDPGVPHRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQAP
Canis lupus familiaris V739 igkv AAEX03010923.1 214203 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDTGVYYCMQG
Canis lupus familiaris V740 igkv AAEX03010923.1 204458 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDTGVYYCGQVIQDP
Canis lupus familiaris V741 igkv AAEX03010923.1 189914 SSGDIVMTQTPPSLSVSPGEPASISCKASQSLLHSNGNTYLNWFRQKPGQSPQGLIYRVSNRSTGVSDRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQDP
Canis lupus familiaris V742 igkv AAEX03010923.1 171283 SSGDIVMTQNPLSLSVSPGETASISCKASQSLLHSNGNTYLNWFRQKPGQSPQGLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCMQGIQAP
Canis lupus familiaris V743 igkv AAEX03010923.1 158342 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDTGVYYCGQGIQDP
Canis lupus familiaris V744 igkv AAEX03010923.1 151240 STGDIVMTQTPLSLSVSPGEPASISCKASQSLLHSNGNTYLYWFRQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQDP
Canis lupus familiaris V745 igkv AAEX03010923.1 139954 SGGDIVMTQTPPSLSVSPRETASISCKASQSLLHSDGNTYLDWYLQKPGQSPQLLIYLVSNRFTGVSDRFSGSGSGTDFTLRISRVEANDTGVYYCGQG
Canis lupus familiaris V834 iglv AAEX03014801.1 4521 FWAQSVLTQPPSVFRSLGQRVTISCTGSSCNVGRGYVIWYQQLLGTRPRTLIYGSSNQPSGVPNRFSGSRSGSTATLTISGFQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V835 iglv AAEX03014802.1 336661 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQ
Canis lupus familiaris V836 iglv AAEX03014802.1 324664 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRGYVGWYQQLPGTGPRTLIYDSSSRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSAYDSSLSG
Canis lupus familiaris V837 iglv AAEX03014802.1 301818 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTSPRTLIYDSSSRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSYDSSLSG
Canis lupus familiaris V838 iglv AAEX03014802.1 291581 SWAQAVLTPLPSVSAALGQTVTISCTGNSTQISSGYAVQWYQQLPGKSPETIIYGDSNRPSGVPDRFSGFSSGNSATLAITGLQDEDEADYYCQSLDDNLN
Canis lupus familiaris V840 iglv AAEX03014802.1 255628 SWAQSVLTQPTSVSGSLGQRVTISCSGSTNNIGIVGASWYQQLPGKAPKLLVYSVGDRPSGVPDRFSGSNSGNSATLTITGLQAEDEADYYCQSFD
Canis lupus familiaris V841 iglv AAEX03014802.1 238137 ADSQTVVTQKPSLSVSPGGTVTLICGLSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFTGSISGNKAALTITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V842 iglv AAEX03014802.1 155240 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRGYVGWYQQLPGTGPRTLIYDNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSG
Canis lupus familiaris V843 iglv AAEX03014802.1 132180 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTLIYRSSSRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSYDSSLSG
Canis lupus familiaris V844 iglv AAEX03014802.1 121962 SWAQAVLTPLPSVSAALGQTVTISCTGNSTQIGSGYAVQWYQQLPGKSPETIIYGDSNRPSGVPDRFSGFSSGNSATLAITGLQDEDEADYYCQSLDDNLD
