WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Physeter catodon AWZP00000000.1 (AWZP01) 49 4 4 6 17 13 2 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Physeter catodon V24 igkv AWZP01008127.1 6621 TTGEATLTQSPASLSLSPGKSATLTCRASQSVSSYLAWYQQEPGQAPRLLIYGASTRASGIPARFSGSGSGTDFTLTISSLEPEDVAVYYCYQYNSGY
Physeter catodon V37 trbv AWZP01010390.1 680 ASADTEITQIPKYLVMETRNKKSLRCEQHLGHNSMYWYKQSAQKPPELMFVYNYRKLASNETVPGRFQPECPDSSHFYLHVDSLKPEDSALYLCASSK
Physeter catodon V38 trbv AWZP01010391.1 13677 PGNAGVTQDPKFRVLRTGQSTTLKCAQDLDHYYMYWYRQDLGHGLRLIHYSSDTGTTNKGDAPKGYSVSRSNLENFPLTLASSTPSQTSVYLCASSY
Physeter catodon V39 trbv AWZP01010391.1 17942 PMDAAVTQKPRYHIIRAGNKMVLECSQHMNHLGMFWYRQDPGQGPRLIHYSNGVGSTGEGDVTEGYSVSRNKSEHFPLTLESASTKQTSLYLCASSE
Physeter catodon V40 trbv AWZP01010391.1 23678 VFPTGPLEAGVTHPPRHLIKTTGQTVTLRCSPISGHLNASWYQQALSQGPQFLSEFYENMQRAKGNFPGRFSAQPFRDARSELNVSSLELRDSALYLCARSL
Physeter catodon V41 trbv AWZP01010391.1 38984 PVEAGITQEPRYKITVTGETVTLKCHQTDSHEYMYWYRQDPGHGLRLTYYSYGAGNIEKGEIPDGYNVSRSNIEDFPLILESVIPSRTSVYFCASSD
Physeter catodon V42 trbv AWZP01010392.1 12428 PTDAGVTQTPRHAVTEMGHAVTLSCVPISEHTVLYWYRQTLGQGLEFLIYFNNQAPVDESGMPKDRFSAKMPNASFSTLKIQPTEPGDSATYLCASSK
Physeter catodon V43 trbv AWZP01010393.1 1511 HVGAMVIQTLGYLVTRTGKPVTPSCSQNLNHEVTSWYQQKLSQAPRLLFYYYDKEFNSEKDTSDNFQSSRPNTSFCSLGIRSAGLGDSAMYLCASS
Physeter catodon V44 trbv AWZP01010393.1 6013 FLEAEVSQPLGHLVQGKGQKVKMYCVPRKGHSYVYWYRQILAKEFKFLISFQNEKVLDETEMPKERFSAQCPRDSPCSLEIQPAELQDSAVYLCASSD
Physeter catodon V45 trbv AWZP01010394.1 19302 TVDGGVTQTPKYLFKVEGRDVTLKCEQDFDYNVMYWYRQDPGQGLRLIYHSQMVKDVRKGDIAEGYSASREKKSLFPLTLTSTQKNQTALYLCATNI
Physeter catodon V46 trbv AWZP01010394.1 24710 GSGLSASVSQQPSRAICKSGASVTIQCRSVGFQATTVFWYHQFPKQGLVLIATGNVGSDATYEQGYTKAKYPISHPDLTFSSLMVTNVHPADSSLYFCGAR
Physeter catodon V165 igkv AWZP01038611.1 11343 SSGDIVLTQTPLPLSVIPGDPASISCRSSQSLLDSDGDTYLNWYLQKPGQSPQLLIYEVSNRASGVPDRFTGSGSGTDFTLKISRVEAEDVGVYYCQQGMEYP
Physeter catodon V166 igkv AWZP01038611.1 19311 SSGDTVMTQTPLSLSVISVEAASISCKSSQSLVLSNGNTFLHWFLQKPGQTPQLLIYKVSNRDSGLSDRFSGSGSGTDFTLKISRVEAEDAAVYYCCQG
Physeter catodon V167 igkv AWZP01038612.1 11415 AERDIQMTQSPSSVSASLRERVTISCRASQSISKYLAWYQQKPGKAPKLLIYGASNLETGVPSRFTGSGSGTDFTLTINSLEAQDAATYYCQQYDEIP
Physeter catodon V168 igkv AWZP01038613.1 1058 SSGDIVMTQTPPTLSVIPGETASISCKSSQSLVHTDGNTYLNWLQQKPGQAPQRLIYKVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDAAVYYCYQG
Physeter catodon V242 trav AWZP01061558.1 523 SSVGQMVTQPQPEVSVQEALTVTLDCTYKTSESNYYLLWYKQPPSGEMIFIIGQEAYKQQNATNSRYSVNFQKEAKSFSLRISDSQLEDAAMYFCAYSG
