WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Leptonychotes weddellii APMU00000000.1 (APMU01) 95 9 17 9 44 10 3 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Leptonychotes weddellii V178 igkv APMU01098581.1 2694 CDDTEPPSLPVSPGESVSISCRASQSIQRSNGNSYLNWYLQKPGQSPRLLIYTVSNRLTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Leptonychotes weddellii V180 trav APMU01099277.1 13359 SSTAQTVTQTQPDTRVRETETVTLHCTYDTSDSNYYLFWYKQPPSGEMILIIRQEAYKQENATKDRFSVNFQKPKKSFSLRISDSRLEDAAMYFCALIE
Leptonychotes weddellii V181 trav APMU01099278.1 5264 VSGKTGVEHRPQYLTAQEGDSVTINCSYSRGMTTLHWLQQNPGGGIVSLFILSLETKKKGRVRATVNTEELHSSLYITATQPRDSATYLCAVG
Leptonychotes weddellii V182 trav APMU01099281.1 18178 GSCRTEIIQSSDLAAMIGTDVTFQCQYNILDENYDSVYWYLQRADQRLTYINRTSQGTMESERYQLSVNRELSSSTLTIKHVQPRDKAIYYCAL
Leptonychotes weddellii V245 trbv APMU01125608.1 5411 PLNAGITQTPKFQVLGTGQSVTLECDQDTNHNFMYWYRQDRGHGLRLIHYSVSARTSEKGEVPDGYSASRSNIKNFLLKLLSTTPSQTSTYFCASSV
Leptonychotes weddellii V269 igkv APMU01132863.1 3390 CGGRLVLTQTPETLAASQDSFISITCRSSEEVGTSVAWYQQKPNEAPRLLIFGASARAAGTPFRFRGSGSGSDFSLTIHGVEAEDAGVYYCQ
Leptonychotes weddellii V270 igkv APMU01132864.1 2741 ASGNAGLTQSPAFLTVSPRESVSITCRANESISDYLSWYQQKPGQAPKLLIYDADNLMSGVPDRFSAIQSDTEFILKISTVEAEDAASYYCQQDYTV
Leptonychotes weddellii V271 igkv APMU01132864.1 9605 SSGEIVMTQTPLSLPVTPGESVSISCRASQSLLHSNGNTYLHWFRQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQNLQS
Leptonychotes weddellii V272 igkv APMU01132865.1 28718 SSGEVVMTQTPLSLPVTPGEPASISCRTSQSLLHSDGKSYLNWYLRKPGQSPQPLIYEAPKRFSGVPDRFSGSRSGTDFTLRISRLEAEDFGVYYCQQSIHVP
Leptonychotes weddellii V273 igkv APMU01132870.1 2785 ASGNAGLTQSPAFLTVSPRESVSITCRANESISDYLSWYQQKPGQAPKLLIYDADNLMSGVPDRFSAIQSDTEFILKISTVEAEDAASYYCQQDYTV
Leptonychotes weddellii V276 iglv APMU01133260.1 2420 QSVLTQPSSMSGTPGQRVTISCTGSSSNIGHGNYVSWIQQLPGKAPKTVIYGTSSRPSGVSDRFSGSRSGSSGTLTITGLQAEDEAEYYCST
Leptonychotes weddellii V320 ighv APMU01147754.1 2861 FQCEVQLVESGRDLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLQWVAGISSDGSSTCYADSVKGIHHLQRQWQEHSVSAHEQPESQGHGLYYCAK
Leptonychotes weddellii V321 ighv APMU01147762.1 5015 AAGGVWGRPGEALGSLRLSCAASGFTFSSYYMHWVCQALGRGLQWVAWIRYDGSSTSYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAMYYCAS
Leptonychotes weddellii V322 ighv APMU01147767.1 2188 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYYMYWVRQAPGKGLQWVAAISYDGSSTRYADSVKGQFTISRDNGKNTLYLQMNSLRTEDTAVYYCAK
Leptonychotes weddellii V335 trav APMU01155489.1 1933 TSVEDFQVTQPESSVSVRAGEILTLGCNVSARSPAGPVLWFRENGQERHLIYNFNGSQFPRVTQVENTEFNQTDYSIRISDVSPKDVGTYYCVKLTI
Leptonychotes weddellii V337 trgv APMU01156093.1 1527 TNADILITQLIPSITKKQGNTAFLECQIKTSGLRNNVYIHWYRQKSDQPLKRILYISSNENVVHEQGVSEERYEARKRQSDLPASLRIHQVNEEDAGLYYCACWD
Leptonychotes weddellii V340 iglv APMU01157438.1 2851 SWAQSVLTQPPSVSGALGQRVTISCTGSSSNIGGNSVSWIQQLPGKTPKTVIYWDNSRPSGVPDRFSGSKSGSSGTLTITGLQAEDEAEYYCSAWDSSLK
Leptonychotes weddellii V341 iglv APMU01157442.1 1296 SWAQSVLTQPSSVSRALGQTVTISCTGSSSNIGGGYYVNWLQQLPGKAPRTVIYGNSNRPSGVPERFSGSKSGSSGTLTITGLQAEDEAEYYCASWDDSLS
Leptonychotes weddellii V424 trdv APMU01043844.1 11433 SSNTDKVRQSQSAVSAEEGKSVTLDCSFTLNFNYYVMNWYHQPPHGKMTGIISMFSDTSSNREGRYKLSFQKGNKILKLTITGLMPEDTGIYFCAIGES
Leptonychotes weddellii V425 trav APMU01043848.1 7482 SSTAQTVTQTQPDTRVRETETVTLHCTYDTSDSDYYLFWYKQPPSGEMILIIRQEAYKQENATKDRFSVNFQKPKKSFSLRISDSRLEDAAMYFCALIE
Leptonychotes weddellii V427 trav APMU01043851.1 4810 IMSDAKTTPTNAMESTEEKPVHLPCNHSTISGNEYIYWYRQIPNQGPEYMIHGLKGNVTNGMATLIITTARESSTLILPRVTLGDTAVYYCMVRD
Leptonychotes weddellii V428 trav APMU01043852.1 22352 ESTQQLEQSPRFLSIQEGENFTAYCNSTSTFSSFQWYRQKPGEGPVHLVTLSKGGEMKKNKSLTTRFGEARKDSSLFISAAQPGDAAIYLCAG
Leptonychotes weddellii V429 trav APMU01043852.1 16432 VRVQMKVEQSPRVLILQEGRNASMICNYSVSMTSVQWFQQSPEGLFTSLSYIASGTQQKGRLKFTVNIKERNSRLYITDSQPGDSVTYFCAVV
Leptonychotes weddellii V430 trav APMU01043852.1 11100 VNSQQKGDKQQVKQTPSLTVQEGKISILNCDYNNDLFDYFLWYKKYPAKSPEFLISILSVMDKNEDGRFTVLLNKSAKRLSLHIAGSQPGDSALYLCAAS
Leptonychotes weddellii V431 trdv APMU01043852.1 1963 SSMAEKVIQTQETVIMQEGQAATIYCKYETSWSNYYTLYWYKQLPSREMAFLIYQDESKPNVKHGRFSVNFQKAAKSISLTISPLQLTDSAVYFCALGR
Leptonychotes weddellii V432 trav APMU01043853.1 8014 VGSVLNVEQNPPWLHVQEGENTNFTCRFPSSTFYSLHWYRWEPAKSPTFLFSVSLNGDEKKKGRVKTTLNTQEGYSSLYIEGSQPEDAVIYLCAM
Leptonychotes weddellii V433 trav APMU01043853.1 693 INGQEIKQNPQFLLLQEGEGFTIYCNSSITLNSLQWYKQRPGGGPVLLITLLKGEVKQERLTARFGETRKDSSLHMEASQTADAGTYFCAGHSALR
Leptonychotes weddellii V434 trav APMU01043854.1 10115 GTRAQAVTQPDAHVTVPEESPLELRCNYSSFRPSLYWYVQHPNQGLQLLLQYVSGNTKVQGPKGFEAEFKDSETSFHLKKPSAHWNDSAVYFCAVS
Leptonychotes weddellii V435 trav APMU01043855.1 40382 GTGAQTVTQPEDRISVFEGNFVQVKCNYSYSGSPVLFWYVQYPKRGFQLLLKHISGESIKGFTASLNRDETSFHLKKQSAQEEDSAMYYCALR
Leptonychotes weddellii V436 trav APMU01043855.1 30039 GASGDTVTQTEGSVTLHEGTSLTLNCTYQSSYSVFAFWYVQYPNKGPELLLKSSSENQRVEHHGFQAVLKSDKSFHLEKHSVQMSDSAVYYCVLG
Leptonychotes weddellii V437 trav APMU01043855.1 18016 SSMTQKVTQAQPAISMLENEAVTLDCVYEVSGSSYYLFWYKQPPSGEMIFLIHQESYREQNATEGRYSLNFQKSDRSISLTITALQPVDSAVYFCALR
Leptonychotes weddellii V438 trav APMU01043855.1 3527 VSSKQEVKQIPEALNICERDSVVLNCSYTDGALYSLQWFRQDPRKGLTFLLLIQSNQRELTSGRIKVSLDTSARQSALHIAASEPSDSATYLCAV
Leptonychotes weddellii V439 trav APMU01043856.1 5838 MRSQQKGVEQSPGSLSVLEGATASLNCNYSDSASQYFTWYRQYSGKGPKLLMYMHSKGDKKEGRFWGQVDTAKQYVSLLIRDSQPSDSATYLCAV
Leptonychotes weddellii V440 trav APMU01043856.1 2287 GTGAQSVTQPDAHVTVSEEAFLELRCNYSYGGAPYLYWYVQHPNQGLQLLLQYVSGNTKVQGPKGFEAEFKDSETSFHLKKPSAHWNDSAVYFCAVS
Leptonychotes weddellii V441 trav APMU01043857.1 9668 QTHGDSVTQTEGPVTLSEEAFLTINCTYSTTGYPTLFWYVQYPGEGPELLLKALRDKEKGSKKGFEATLDSKSKSFHLQKGSVQASDSAVYYCVMS
Leptonychotes weddellii V442 trav APMU01043857.1 388 QTHGDSVTQMEGPVTLSEEDSLTINCTYSITGYPTLFWYVQYPGEGPELLLKASRDKETKHNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCVMN
Leptonychotes weddellii V443 trav APMU01043858.1 1513 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSVSVYFPWYKQEFGKGPQLLIYIRSTMATKEDQRLTVFLNKKAKHLSLHIKDTQPEDSAVYFCAA
Leptonychotes weddellii V444 trav APMU01043860.1 4311 QTHGDSVTQLEGSVTLSEEASLTVNCTYSTIWSPTLFWYVQYPGERPELLLKASRDKETKHNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCVMS
Leptonychotes weddellii V445 trav APMU01043864.1 1912 VRGMNVKQSPSTLSLQEGASSTLKCNFSDILNSVQWFRQNPEGGGLTRLFYVASGMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAAQ
Leptonychotes weddellii V446 trav APMU01043865.1 3047 QTHGDSVTQTEGQVTLLEEASLTINCTYSTIGYSTLFWYVQYPGEGLHLLLSSSRDQEKKSKEGFEATFDSKSKSFHLEKGSVQTSDSAVYYCALS
Leptonychotes weddellii V447 trav APMU01043866.1 4473 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSASDYFPWYKQEFGKGPQLLIYIRSTMATKKDQRLTVFLNKMAKHLSLHIADTQLEDSAVYFCAA
Leptonychotes weddellii V448 trav APMU01043867.1 9198 QTHGDSVTQLEGPVTLSEKAFLTINCTYTTTSYPTLFWYVQYPGEGPELLLKALRDKEKGSKKGFEATFDSKSKSFHLEKGSVQASDSAVYYCALS
Leptonychotes weddellii V449 trav APMU01043867.1 5848 QTHEDSVTQTEGQVTLLEEASLTVNCTYSTTGSPTLFWYVQYPGEGPELLLKALRDKEKGSKKGFEATFDSDSKSFHLEKGSVQASDSAVYYCVMS
Leptonychotes weddellii V450 trav APMU01043867.1 1477 VRGLEVEQSPSALSLQEGASSTLKCSFSSTVNSVQWFRQNPEGGGLTRLFYVASGMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAVE
Leptonychotes weddellii V451 trav APMU01043868.1 503 VRGMEMEQIPSALSLQEGASSTLKCNFSSRVNSVQWFRQNPEGGGLTRLFYITSGMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAVE
Leptonychotes weddellii V452 trav APMU01043871.1 5424 VRGMEMEQIPSALSLQEGASSTLKCNFSSRVNSVQWFRQNPEGGGLTRLFYITSGMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAVE
Leptonychotes weddellii V453 trav APMU01043872.1 3314 QTHGDSVTQTEGQVTLLEEASLTVNCTYSTTWSPTLFWYVQYPGEGPELLLKALRDKEKGSKKGFEATFDSKSKSFHLEKGSVQASDSAVYYCVMS
Leptonychotes weddellii V454 trav APMU01043874.1 12386 QTHGDSVTQTEGQVTLSEKAFLTVNCTYSASGYPALYWYVQYPGEGPELLLKASRDKEKGSKKGFEATYDRDSKSFHLQKGSVQATDSAVYYCVMS
Leptonychotes weddellii V455 trav APMU01043874.1 1339 VRAMKVEQSPSALSLQEGASSTLKCNFSSTPDSVQWFQQNFGGGGLTRLFYIASGMKQSGRLNCTVNAKEQSSTLHLTDSQLEDSATYLCAVE
Leptonychotes weddellii V456 trav APMU01043876.1 15520 QTHGDSVTQLEGPVTLSEEAFLTVNCTYTVATSYPTLFWYVQYPGEGPELLLKASRDKEKGSKKGFEATYDRDSKSFHLQKGSVQASDSAVYYCAVS
Leptonychotes weddellii V457 trav APMU01043876.1 5428 VRGLEVEQSPSALCLPEGASSTLKCNFSSTVNNVQWFRQNPRGGGLTSLFYIASGMKQSGRLNCTVNAKERSSTLRITASQLEDSATYLCAAQ
Leptonychotes weddellii V458 trav APMU01043877.1 998 FSQGEKVEQHPSTLSVQQGSSSVINCSYSDSTSIYFLWYKQELRKGPQLLIDIRSSMATKEDQRLTVFLNKMAKHLSLHIKDTQPEDSAVYFCAA
Leptonychotes weddellii V459 trav APMU01043883.1 33556 GLRAQSVSQPDQVTVAEGDPLTVNCTYSVSGSPYLFWYVQYPNQGLQFLLKYITGNNLVKGSYGFEAEFNNSQTAFHLKKPSVLWSDSAVYFCAVA
Leptonychotes weddellii V460 trav APMU01043883.1 19335 GTRAQSVTQPDAHVTVSEEAALELRCNYSSVVQPYLYWYVQYPNQGLQLLLQYFSGDTLVKGIKGFEAEFRKTETSFHLRKPSAHGSDAAKYFCAVS
Leptonychotes weddellii V461 trav APMU01043883.1 17158 VRGMEVEQRPSALSLQEGASSTLKCNFSQTASSLQWFRQNPWGGGLTQLFYIASGMKQSGRLNCTVNAKERSSTLHITASQLEDSATYLCAAQ
Leptonychotes weddellii V462 trav APMU01043883.1 11652 MSKGEEVQQHPSFLTIWEGDSFVINCTYTDSASDYFFWYKQEPGKGLQLLIYTLSNVVKKQEQRLTVLFNKKDKHLSLHDTATHPGDSATYFCATR
Leptonychotes weddellii V548 trgv APMU01086058.1 6289 GLGQVKLEQPEISISRARDKSAHISCKVSAKDFNDEVIHWYRQKPDQEIEHLTYIQESSVQVSLGGKKNKLEASKNTHTSTATLNVNFLKQEDEAMYYCACWID
Leptonychotes weddellii V549 trgv APMU01086071.1 8031 GGAGLKLDQPALVVVRLPLESSATLQCKVDTSVSYVHWYRHQEGTAPKRLLYLDMSRSYVQRDFPMKADKVNAKKGRESNSCILSVLKLEKRDEGVYYCAAWE
Leptonychotes weddellii V550 ighv APMU01086663.1 2986 VLSQLTLQESGPGLVKPSQTLSLTCVVSGGSVTSSYYWNWIRQRPGRALEWMGYWTGSTRYNPAFQGRISITADTSKNQFSLQLSSVTTEDTAVYYCAR
Leptonychotes weddellii V551 ighv APMU01086664.1 7938 VQSEVQLVESGGDLVKPGGSLRLSCAASGFTFSDYGMGWVRQAPGKGLRWVAAISYDGSSTSYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAT
Leptonychotes weddellii V552 ighv APMU01086664.1 2874 VQSEVQLVETGGDLVKPGGSLRLSCAASGFTFSSYYMSWVHQAPGKGLQWVAWISYDASSTSYTDSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAT
Leptonychotes weddellii V553 ighv APMU01086669.1 5968 VQCEVQLVESGGDLVKPRGSLRLSCGASGFTFSSNNMSWVCQAPGKGLQWVAGINNTGGSSYYTDSGRFTISRDNGKNTLYLQMKSLRAEDITVYYCAR
Leptonychotes weddellii V554 ighv APMU01086684.1 1632 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYCMSWVRQAPGKGLQWVAVISYNGSSKRYADSVKGQFTISRDNVKNTLYLQMNSLRAEDTAVYYCAK
Leptonychotes weddellii V590 igkv APMU01098581.1 11148 STGDIVLTQSPGSLTMFPGQRATISCKASQKVSDIWGITHYMTWYPQKSGQRPKVLIYKASSRESGVPARFSGGGSGTDFSLTVDLVEAGDAANYYCLQGRRLL
Leptonychotes weddellii V592 trdv APMU01099284.1 44148 KGVLCDQVTQSPPDQTVASGSKVTLLCTYSTTQSNPDLYWYRIRPDRSFQFILYRDNTESQNADFTQGRFSVLHNRSQRTFHLVISPVEPEDSASYYCSMD
Leptonychotes weddellii V598 iglv APMU01100838.1 13042 SMAAYVLTQPRSMSVSLGQTARITCGGDNIGSKNAYWYQQKPGQAPVTIIYADSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCHVWDSNAD
Leptonychotes weddellii V599 iglv APMU01100839.1 383 SVASYELTQPPSVCVTLGQTARITCGGNNIGSKNVSWYQQKPGQAPVMIIYGDSSRPSGIPDRFSGSNSGNTATLTISGARAKDEADYYCHVWDSNAD
Leptonychotes weddellii V622 trbv APMU01110859.1 83956 LMDASVSQTPRHCVSGTGKKIALNCSQTMGYDNMYWYRQDPGKALQLIHYSYGVNTTEKTEFSSGSTVSRIKKEDFPLTLESASPSQTSLYFCAISE
Leptonychotes weddellii V623 trbv APMU01110859.1 70160 PMEAEVTQTPRYFITGTGRQLTLHCFQDMNHDAMYWYRQDPGLGLKLIYYSRNVEFVEDGDVPHGFTVLQKEKKNFPLTLKSAGTNQTSLYLCASSE
Leptonychotes weddellii V624 trbv APMU01110859.1 55057 SVFSALLSQKPRRDIRQRGTSLTIQCVADTQPISMFWYRQLPGQSLILIATANQNVEATYESGFTKDKFAISGPISKSSNLTVNNLSLEDSSFYFCSAR
Leptonychotes weddellii V625 trbv APMU01110861.1 51555 HMDAGITQSPRYEIARTGKKVTLRCHQTENYDYMYWYRQDLGHGLRLIYYSIDIGRIEKGEVSDGYNVSRSNMEDFQLTLLSVASSQTSVYFCANS
Leptonychotes weddellii V627 trbv APMU01110861.1 32083 HMGAMVIQSPRYQVTSVGKLVNLSCSQNLNHENMYWYQQKLSQAPKLLLYYYNTNLNREADTSDNFQSTQSNNSFSSLSIHSPGLGDSAVYLCASSK
Leptonychotes weddellii V628 trbv APMU01110861.1 28125 TLNAEVTQTPGHLVKGKGQKAKMYCVPIKGHRYVFWYQQIPAKDFKFLTSFQDGIIFDKTGMPEKRFLAVCPQNSNCSLEIKPTELQDSAVYFCASSE
Leptonychotes weddellii V629 trbv APMU01110861.1 16768 PMNAGVTQNPRHLVRRTGQAANLTCSPERGHSYFYWYQQPLGEGLKFMVSLQDEKTIDNSGMPKNHFSTMFSKEGFSILNIQMAELGDSAVYFCASSL
Leptonychotes weddellii V630 trbv APMU01110861.1 10361 SGLGALVSQDPRAVICKSGASVRIQCRAVDFEAYTVFWYRQLPTQGLTLMATSKAGSDVTHERDFPAAKFPIKHVNLTFFTLKVTSASPADSSLYFCGAS
Leptonychotes weddellii V631 trbv APMU01110863.1 1655 SMDTGVTQIPKHLVTGTGRKVTLECKQNLGHNAMYWYKQSAQKPPKLMFAYNGNDLFQNETASSRFSLQRPKTSELDLHVSPVEPEDSAVYLCASSK
Leptonychotes weddellii V672 iglv APMU01124706.1 1678 SQPGLAQPDALLVFPGQVAQLSCMLSPRHATVGEYGVSWYQQRAGSAPRYLLYYRSEDNYHRPPDIPDRFSAATDAAHNACILTISPVQPEDDADYYCSVG
Leptonychotes weddellii V701 iglv APMU01132369.1 5292 TSSQAVVTQETSMTVFPGGTVTLTCASNTGAVTNAHYPYWFQQKPGQSPRTLIFNTNSKHSWTPARFSGSLLGGKAALTLTGAQPEDEAEYHCWLVYDGV
Leptonychotes weddellii V702 iglv APMU01132370.1 7613 ATSQAMVTQETSLSMSPGGTVTITCGSSTRAVTTSNHVSWVQQKPYQVPQGLISSTSNLNPGVPARFSSSLVGQKAALTITGAQTEDEAQYYCALWYSNY
Leptonychotes weddellii V703 iglv APMU01132371.1 3632 TSSEAVVTQEPSLTVSPGETVSLTCASSYGAVSNLHYPAWFQQKPGQSPRTLIYNAYNKHSWTPARFSGSLLGGKAVLTLTGAQPEDEAEYYCFLQYGDG
Leptonychotes weddellii V704 iglv APMU01132375.1 3776 SRAQYVMIQPPSVSGALGQSVTISCKGIPENIEIDNSVSWYQQLPGKTPKLLNYDDDKRHTGVPNRFSSSKSGSSASLTITGLQAEDEADYYCQSYDLSFD
Leptonychotes weddellii V705 iglv APMU01132391.1 34015 SLSQPVLTQPPSLSASPGTTARPTCTFSSGFNVGSYQTYWYQQKPGSPPRYLLRFYSDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQTEDEADYYCAM
Leptonychotes weddellii V706 iglv APMU01132391.1 27614 SWAQSVLTQPPSVSCALSQRVTISCTGSSSNLGAYALNWYQQLPGTDSNLLIYDKRNCPSSMPHHFCGSKSRSSGSLTITGLRAEAKADYYCQCYYSPLH
Leptonychotes weddellii V707 iglv APMU01132391.1 13855 SWAQSVLTQPPSVSGALGQKVTISCSGSSYNSILGVNWYQQLPGKAPKLLIYGGSNRPSGVPERFSGSKAGDSGSLTINGLQAEDEADYYCQSFDPSLS
Leptonychotes weddellii V710 igkv APMU01132866.1 5610 VSGDIVMTQSPGNLTKAVRESVAINCKSSQSLLYSSNQKNYLVWYQQKPGQAPKLLMYWASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVGYYYCQQHYSYP
Leptonychotes weddellii V711 igkv APMU01132866.1 1886 STGDIVLTQSPGSLTMFPGQRATISCKASQKVSDIWGITHYMTWYPQKSGQRPKVLIYKASSRESGVPARFSGGGSGTDFSLTVDLVEAGDAANYYCLQGKEAP
Leptonychotes weddellii V746 trav APMU01146392.1 7568 PHAQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Leptonychotes weddellii V765 iglv APMU01150948.1 5572 SMASYVLTQPRLMSVNLGQTARITCGGDNIGGNYASWYQQKPGQAPVMIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCLSSASSAN
Leptonychotes weddellii V766 iglv APMU01150951.1 2431 SWAQSPLTQPSSVSGALGQTVTISCTGTSNDIGKYNYVSWYQQLPGMSPKLLIYSVSSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCASYRSSYT
Leptonychotes weddellii V780 iglv APMU01155129.1 5126 SWAQSPLTQPSSVSGALGQTVTISCTGTSNDIGKYNYVSWYQQLPGMSPKLLIYSVSSRPSGIPDRFSGSKSGNTASLTISRLQAEDETDYYCASYRSGGT
Leptonychotes weddellii V784 ighv APMU01157903.1 2440 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLQWVGEIKDDGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRLEDTAVYYCAR
Leptonychotes weddellii V786 iglv APMU01159695.1 1094 SWAQSLLTQPSSVSKALGQTVTISCTGSSSKIGSYGVNWYQQLPGKAPKTMIYGSSGRPSGVPERFSGSTSGSSGTLTITGFQAEDEAEYHCASWDDSLS
Leptonychotes weddellii V787 trav APMU01160335.1 4055 TSGDTVTQTEGSVTLREGTPLTLNCTYQSSYAIVVFWYVQYPNKGPELLLKSSSENQRVEHRGFQADLKSDKSFHLEKRSVQMSDSAVYYCVLG
Leptonychotes weddellii V789 trav APMU01161187.1 2780 VSGKNQVEQNPPSLVILEGENCTIQCNYTVNPFSNLRWYKQGTERGPAALIFVVYSDSKTSDGRYTTTLDTTSKHSSLHITAAQLSDSAFYICAVS
Leptonychotes weddellii V790 trav APMU01161322.1 2597 VSGKNQVEQNPPSLVILEGENCTIQCNYTVNPFSNLRWYKQGTERGPAALIFVVYSDSKTSDGRYTTTLDTTSKHSSLHITAAQLSDSAFYICAVS