Canis lupus familiaris V845 iglv AAEX03014802.1 80671 SWAQSALTQTASMSGSLGQRVTVSCTGSSSNVGYRSYVGWYQQLPGTGPRTIIYNTNTRPSGVPDRFSGSISGSTATLTIAGLQAEDEADYYCSSYDSSLKA
Canis lupus familiaris V846 iglv AAEX03014802.1 46821 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTQGRAPRTIIYNTSSRPSGVPNRFSGSISGNKAALTITGAQPEDEADYYCSLYTGS
Canis lupus familiaris V847 iglv AAEX03014802.1 28723 SWAQSVLTQPPSVSGFLGQRVTISCTGSSSNIGRGYVHWYQQLPGTGPRTLIYGISNRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V848 iglv AAEX03014804.1 209327 FWAQSVLTQPPSVFRSLGQRVTISCTGSSSNVGRGYVIWYQQLLGTRPRTLIYGSSNQPSGVPNQFSGSRSGSTDTLTISGFQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V849 iglv AAEX03014808.1 153500 SWAQSVLTQPTSVSWSLGQRVTISCSRSTNNIGIVGASWYQQLPGKAPKLLVDSDGDQLSGVPDRFSGSKSGNSANLTITGLQAEDKADYYCQSF
Canis lupus familiaris V850 iglv AAEX03014808.1 69793 SWTQSVLTQPASASGSLGQRVTVSCSSSTNNIGIIGVKWYQQIPGKAHKLLIYDNEKRPSGVPNRFSGSKSGDLSTLTINGLQGEDEADYYCQSMDFSLG
Canis lupus familiaris V851 iglv AAEX03014814.1 264711 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNHPSWYQQTQGKAPRMLIYNTNNRPSGIPNCFSGSISGNKASLTITGAQPEDETDYYCLLYMGSNI
Canis lupus familiaris V914 igkv AAEX03020278.1 8847 SSGDIVMTQTPPSLSVSPGEPASISCKASQSLLHSNGNTYLNWFRQKPGQSPQGLIYRVSNRSTGVSDRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQDP
Canis lupus familiaris V915 igkv AAEX03020281.1 576 SSGDIVMTQTPLSLSVSPGEPASNSCKASQSLLHSNGNTYLFWFRHKPGQSPQSLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEANDTGVYYCGQG
Canis lupus familiaris V917 igkv AAEX03020742.1 3336 SGGDIVMTQTPPSLSVSPRETASISCKASQSLLHSDGNTYLDWYLQKPGQSPQLLIYLVSNRFTGVSDRFSGSGSGTDFTLRISRVEANDTGVYYCGQG
Canis lupus familiaris V918 igkv AAEX03020744.1 6953 STGDIVMTQTPLSLSVSPGEPASISCKASQSLLHSNGNTYLYWFQQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQDP
Canis lupus familiaris V919 igkv AAEX03020746.1 15575 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSNGNTYLNWFRQKPGQSPQGLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCMQGIQAP
Canis lupus familiaris V920 igkv AAEX03020746.1 7167 SSGDIVMTQAPPSLSVSPGEPASISCKASQSLLHSNGNTYLYWFRQKPGQSPEGLIYKVSNRFTGVSDRFSGSGSGTDFTLRISRVEADDAGVYYCGQNLQFP
Canis lupus familiaris V921 iglv AAEX03021130.1 12523 ADSQTVVTQKPSLSVSPGGTVTLICGFSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFPGSISGNKAALTITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V922 iglv AAEX03021351.1 5670 CGHQKPSLSVSPGGTVTLICGLSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFPGSISGNKAALTITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V923 iglv AAEX03021584.1 1709 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTSPRTLIYDSSSRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSYDSSLSG
Canis lupus familiaris V924 iglv AAEX03021677.1 2882 ADSQTVVTQKPSLSVSPGGTVTLICGLSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFPGSISGNKAALIITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V925 iglv AAEX03021877.1 3396 FWAQSVLTQPPSVFRSLGQRVTISCTGSSCNVGRGYVIWYQQLLGTRPRTLIYGSSNQPSGVPNRFSGSRSGSTATLTISGFQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V927 iglv AAEX03022522.1 3143 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQ
Canis lupus familiaris V928 igkv AAEX03023381.1 6834 SSGDIVMTQTPLSLSVSPGETASISCKASQSLLHSDGNTYLNWFRQKPGQSPQRLIYKVSNRDTGVPDRFSGSGSGTDFTLRISRVEADDTGVYYCGQVIQDP
Canis lupus familiaris V929 igkv AAEX03023924.1 6600 SSGDIVMTQTPLSLSVSPGEPASISCKASQSLLHSNGNTYLFWFRQKPGQSPQRLIYKVSNRDTGVPDRFSGSGSGTDFTLRISTVEADDTGVYYCGQG
Canis lupus familiaris V930 igkv AAEX03024339.1 7400 SSGDIVMTQAPPSLSVSPREPASISCKASQSLLHSNGNTYLYWFRQKPGQSPEGLIYKVSNRFTGVSDRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQFP
Canis lupus familiaris V0 trgv AACN010003605.1 2890 GHAETRLEQPAVVVAREKSSASLLCTANVKASYIHWYRYQEGKGLQRLLHLAMFQSDVQWDSVLEADKVTAIETKDGYSCTLLVLKLEKSDEGMYYCAAWR
Canis lupus familiaris V1 ighv AACN010008160.1 870 VQGEVPLVESGGELVKPEGSLRFSCVASGFTFSSYWISWVRQAPGKGLHWVSVINKDGSTTYHADAVKGRFTISRDNAKNTLYLQMNSLRAEGTTVYYCA
Canis lupus familiaris V2 iglv AACN010009061.1 3652 SVASYVLTQPPSVTVTLRQTARITCGGDSIGSKNVYWYQQKPGQAPVLIIYSDSNRPTGIPERFSGSNSGNMATLTISGALAEDEADYYCQVWDSSAD
Canis lupus familiaris V3 igkv AACN010015891.1 1936 SSGDIVMTQTPLSLSVSPGEPASISCKASQSLLHSNGNTYLYWFQQKPGQSPQRLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCGQGIQDP
Canis lupus familiaris V4 trbv AACN010019242.1 1688 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHNAMYWYKQDLKQLLKIMFIYFNQGLNLNESVPGRFSPETSDKAHLNLHVDSLETGDSAVYFCASSL
Canis lupus familiaris V5 iglv AACN010019484.1 1830 FVASYVLSQPPSATVTLRQTARLTCGGDSIGSKSVQWYQQKPGQSPVLIIYGDSSRPSGIPERFSGANSGNTATLTISGALAEDEADYYCQVWDRSAK
Canis lupus familiaris V6 ighv AACN010021608.1 2047 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSNYMSWIRQAPGKGLQWVSQISSDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRDEDTAVYYCAR
Canis lupus familiaris V7 trgv AACN010029259.1 1855 GAAGLKLEQTPVVVGRLGTLATLPCTVDTSVSYIHWYFHKEDTAPKRLLYLDMSRSYVQRDIFVKADKVNAKKGRNSYSCNLLLQKLEKNDEGVYYCAAWE
Canis lupus familiaris V9 trav AACN010042052.1 1060 KSTQLLQQSPRSLSIQEGENFTTYCNFTSTFPSFQWYRQKPGAGPVHLMTLSKRGEVKKQKSLTALFGEARKDSSLLIIAAQPGDAAIYFCAGS
Canis lupus familiaris V10 iglv AACN010047757.1 1852 SWAQSVLTQPASVSGSLGQRVIISCTGSSSSIGRGYVGWYQQLPGTGPRTLIYGISNLPPGVPNRFSGSRSGSTATLTIAELQAEDEADYYCSSWDRSLSA
Canis lupus familiaris V11 ighv AACN010056149.1 367 VQGEVQLVESGGDLVKPEGSLRLSCVASGFTFSSFYMSWFCQAPRKGLQWVAEISSSGSSTSYADIVKGRFTISRDNAKNMLYLQMNSLRAEDMAVYYCAR
Canis lupus familiaris V12 trbv AACN010057730.1 2810 LMDGSVSQTPRHCISGTGKKITLECSQTMGYDNMYWYRQDPGKALQLLHYSYGVNTTEKAELSSGSTVSRLRKELFSLTLESTSLSQTSLYLCASSE
Canis lupus familiaris V13 trgv AACN010066267.1 1081 GGAGLKLEQTPVVVGRLGTSATLLCTVDSSVYYIHWYFHKKFAAPKRLLYLDMSSSSVQRDTSVKAHKVNAKKGKDSYSCNLLVQKLEKSDEGVYYCAAWE
Canis lupus familiaris V14 trbv AACN010071168.1 642 SVPTGHAEPGVSQSPRHRVTKRGQNVSFTCDPISGHVVLYWYRQTMGQGPEFLVYFQNEEAMDESGLDKTRFSAKRPKGTRSTLQIQRAEQRDSAVYLCASS
Canis lupus familiaris V15 trav AACN010073822.1 1433 QTHGDLVTQMEGQVTLSEEAFLTVNCNYSASGYLALFWYVQYLREGPQLLLKASRDKEKGSNKGLEATNDRSSRSFHLKKSSVQMSDSAVYYCALR
Canis lupus familiaris V16 ighv AACN010079090.1 2276 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYDMDWVRQAPGKGLQWLSEISSSGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Canis lupus familiaris V17 trbv AACN010083100.1 2125 SMDAGITQTPRNGIIKKGKNISLECSQIKSHNYMYWYRQDPGMGLRLISYSFGVNYINEGEVSNGYSASRTDLEKFSLSVGTAIPNQTALYFCASSD
Canis lupus familiaris V18 trgv AACN010088708.1 2207 GLGQVKLEQHEISVSRARDKTARISCKVITEDFNSEVIHWYRHKPDQEIEHLIMVQTSSTQASLDGRKNKLEASKNAVTSTSTLSINFLQEEDEAMYYCACWKG
Canis lupus familiaris V19 trav AACN010119741.1 460 VSSQELEQSPQSLIIQEGENFTINCHSSKPVYALHWYRQKNSEGLISLMILWENGEKSHEKTTATLNEKKQQSSLHITASQSSDSGIYFCAA
Canis lupus familiaris V20 iglv AACN010177893.1 1691 FCALPMLTQPPSASASLEASVKLTCTLSSEHSSYYIYWYQQQQPGKAPRYLMKVNSDGSHSRGDGIPSRFSGSSSGADRYLTISNIQSEDEADYYCG
Canis lupus familiaris V21 iglv AACN010181901.1 1046 FCAPPVLTQTPSASASLEASVKLTCTLSSEHSSYYITWYQQQQPGKAPRYLMKVNSDGSHSRGDGIPSRFSGSSSGADRYLTISNIQSEDEADYYCF
Canis lupus familiaris V22 trav AACN010198901.1 302 QTHGDSVNQTEGQVTLSEEAFLTMNCTFSTSWSPSLFWYVQYLGEGPKLLLKALTNKAKGSNKGFEATLDSSSKSFHLKKGSVEMSDSAVYYCAMS
Canis lupus familiaris V23 trav AACN010199067.1 402 QTHGDSVNQTEGQVILSEEAFLSINCTYSTTGSPTLFWYVQYLGEGPQLLLKAVRDKEKGSNKGFEATLDKTSRSFHLKKGSVQQSDSAVYYCALS
Canis lupus familiaris V24 trav AACN010211984.1 588 QTHGDSVKQMEGQVTLSEEASLTINCTFSTSTTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFHLKKGSVQMSDSAVYYCALS
Canis lupus familiaris V25 ighv AACN010230159.1 1149 VQGEVQLVESGGDLVKSGGSLRLSCVASGFTFSSYYMHWVRQATGKGLQWVTRISNDGSSTRYADAMKGQFTISRDNSKNTLYLQMNSQRAEDMALYYCAR
Canis lupus familiaris V26 trav AACN010233894.1 1138 GGSVLNVEQNPPWLHVQEGENTNFTCHFPSSNFYSLQWYRQEPAKSLKFLFTIALNGDEKEEGRVRATLNTREGYSSLYIKRSQPEDAAVYLCA
Canis lupus familiaris V27 ighv AACN010237511.1 112 VQGEVQLVESGGDMVKPGGSLRLSCVASGFTFSSYYMYWARQAPGKGLQWVSHINKDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V28 iglv AACN010242956.1 355 SWAQSVLTQPASVSGSLGQRVTISCTGSTNNIGGDNYVHWYQQLPGKAPSLLIYGDDNRESGVPERFSGSKSGSSATLTITGLHAEDEADYYCQSYDDSLN
Canis lupus familiaris V29 ighv AACN010260720.1 310 VQGEVQLVESGEDLVKPGGSLRLSCVASGFTFSSSEMSWVHQAPGQGLQWVSWIRYDGSISRYADTVKGRFTISRDNAKNTLYLQMNSLRAEDTAIYYCA
Canis lupus familiaris V30 iglv AACN010273216.1 824 SWAQAVLTPLPSVSAALGQTVTISCTGNSTQIGSGYAVQWYQQLPGKSPETIIYGDSNRPSGVPDRFSGFSSGNSATLAITGLQDEDEADYYCQSLDDNLD
Canis lupus familiaris V31 iglv AACN010283695.1 683 SVASYVLTQLPSMSVTLRQPAHITCGGDSIGSKSVHWYQQKLGQAPVLIIYGDSNRPSGIPERFSGDNSGNTATLTISGALAEDEADYYCQVWDSSAK
Canis lupus familiaris V32 iglv AACN010292595.1 924 SWAQSVLTQPTSVSWSLGQRVTISCSRSTNNIGIVGASWYQQLPGKAPKLLVDSDGDQLSGVPDRFSGSKSGNSANLTITGLQAEDKADYYCQSF
Canis lupus familiaris V33 iglv AACN010297306.1 211 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGSGYVGWYQQLPGTGPRTLIYNSSNRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSAYDSSLSG
Canis lupus familiaris V34 ighv AACN010338805.1 800 AAGGVWGRPGEAWGSLRLSCVTSGFTFSSYAMHWVRQAPGKGLQWVAVISRDGSSTNYADAVKGRFTISRDNAKNMLYLQMNSLRAEDTAMYYCAK
Canis lupus familiaris V35 iglv AACN010348433.1 161 SWAQSVLTQPASVSGSLGQRITISCTGSSSNIGGNNVGWYQQLPGRGPRTVIYSTNSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDDSLSA
Canis lupus familiaris V36 trdv AACN010348506.1 410 KGVLCEQVIQSSLEQMVASGSKVTLLCTYDTSYSNPDLYWYRIRSDHSFQFILYRDNTQSRNADFTQGRFSVLHNPSQKTFHLVISQVEPEDSATYYCAID
Canis lupus familiaris V37 trav AACN010407918.1 207 VVTGMKVEQSPSALSLQEGASCTLKCNYSSTPDNVQWFRQNPGGGSLTRLFYIASGMMQSGRLNCTLNAKERFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V38 iglv AACN010521330.1 568 SWAQSVLTQPTSVSGSLGQRVTISCSGSTNNIGIVGASWYQQLPGKAPKLLVYSDGNRPSGVPDRFSGSNSGNSATLTITGLQAEDEADYYCQSC
Canis lupus familiaris V39 trav AACN010527565.1 459 INGQEIKQNPQFLLLQEVEDFTIYCNSSSTLNGLQWYKQRPGDGPVLIKLFKGGEVKQKRRTAQLGETRKDSSLHKAASQTADAGTYFCAGSTVLS
Canis lupus familiaris V40 ighv AACN010532407.1 199 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSNYEMYWVRQAPGKGLEWVARIYESGSTTYYAEAVKGRFTISRDNAKNMAYLQMNSLRAEDTAVYYCAS
Canis lupus familiaris V41 ighv AACN010600279.1 310 VQGEVQLVESGGNLVKPGGSLRLSCVASGFTFSSYYMDWVRQAPGKRLQWVAGISSDGSSTYYPQAVKGRFTISRDNAKNTLYLQMNSLRAEDSAVYYCAM
Canis lupus familiaris V42 iglv AACN010604951.1 175 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRDYVGWYQQLPGTRPRTLIYGNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDNS
Canis lupus familiaris V43 iglv AACN010631726.1 232 SWAQSVLTQPASVSGSLGQRVTISCSGRTNIGRFGASWYQQLPGKAPKLLVDSDGDRPSGVPDRFSGSKSGNSATLTITGLHAEDEADYYCLSIG
Canis lupus familiaris V44 ighv AACN010639430.1 564 FQGEVQLVESGGDLVKPERSLRLSCVASGFTFSSFYMSWFCQAPGKGLQCVAEISSSGNSTSYADAVKGRFTISRDNAKNTLYLRMHSLRAEDTAVYYCAR
Canis lupus familiaris V45 iglv AACN010670406.1 24 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRYSVGWFQQLPGKGPRTVIYSSSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Canis lupus familiaris V46 ighv AACN010710858.1 107 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMYWVRQAPGKGLQWVARISSDGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V47 igkv AACN010731709.1 457 CGGRHILTQFPETLAVSPDSFISITCQSSIDIGTSMAWYQQKPGEAPRLLIFGAYARAAGTPSRFQGSGSGSDFSLTIHGVEAEDMGVYYCQ
Canis lupus familiaris V48 iglv AACN010741317.1 524 SVASYVLTQSPSVSVTLGQTASITCRGNSIGRKDVHWYQQKPGQAPLLIIYNDNSQPSGIPERFSGTNSGSTATLTISEAQTKDEADYYCQVWESSAD
Canis lupus familiaris V49 trav AACN010867175.1 291 QTHGDSVNQTEGQVTLSEVGFLTMNCTFSTSRTPTLFWYVQYLGEGPKLLLKAMTDKEKGSNKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALR
Canis lupus familiaris V50 iglv AACN010876560.1 433 SWAQSVLTQPASVSGVLGQRVTISCTGSSSNIGGNYVSWHQQVPETGPRNIIYADNYRASGVPDRFSGSKSGSTATLTISVLQAEDEADYYCSVGDDSLK
Canis lupus familiaris V51 iglv AACN010880802.1 245 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTLIYYSSSRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSYDSSLSG
Canis lupus familiaris V52 ighv AACN010990990.1 80 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSNYDMSWVRQAPGKGLQWVAAISYDGSSTYYTDAVKGRFTISRDNARNTVYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V53 iglv AACN011056936.1 202 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRGYVGWYQQLPGTGPRTLIYGISNRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V54 ighv AACN010000619.1 6434 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSSDMSWIRQAPGKGLQWVAYISNDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCA
Canis lupus familiaris V55 iglv AACN010006742.1 1543 SWAQAVLTQPPSVSAVLGQRVTISCTGSSTNIGSGYDVQWYQQLPGKSPKTIIYGNSNRPSGVPDRFSGSKSGSTASLTITGLQAEDEADYYCQSSDDNLD
Canis lupus familiaris V56 trav AACN010008918.1 3158 VVTGMKVEQSPSALSLQEGASCTLKCNYSSTPDNVQWFRQNPGGGSLTRLFYIASGMKQSGRLNCTLNAKERFSTLHVAASQLEDSATYLCAVE
Canis lupus familiaris V57 igkv AACN010015563.1 4336 SSGEVVMIKTPLSLSVSPGEPASISCRASQSLRHSNGNTYLYWYLQKPGQSPQLLIDLVSNRFTGVSDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQS
Canis lupus familiaris V58 iglv AACN010043674.1 2962 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTIICYTNTRPSGVPDRYSGSKSGSTATLTISGLQAEDETDYYCTTCDSSLNA
Canis lupus familiaris V59 ighv AACN010047870.1 879 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMFWIRQAPGKGNQWVGYINKDGSSTYYPDAVKGRFTISRDNAKNTLYLQMNSLTVEDTALYYCAR
Canis lupus familiaris V60 trbv AACN010058963.1 929 PVGAGVIQTPRHLIKGSGGKALLECHLVSGHNTVRWYKQAPGQGPQFLFEYYRQEQRDKGDVSARFSAQQFSDASSQLEMNPLELGDSALYLCASSL
Canis lupus familiaris V61 trbv AACN010059936.1 2587 LKDALVNQFPRHRILGTGKKLTLQCLQDMNHVSMFWYRQDPGFGLQLIYYSTGTDNFEKGDAPEGYDVSRNELKSFPLTLVSASTNQTSVYLCASS
Canis lupus familiaris V62 iglv AACN010064489.1 922 SWAQSVLTQPASVSQSLGQRVTISCTGSSSNVGYNSYVSWYQQLPGTVPRTIIYYTNTRPYGVPDRFSGSKSGNSATLTIAGLQAEDEADYYCSTYDSSLSG
Canis lupus familiaris V63 igkv AACN010088788.1 2106 SSGDIVMTQTPLSLSVSPGETASISCRANQSLLHSNGNTYLDWYMQKPGQSPQGLIYRVSNHFTGVSDRFSGSGSGTDFTLKISRVEADDAGVYYCGQG
Canis lupus familiaris V64 ighv AACN010091420.1 2703 VQGEVQLVESGGDLVKPGGSLRLSCVTSGFTFSSYWMSCVRQAPGKELQWVAYINSGGSSTWYTDAVKGRFTISRDNAKNTLYLQMNNLRAEDTAVYYCAR
Canis lupus familiaris V65 trdv AACN010124863.1 2322 SSMAQKVTQTQPEMFVQETETVILHCTYDTSNSDYYLFWYKQPPSREMILIIRQEVYRQDNATNNRFSVNFQKGNKSFSLKISDSRLEDAAMYFCVLAG
Canis lupus familiaris V66 trbv AACN010126447.1 1087 PMDTGITQTPKHLVTGPGRRVTLNCEQHLGHDAVYWYQQRAQKPPKLMFAYRYKELIENEPASGRFSPECPDSSRLYLHVDALEPDDSALYLCASSR
Canis lupus familiaris V67 iglv AACN010127126.1 878 SRAQSALTQPSSVSGTLGQTVTISCDGSSSNIGSSNYIEWYQQFPGTSPKLLIYYTNNRPSGIPARFSGSESGNTASLTISGLQAEDEADYYCSAYTGSNT
Canis lupus familiaris V68 igkv AACN010129916.1 654 ITGEIVMTQSPDSLSLSQEKKVTITCRASQSVSSYLAWYQQKPGQAPKLLIYGASNKATGVPSRFSGSGSGTDFSFTISSLEPEDVAVYYCQQYNSGY
Canis lupus familiaris V69 trav AACN010130514.1 1091 IRVQMKVEQSPGVLILQEGRNASMMCNYSIAVTSVQWFQQNHEGHLTSLLYIVSGMKQKGRLKFTVDTKERNSHLYITDSQPGDSVTYFCAVE
Canis lupus familiaris V70 iglv AACN010152354.1 1739 SWAQSVLTQPSSVSGTLGQRVTISCTGSSSNIGGDYGVNWYQQLPGKAPKTIIYASTNQPSGVPERFSGSRSGSSGSLSITGLQAEDEADYYCSAWDSKLSA
Canis lupus familiaris V71 trav AACN010159392.1 1577 VSSKQEVKQSPEALSVRERDSVVLSCNFTDSAIYSLQWFRQDPGKGLTLLLLMQSNQKEQTSGRIKVWLDMSSRQSTLYIAASQPSDSATYLCAV
Canis lupus familiaris V72 ighv AACN010189951.1 723 VQSEVQLVESGGDLVKPVGSLRLSCVASGFTFSSYDMNWVRQAPGKGLQWVAYISSGGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAG
Canis lupus familiaris V73 iglv AACN010191803.1 514 FWAQSVLTQPPSVFRSLGQRVTISCTGSSCNVGRGYVIWYQQLLGTRPRTLIYGSSNQPSGVPNRFSGSRSGSTATLTISGFQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V74 iglv AACN010192251.1 588 SWAQSALTQTASMSGSLGQRVTVSCTGSSSNVGYRSYVGWYQQLPGTGPRTIIYNTNTRPSGVPDRFSGSISGSTATLTIAGLQAEDEADYYCSSYDSSLKA
Canis lupus familiaris V75 trgv AACN010204501.1 688 TKADTLITQLMPSVIKKQGNTAFLECQIKTGAFKKNVYIHWYRQKPDQPLQRILYISSNENVVHEQGVSEERYEARKWKQDLPASLRIHRVNEADAGLYYCACWD
Canis lupus familiaris V76 trbv AACN010235157.1 901 PMDTGITQTPKHLVTGPGRRVTLNCEQHLGHDAVYWYQQSGQKPPKLMFAYRYKELIENETASGRFSPECPDSSRLYLHVDALEPDDSALYLCASSR
Canis lupus familiaris V77 trbv AACN010235917.1 504 TLNAKVMQTPGHLVKGKGQKAKMECVPIKGHSYVFWYQQIPAKEFKFLISFQDNAVFDKTGMPTQRFLAFCPKNSPCSLEIERTELQDSAVYFCASSE
Canis lupus familiaris V78 ighv AACN010240812.1 1100 VQGELQLVELGGDLVKPGGSLRLSCVASGFTFSSYAMSWVCQAPGKGLQWVAAISSSGSSTYHVDAVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Canis lupus familiaris V79 trav AACN010262514.1 1368 IMSETKTTQPNVMESTEEEPVHLPCNHSTISGNEYIYWYRQIPQQSPEYMIHGLKDNVTNGMATLIIAVDRKSSTLILPWITLRDAAVYYCIVKE
Canis lupus familiaris V80 ighv AACN010308334.1 348 VQGEVQLVESGGNLVKPGGSLRLSCVASGFTFSSYYMDWVRQAPGKRLQWVAGISSDGSSTYYPQAVKGRFTISRDNAKNTLYLQMNSLRAEDSAVYYCAM
Canis lupus familiaris V81 iglv AACN010315146.1 1067 SWAQSVLTQLASVSGSLGQRVTISCSGSTNDIGIIGVNWYQQLPGKAPKLLIYDNEKRPSGIPDRFSGSKSGNSGTLTITGLQAEDEADYYCQSMDFSLG
Canis lupus familiaris V82 iglv AACN010316312.1 531 SWAQSVLNQLPSVLGSLGQRITISCSGSTNDIGMLGVNWYQELPGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQ
Canis lupus familiaris V83 iglv AACN010389860.1 1269 FWAQSVLTQPPSVFRSLGQRVTISCTGSSCNVGRGYVIWYQQLLGTRPRTLIYGSSNQPSGVPNRFSGSRSGSTATLTISGFQAEDEADYYCSSWDSSLSA
Canis lupus familiaris V84 trbv AACN010497630.1 890 STNAGVTQNPRHLVRRTGQEAILTCSPEKGHSYFYWYQQFLGEGLKFMIYLQKETILDQSGMPKKRFSTEFSEDGLSILKIQPAELGDSAVYFCA
Canis lupus familiaris V85 iglv AACN010501304.1 832 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYSSSVGWYQQFPGTGPRTIIYYDSSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSWDNSLKA
Canis lupus familiaris V86 trbv AACN010525469.1 478 HMGAMVIQSPRYQVTKVGKPVTLNCSQNLNHDTMYWYQQKLRQAPKLLLYYYDTELTKETDTSDNFQPSRLSNSLCSLSIRSPGLGDSAVYLCASSK
Canis lupus familiaris V87 iglv AACN010531252.1 552 SWARSVLTQPPSVSGSVGQRITISCSGSTNSIGILGVNWYQLLSGKAPKLLVDGTGNRPSGVPDRFSGSKSGNSGTLTITGLQPEDEADYYCQSIEPMLGA
Canis lupus familiaris V88 trbv AACN010547586.1 568 LLNAQVTQTPRQLIKKVGAKVLLKCSQNMDHERMFWYRQDPGLGLRLLYWSYNIDSVETGDIPYGYSVSRKKKDAFPLILESARINQTSVYFCASS
Canis lupus familiaris V89 iglv AACN010599302.1 489 ADSQTVVTQKPSLSVSPGGTVTLICGLSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFPGSISGNKAALTITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V90 ighv AACN010601360.1 334 AAGGVWGDLVKPGGSLRLSCVASGFTFSSYYMSWVRQAPGKGLQWVGYINSGGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCGK
Canis lupus familiaris V91 iglv AACN010629634.1 886 SWAQAVLTQPPSVSAALGQRVTISCTGSNTNIGSGYDVQWYQQLPGKSPKTIIYGNSNRPSGVPVRFSGSKSGSTATLTITGIQAEDEADYYCQSYDDNLD
Canis lupus familiaris V92 iglv AACN010673739.1 705 CADSASLSVWVPGPEVTVSCTGSCFNIGRYSVSWLQQLPGTGPRTIIYYDRSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSYDSSLK
Canis lupus familiaris V93 iglv AACN010677327.1 392 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRYSVGWFQQLPGKGPRTVIYSSSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Canis lupus familiaris V94 igkv AACN010690535.1 737 SSGDIVMTQNPLSLSVSPGETASISCKASQSLLHSNGNTYLNWFRQKPGQSPQGLIYKVSNRDPGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCMQG
Canis lupus familiaris V95 ighv AACN010766547.1 544 VQGEEQLVEFGGHMVNPGGSLGLSCQASGFTFSSYGMSWVRQAQKKGLQWVGHISYDGSSTYYADTVRDRFTISRDNTKNMLYLQMNSLRAEDTAVYYCMR
Canis lupus familiaris V96 ighv AACN010813905.1 406 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSNDMDWVRQAPGKGLQWLTRISNDGRSTGYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Canis lupus familiaris V97 iglv AACN010864426.1 376 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTLIYDSSSRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCSSYDSSLSG
Canis lupus familiaris V98 iglv AACN010938679.1 646 ADSQTVVTQKPSLSVSPGGTVTLICGLSSGSVSTSNYPGWYQQTQGRASRTIIYSTSSRPSGVPNRFPGSISGNKAALTITGAQPEDEADYYCSLYMGS
Canis lupus familiaris V99 trav AACN010956490.1 365 TSDQEFQVTQPESSISVRAGEILTLGCNVSARSPAGPVLWFRENGQERRLIYNFNGSQFPRVTQVEDTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Canis lupus familiaris V100 ighv AACN010983823.1 421 VLSELTLQESGPGLVKPSQTLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWMGYWTGSTNYNPAFQGRISITADTAKNQFSLQLSSMTTEDTAVYYCAR