Physeter catodon V243 trav AWZP01061558.1 4251 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSDSNYYLLWYKQPPSGEMIFIIGQESYKQQNATNSRYSVNFQKEAKSFSLRISDSQLEDAAMYFCAYSG
Physeter catodon V244 trav AWZP01061558.1 23770 VSGKNGVEQSPRYLSALEGDFVTINCSYSEEMTTLQWLQQNPGGGVVSVFILSLEMKKKGRVSATINRKERHSSLHITASQPRDSATYFCAVE
Physeter catodon V245 trdv AWZP01061562.1 2251 VYLDVILEAETKTLTVLLGEPATFRCSITGGELKTYQMSWYKKNENNSLTLVYRLSNNSNENERSNFKGKFDALKSQYIHDIQKTTVKDVGTYYCGSN
Physeter catodon V246 trdv AWZP01061564.1 3487 VMSAVTLVPQYQTRSVSVGESVTLRCSMKGESISNYYTFWYRKTPGSTMTFIYREGGTYGLGFKDNFQGEIDSLNNQAVLNILEASERDEGSYYCAST
Physeter catodon V288 trbv AWZP01073515.1 12624 VRAQTIHQWPLIRVQPAGSPLSLECTVKGTSNPSLYWYRQVAEGALQLLFYSISAEQINAEEPQKFEASRPQDGRFILSSKKLLLSNSGFYLCAWT
Physeter catodon V329 igkv AWZP01091312.1 2621 CWGQITLTQSPETLAASQGSFVSITCKSSMEVGTSMAWYQQKPKEAPKLLIFGASARASGTPSRFEGSGSGFDFSLAIHGVEAEDVGVYYCQ
Physeter catodon V330 ighv AWZP01092023.1 1265 VQCEAQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWISVISSSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Physeter catodon V332 iglv AWZP01092898.1 13189 SVASYELTQPPVVSVALEQTAKITCSGDLLDEKYTYWYQQKPGQTLQVIYKDSQRPSGITDRFSGSSSGKIATLTISRAKAEDEADYYCGSADSSGY
Physeter catodon V369 iglv AWZP01104947.1 979 VVLTQPRSVSGSLEQKVTISCTRSSGNIGSYYVHWYQQRPGSAPTTIIYKGDQRPSGVPIHFSGSIDTSSSAAYLTISGLQPEDEANYYCQSSYDSNK
Physeter catodon V370 iglv AWZP01104948.1 21632 SWAQAVLTQPRSVSGALGQRVTVSCSGSSSNIGSNYVSWYQQVPGTAPRLLIYENSERPSGVLDRFSGSKSGNSGSLTITGLQAEDEADYYCQSYDDSLD
Physeter catodon V372 iglv AWZP01104952.1 48773 SWAQSGLTQPPSVSGNPGQTVTISCAGTSSDIGDYNYVSWYQQRPGTAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLKAEDEADYYCGSITSSSS
Physeter catodon V512 trgv AWZP01030817.1 1546 GLGQLTWEQPEISVTGARHKSVVISCKVSSADFSKEYIHWYRHKPDQGIEHLAYVVTDPALLHLGEKKNKIEARKDIPTSTSTLKIKFLEKEDEATYYCARWFN
Physeter catodon V513 trgv AWZP01030820.1 9075 SHLEQPQLSSTKKLSKTARLECVVSGVTISEMSVYWYQERPGQAMQHLLHILSNNTVERQSDVTLGKFEADKIPETSTSTLTIHNVQEQDAATYYCALWK
Physeter catodon V628 trdv AWZP01061566.1 10247 KDVLCNQVTQISQEQIVASGSEVTLQCIFQTTYSDPDLYWYQIRPDGSFQFVLHRNNNNSHDADFARGRFSVQHSLTHKTFHLVISSVRPEDSATYYCALR
Physeter catodon V702 trav AWZP01081074.1 55833 GTNGDSVTQTEGPVTVSEGAPGTLHCTYQTSDPDPYLFWYVQYPNKAPQFLLKGSKANQRAEHEGFQATLVTSDSSFHLQKPSVQTSDSAVYYCALS
Physeter catodon V703 trav AWZP01081074.1 46510 LRGEDQVKQSPQTLKIQEGDSLILNCSYTVSNFRGLLWYRQDPGKGPELLFLLYSAGDEKQKGRLKATLLKKGSSLHIAAPKPEDSATYLCAVE
Physeter catodon V704 trav AWZP01081074.1 35968 GAGAQSVTQPDGHITISEGARLELRCNYSSSVPPYLFWYVQYPNQGLLLLLKYTSGNSLVSGIKGFEAEFRRSENSFHLRKTSAHWKDSAKYFCALS
Physeter catodon V705 trav AWZP01081074.1 20306 MSCQQLNQSPQFMSIQEGEDVSMNCNSSSTLNLLLWYKQDAGGGPILLITLYKAGELTRNGKLTAQFSGTRKDSFLNISASEPKDAGTYFCAG
Physeter catodon V706 trav AWZP01081074.1 15552 VSSDDKVIQSPPSLVVHEGTRATLNCSCKVTNFQSLHWYKQEEKAFTFLFILSSAGIEKKSGRLRGTLDRKELLSTLHITATKPGDSATYLCAAE
Physeter catodon V707 trav AWZP01081074.1 10635 PGRADWIRPQETEVSGTAGKTVSLLCNYYTSSMNFVDLYWYRQYPNQAPEYILYRGWGYSGKGYASFATERFHSENTANTTNLYIKRVLHSDTALYHCALR
Physeter catodon V708 trav AWZP01081076.1 1432 VNSQQGEENLQALSIQEGENATMNCSYKTSIDTLHWYRQDSRRGFAHLILIRSNEREKRSGRLRVTLDSSIKSSSLSITASQAADAATYLCATD
Physeter catodon V709 trav AWZP01081077.1 10268 GAGAQSVTQPDSHITVSEGARLELRCNYSSSSAPYLFWYVQYPNQGLQLLLKYTSGNNLVTGIKGFEAEFRKSETSFHLRKPSAHWSDSVEYFCALS
Physeter catodon V710 trav AWZP01081077.1 1211 GTRAQTVTQPEDHISVFEGSPVQVKCNYSYSGSPELFWYVQYPKQHLQLLLKHISRESIRGFTADLNKGEASFHLKKLSAQEEDSAVYYCALR
Physeter catodon V713 trbv AWZP01081792.1 13694 AMDAEIYQMRFLLAEAGQDVTLECKQNLSYYAMYWYRQDPGQGLRLIYYSTVEKDVQRGDISEGYSVSREEKGQFPLTVKAAHTNQTALYLCSGS
Physeter catodon V714 trbv AWZP01081793.1 848 CTDTKVTQSPGHLVKGKEQKAKMHCVPRKGHTHVYWYRKKLEEGFEFLVYLQSEDIVDDTDVFKQRFSAHCPQNSPCSLEVKSTEAADSALYFCASSQ
Physeter catodon V718 trav AWZP01082434.1 26562 VSLGEKVEQSPSTLTVQEGHSSVITCTYTDTALDYFLWYKKEPGKGPQRLIDIRSNTRKKELQRWSVLLNDKAKRLSLHISDTQPGDSAVYFCAAS
Physeter catodon V719 trav AWZP01082434.1 18891 SSISQKVTQDQPVILVQEKEVVTLDCIYDTNDFSYSLFWYKKPSSGAMILLIRQDSYNQQNATEGRYLLNFQKANKSIRLTISPSQLEDSAVYFCALSE
Physeter catodon V720 trav AWZP01082434.1 1249 VSGKNQVEQSPPSLTVLEGQNCTFQCNYTVSPFGNLRWYKQDTGRGLVSLIIMSYSDSKKSNGWYTATLDASAKHSSLHITAAQLSDPASYICVVG
Physeter catodon V721 trav AWZP01082435.1 2393 GTGAQSVTQPDGHITVSEGARLELRCSYSSSLPPYLFWYVQYPNQGLQLLLKYTSGNSLVSGIKGFKAEFRRSENSFHLEKQSALCSDSAKYFCALG
Physeter catodon V734 ighv AWZP01086220.1 40581 VLSQVQLQQRGPGLVKPSQTLTITCAVSGFSITTSSYYWSWIPQSPGKGLEWIGYIEYDGNTYYNPSFRSRISISRDTSKNQFSLQLRSVTTEDTAVYYCAR
Physeter catodon V735 ighv AWZP01086220.1 9991 VRCEAQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMSWVRQAPGKSLQWVSSINWDGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKG
Physeter catodon V736 ighv AWZP01086220.1 3455 VVSEVQLQESGPSLVKPSQTLSLTCTVSGFSLTSNAVAWVRQPPGKGLERVGVMWSDGSTGYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAG
Physeter catodon V738 trav AWZP01086350.1 145881 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF