WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mus musculus AAHY00000000.1 (AAHY01) 523 273 4 112 99 19 7 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mus musculus V709 trav AAHY01765217.1 380 AAGQGVEQPAKLMSVEGTFARVNCTYSTSGFNGLSWYQQREGQAPVFLSYVVLDGLKDSGHFSTFLSRSNGYSYLLLTELQIKDSASYLCAVR
Mus musculus V1142 trav AAHY01113949.1 8393 VNSQQKVQQSPESLIVPEGGMASLNCTSSDRNVDYFWWYRQRSGKSPKMLMAIFSNGEKEEGRFTVHLNKASLHTSLHIRDSQPSDSALYFCAV
Mus musculus V1391 trav AAHY01322379.1 499 GVSGDKVKQSPSALSLQEGTNSALRCNFSIAATTVQWFLQNPRGSLINLFYLVPGTKENGRLKSTFNSKESYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V137 trbv AAHY01052880.1 222607 VSAQTIHQWPVAEIKAVGSPLSLGCTIKGKSSPNLYWYWQATGGTLQQLFYSITVGQVESVVQLNLSASRPKDDQFILSTEKLLLSHSGFYLCAWS
Mus musculus V141 igkv AAHY01053995.1 15411 AIGDIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCMQHLEYP
Mus musculus V142 igkv AAHY01054000.1 5183 TNGDVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQG
Mus musculus V143 igkv AAHY01054006.1 32624 TNGDVVMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQG
Mus musculus V144 igkv AAHY01054006.1 67380 TNGDVVMTQTPLSLSVTIGQPASISCKSSQSLLYSNGKTYLNWLQQRPGQAPKHLMYQVSKLDPGIPDRFSGSGSETDFTLKISRVEAEDLGVYYCLQGTYY
Mus musculus V145 igkv AAHY01054006.1 98497 ARCEIQMTQSPSSMSASLGDRITITCQATQDIVKNLNWYQQKPGKPPSFLIYYATELAEGVPSRFSGSGSGSDYSLTISNLESEDFADYYCLQFYEFP
Mus musculus V146 igkv AAHY01054009.1 2964 SRAETTVTQSPASLSVATGEKVTIRCITSTDIDDDMNWYQQKPGEPPKLLISEGNTLRPGVPSRFSSSGYGTDFVFTIENTLSEDVADYYCLQSDNMP
Mus musculus V147 igkv AAHY01054009.1 37950 IRCDIKMTQSPSSMYASLGERVTITCKASQDIKSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESP
Mus musculus V148 igkv AAHY01054010.1 6572 ARCDVQMIQSPSSLSASLGDIVTMTCQASQGTSINLNWFQQKPGKAPKLLIYGASNLEDGVPSRFSGSRYGTDFTLTISSLEDEDMATYFCLQHSYLP
Mus musculus V149 igkv AAHY01054013.1 17376 SSSDAVMTQTPLSLPVSLGDQASISCRSSQSLENSNGNTYLNWYLQKPGQSPQLLIYRVSNRFSGVLDRFSGSGSGTDFTLKISRVEAEDLGVYFCLQV
Mus musculus V150 igkv AAHY01054013.1 37223 SRAETTVTQSPASLSMAIGEKVTIRCITSTDIDDDMNWYQQKPGEPPKLLISEGNTLRPGVPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDNLP
Mus musculus V151 igkv AAHY01054013.1 50365 TRCDIQMTQSPSSLSASLGERVSLTCRASQDIGSSLNWLQQEPDGTIKRLIYATSSLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYCLQYASSP
Mus musculus V152 igkv AAHY01054015.1 4582 SSSDVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG
Mus musculus V153 igkv AAHY01054021.1 1310 STADIVMTQAAFSNPVTLGTSASISCRSSKNLLHSNGITYLYWYLQRPGQSPQLLIYRVSNLASGVPNRFSGSESGTDFTLRISRVEAEDVGVYYCAQLLELP
Mus musculus V154 igkv AAHY01054021.1 10409 SSSDVLLTQTPLFLPVSLGDQASISCSSSQSLVHSNGNSYLEWHLQKSGQSLQLLIYEVSKRHSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCFQG
Mus musculus V155 igkv AAHY01054025.1 25497 VSGDIVITQDELSNPVTSGESVSISCRSSKSLLYKDGKTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQLVEYP
Mus musculus V156 igkv AAHY01054029.1 6830 IKCDIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFP
Mus musculus V157 igkv AAHY01054029.1 21212 SSSDVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQS
Mus musculus V158 igkv AAHY01054031.1 15763 STADIVMTQAAFSNPVTLGTSASISCRSSKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGVYYCAQNLELP
Mus musculus V159 igkv AAHY01054033.1 11181 ARCDVLMTQSPSSLSASLGERVSLTCQASQGISNNLNWYQQTPGKAPRLLIYDASKLEDGVPSRFSGTGYRTDFNFTISSLEEEDVATYFCLQHRYLP
Mus musculus V160 igkv AAHY01054036.1 20855 TRCDIRMIQTPASLSGSLGESVTITCQASQDIGKSLLWYQQKTGNPPKILIYTTSNLADGISSRVSGSGSGTQFFLKFSSLKPEDTATYYCCQGYWLF
Mus musculus V161 igkv AAHY01054039.1 2656 AQCDVQITQSPSYLAASPGETITINCRASKSISKYLAWYQEKPGKTNKLLIYSGSTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYYCQQHNEYP
Mus musculus V162 igkv AAHY01054042.1 445 VRCDIQMNQSPSSLSASLGDTITITCHASQNINVWLSWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQSYP
Mus musculus V163 igkv AAHY01054042.1 37626 MSCNIQVIQSPFLSASVGERVTISCKTHQHINSSIAWYQQKVGKAPILLIRDASFSLTDTPSRFTGNGFGTDFTLSISSMQSQDGATYFCQQH
Mus musculus V164 igkv AAHY01054043.1 28999 ARCDILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFKGLIYHGTNLEDGVPSRFSGSGSGADYSLTISSLESEDFADYYCVQYAQFP
Mus musculus V165 igkv AAHY01054043.1 51929 SSSDVVLTQTPLSLPVNIGDQASISCKSTKSLLNSDGFTYLDWYLQKPGQSPQLLIYLVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQSNYLP
Mus musculus V166 igkv AAHY01054045.1 4509 GKCDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTP
Mus musculus V167 igkv AAHY01054045.1 25140 VRCDIQMTQSPSTLSASLGDRVTITCHASQNIKSWLAWCQQKPGNSPKLLIYEATKLQIGFSGSGYGTDFTISISSLQSEDIVIYHCL
Mus musculus V168 igkv AAHY01054052.1 4307 TRYDIQMTQTTSSLSASLGDRVTISCRASEDISTYLNWYQQKPDGTVKLLIYYTSGLHSGVPSRFSGSGSGADYSLTISNLEPEDIATYYCQQYSKLP
Mus musculus V170 igkv AAHY01054061.1 937 MICDIQMTQSSSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTP
Mus musculus V171 igkv AAHY01054108.1 23345 SRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQN
Mus musculus V172 igkv AAHY01054111.1 19586 STGDILLTQSPATLSVTPGETVSLSCRASQSIYKNLHWYQQKSHRSPRLLIKYASDSISGIPSRFTGSGSGTDYTLSINSVKPEDEGIYYCLQGY
Mus musculus V173 igkv AAHY01054116.1 2653 TCGDILMTQSPSSLTVSAGEKVTMSCKSSQSLLASGNQNNYLAWHQQKPGRSPKMLIIWASTRVSGVPDRFIGSGSGTDFTLTINSVQAEDLAVYYCQQSYSAP
Mus musculus V174 igkv AAHY01054120.1 7653 STGDIVLTQTSACFVVSLGQRDNISCKSCESVTDTLCNNSMQWYQQNPEQLPIVLIYEAYSVESGVYVRFCGSWCETDFKLTIYPVEDSNAASYYCQQSKEF
Mus musculus V175 igkv AAHY01054121.1 7132 VDGDIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSVQAEDLALYYCQQHY
Mus musculus V176 igkv AAHY01054134.1 4233 VDGDIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTP
Mus musculus V177 igkv AAHY01054140.1 29523 STGDIVLTQSPASLAVSLGQRATISCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHSRELP
Mus musculus V178 igkv AAHY01054144.1 16610 STGNIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDP
Mus musculus V179 igkv AAHY01054144.1 32157 STGDIVLTQSPASLAVSLGQRATISCQASESVSFAGTSLMHWYQQKPGQPPKLLIYRASNLESGVPARFSGSGSESDFTLTIDPVEEDDAAMYYCMQSMEDP
Mus musculus V180 igkv AAHY01054144.1 51416 STGDIVLTQSPASLAVSLGQRATISCRASQSVSTSSYSYMHWYQQKPGQPPKLLIKYASNLESGVPARFSGSGSGTDFTLNIHPVEEEDTATYYCQHSWEIP
Mus musculus V181 igkv AAHY01054147.1 16428 STGDIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKLLIYRASNLESGIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDP
Mus musculus V182 igkv AAHY01054147.1 24910 STGDIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDP
Mus musculus V183 igkv AAHY01054147.1 40012 STGDIVLTQSPASLAVSLGQRATIFCRASQSVDYNGISYMHWFQQKPGQPPKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSIEDP
Mus musculus V184 igkv AAHY01054147.1 51545 STGDIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGQPPKLLIYAASNQGSGVPARFSGSGSGTDFSLNIHPMEEDDTAMYFCQQSKEVP
Mus musculus V185 igkv AAHY01054147.1 56655 STGDIVLTQSPASLAVSLGQRATISCRASESVEYYGTSLMQWYQQKPGQPPKLLIYAASNVESGVPARFSGSGSGTDFSLNIHPVEEDDIAMYFCQQSRKVP
Mus musculus V323 ighv AAHY01103750.1 10737 VQCEVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCA
Mus musculus V324 ighv AAHY01103750.1 25062 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVSWVRQPPGKGLEWLGVIWGDGSTNYHSALISRLSISKDNSKSQVFLKLNSLQTDDTATYYCAK
Mus musculus V325 ighv AAHY01103750.1 38797 VQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISDGGSYTYYPDNVKGRFTISRDNAKNNLYLQMSHLKSEDTAMYYCAR
Mus musculus V326 ighv AAHY01103754.1 12992 VLSQVQLKQSGPSLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWRGGSTDYNAAFMSRLSITKDNSKSQVFFKMNSLQADDTAIYYCAK
Mus musculus V327 ighv AAHY01103761.1 12139 VLCEVKLVESGGGLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLELVAEISNSGGSTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCA
Mus musculus V328 ighv AAHY01103764.1 10318 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTNSGVHWVHQSPGKGLEWLGVIWGDGSTNYNSAFKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCAK
Mus musculus V329 ighv AAHY01103805.1 1679 VYSEVQLQQSGTVLARPGASVKMSCKTSGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSASTAYMELSSLTNEDSAVYYCT
Mus musculus V333 trgv AAHY01104635.1 31408 GLGQLEQTELSVTRETDENVQISCIVYLPYFSNTAIHWYRQKTNQQFEYLIYVATNYNQRPLGGKHKKIEASKDFKSSTSTLEINYLKKEDEATYYCAVWM
Mus musculus V355 trav AAHY01113947.1 3707 MSQGEQVEQLPSILRVQEGSSASINCTYENSASNYFPWYKQEPGENPKLIIDIRSNMERKQTQGLIVLLDKKAKRFSLHITDTQPGDSAMYFCAAS
Mus musculus V356 trav AAHY01113947.1 9550 MAQGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS
Mus musculus V357 trav AAHY01113947.1 16161 VSSQEKVQQSPESLTVPEGAMASLNCTISDSASQSIWWYQQNPGKGPKALISIFSNGNKKEGRLTVYLNRASLHVSLHIRDSHPSDSAVYLCAA
Mus musculus V358 trav AAHY01113947.1 29474 VKGQQVEQSPASLVLQEGENAELQCTYSTTLNSMQWFYQRPGGRLVSLLYSPSWAEQRGGRLTSSAASNESRSSLHISSSQITDSGTYLCAME
Mus musculus V359 trav AAHY01113947.1 38020 AKSQWGEENLQALSIQEGEDVTMNCSYKTYTTVVQWYRQKSGKGPALIILIRSNEREKRSGRLRATLDTSSQSSSLSITGTLATDTAVYFCATD
Mus musculus V360 trav AAHY01113947.1 43164 ATSMAQKVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRE
Mus musculus V361 trav AAHY01113947.1 60258 ASQLGLKEQQVQQSPASLVLQEGENAELQCSFSIFTNQVQWFYQRPGGRLVSLLYNPSGTKQSGRLTSTTVIKERRSSLHISSSQITDSGTYLCAME
Mus musculus V362 trav AAHY01113949.1 32768 GVRGMPVEQNPPALSLYEGADSGLRCNFSTTMKSVQWFQQNHRGRLITLFYLAQGTKENGRLKSTFNSKERYSTLHIKDAQLEDSGTYFCAAE
Mus musculus V363 trav AAHY01113949.1 49000 RTHGDSVIQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYSGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQEIDSAVYYCAMR
Mus musculus V364 trav AAHY01113949.1 61621 VNSQQNVQQSPESLIVPEGARTSLNCTFSDSASQYFWWYRQHSGKAPKALMSIFSNGEKEEGRFTIHLNKASLHFSLHIRDSQPSDSALYLCAV
Mus musculus V365 trav AAHY01113951.1 10158 MRKTHGDSVTQKQGQVTLSEDDFLFINCTYSTTTYPTLLWYVQYPGQGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQESDSAVYFCALV
Mus musculus V366 trav AAHY01113951.1 17146 VRSQQKVQQSPESLSVPEGGMASFNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYFCAAS
Mus musculus V367 trdv AAHY01113978.1 38671 KDVLCITLTQSSTDQTVASGTEVTLLCTYNADSPNPDLFWYRKRPDRSFQFILYRDDTSSHDADFVQGRFSVKHSKANRTFHLVISPVSLEDSATYYCASG
Mus musculus V396 igkv AAHY01125304.1 5768 ARCDIQMTQSPSSMSVSLGERVSITCRASQGTSSYLSWLQQKPGKSPKTLISYATNLEDRVPSWFSGSWSGADYSLTISNLESEDFTDYYCVQYAQFP
Mus musculus V400 iglv AAHY01126128.1 286043 CGPQPMVHQPPSASSSLGATIRLSCTLSNDHNIGIYSIYWYQQRPGHPPRFLLRYFSHSDKHQGPDIPPRFSGSKDTARNLGYLSISELQPEDEAVYYCAVGLR
Mus musculus V412 igkv AAHY01130608.1 7485 TTVTQSPTSLSMATGEKVTIRCITRTDIDDDMNWYQQKPGEPPKLLISEGNTLRPGVPSRFSNSGYGTDFLLTIENTLSEDVADYYCLQSDNLP
Mus musculus V446 ighv AAHY01145005.1 1630 VNSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGMIDPSDSYTSYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCT
Mus musculus V447 ighv AAHY01145243.1 883 VQSQVQLQQSGAELVKPGASVKISCKASGYAFSSSWMNWVKQRPGKGLEWIGQIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V448 ighv AAHY01145257.1 532 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPGSSSTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V449 ighv AAHY01145550.1 5349 AQAQIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKGLKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCA
Mus musculus V450 trav AAHY01145795.1 1656 VKGQQVQQSPASLVLQEGENAELQCNFSSTATQLQWFYQSPGGSLVSLLSNPSGTKHTGRLTSTTVTKERRSSLHISSSQTTDSGTYLCAIDPQCS
Mus musculus V451 ighv AAHY01146024.1 1825 VQCEVQLLETGEGLVPPGGSRGLSCEGSGFTFSGFWMSWVRQTPGKTLEWIGDINSDGSAINYAPSIKDRFTIFRDNDKSTLYLQMSNVRSEDTATYFCMR
Mus musculus V452 ighv AAHY01146212.1 7008 VQSEVKIEESGGGLVQPGGSMKLSCAASGFTFSDYRMDWVHHSTENGLEWVAEIRNKASNYATYYVESVNGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCT
Mus musculus V454 ighv AAHY01146716.1 773 VHCQVQLQQSGPELVKPGASVKISCKASGYTFTDYYINWVKQRPGQGLEWIGWIFPGSGSTYYNEKFKGKATLTVDKSSSTAYMLLSSLTSEDSAVYFCA
Mus musculus V455 ighv AAHY01146746.1 2118 IQAQIQLVQSGPELKKPGETVKISCKASGYTFTTAGMQWVQKMPGKGFKWIGWINTHSGEPKYAEDFKGRFAFSLETSASTAYLQISNLKNEDTATYFCA
Mus musculus V456 ighv AAHY01146979.1 1624 VHSQVQLQQSGPELVKPGASVKLSCKASGYTFTSYDINWVKQRPGQGLEWIGWIYPRDGSTKYNEKFKGKATLTVDTSSSTAYMELHSLTSEDSAVYFCA
Mus musculus V457 trav AAHY01147026.1 3162 VNSQLAEENPWALSVHEGESVTVNCSYKTSITALQWYRQKSGEGPAQLILIRSNEREKRNGRLRATLDTSSQSSSLSITATRCEDTAVYFCATD
Mus musculus V459 trav AAHY01147868.1 2180 VKGQQVQQSPTSLVLQEGENAELQCNFSTSLNSMQWFYQRPGGSLVSVFYNPSGTKQSGRLTSTTVIKERRSSLHISSSQITDSGTYLCAMEPQCS
Mus musculus V460 ighv AAHY01149409.1 2207 VHSEVHLQQSGPELVNPRDSVKISCKASGYSFTGYYMNWVKQGPGKSLEWIGYISWYNGATSYNQKFKGKAIFTVDKSSSTAYMQFNSLTSEDSVVYYCA
Mus musculus V461 ighv AAHY01149590.1 1773 VHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGMIHPSDSETRLNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCA
Mus musculus V462 trav AAHY01149714.1 389 RAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALG
Mus musculus V463 ighv AAHY01149738.1 3118 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWAGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAR
Mus musculus V465 ighv AAHY01149857.1 92 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMYWVKQRPGQGLERIGEINPSNGGTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSVVYYCT
Mus musculus V466 trav AAHY01150177.1 462 GVRGDQVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFQQNSRGSLINLFYLASGTKENGRLKSTFNSKESYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V467 ighv AAHY01151532.1 1363 VQCEVKLVESGGGLVKPGASLKLSCAASGFTFSNYGMSWVRQTSDKRLEWVASISSGGGSTYYPDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCAR
Mus musculus V468 trav AAHY01151671.1 2024 RSNGDSVTQTEGLVTVTEGLPVMLNCTYQTAYSDVAFFWYVQYLNEAPKLLLRSSTDNKRTEHQGFHATLHKSSSSFHLQKSSVQLSDSALYYCALS
Mus musculus V469 igkv AAHY01152338.1 2118 ACGEIVLTQSIPSLTVSAGERVTISCKSNQNLLWSGNQRYCLVWHQWKPGQTPTPLITWTSDRYSGVPDRFIGSGSVTDFTLTISSVQAEDVAVYFCQQH
Mus musculus V470 ighv AAHY01152609.1 1316 VLSEVQLQQSGPDLVKPGASVKISCKASGYTFTDYDMNWVKQSHGKSLEWIGYIYPNNGGTSYNQKFKGKATLTVDKSSSTEYMELRNLTSEDSAVYYCA
Mus musculus V471 ighv AAHY01153946.1 167 VHSQVQLQQPGSELVRPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGNIYPGSGSTNYDEKFKSKATLTVDTSSSTAYMQLSSLTSEDSAVYYCT
Mus musculus V472 ighv AAHY01154384.1 2023 ILSEVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVTSEDTATYYCAR
Mus musculus V473 ighv AAHY01155738.1 1193 AQAQIQLVQSGPELKKPGETVKISCKASGYTFTNYAMHWVKQAPGKGLKWMGWKYTNTGEPTYGDDFKGRFAFSLETSASTAYLQINNLKNEDMATYFCA
Mus musculus V475 ighv AAHY01155803.1 3154 VHSQVQLQQSGAELAKPGASVKMSCKASGYPFTSYWMHWVKQRPGQGLEWIGAINPSSDYTEYNQKFKDKATLTADKSSSTAYMQLSILASEDSAVYYCA
Mus musculus V476 ighv AAHY01155959.1 3946 VLSEVQLQQSGPELVKPGSSVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGDINPINGGTSYNQKFKGKATLTVDKSSSTDYMELRGLTSEDSAVYYCA
Mus musculus V477 ighv AAHY01155963.1 4290 VLSEVQLQQSGPELVKPGASVKISCKASGYTFTDYYYMNWVKQSHGKSLEWIGYIYPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V478 ighv AAHY01155964.1 1503 VHSEVQLQQSGPELVKPGASVKISCKASGYTFTDYTMHWVKQSHGKSLEWIGLVNPNNGGTNYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSSVYYCA
Mus musculus V479 ighv AAHY01156016.1 685 VLCDVKLVESGGGLVKLGGSLKLSCAASGFTFSSYYMSWVRQTPEKRLELVAAINSNGGSTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTALYYCA
Mus musculus V481 ighv AAHY01156248.1 1841 VHSQVQLQQPGAELVKPGAPVKLSCKASGYTFTSYWMNWVKQRPGRGLEWIGRIDPSDSETHYNQKFKDKATLTVDKSSSTAYIQLSSLTSEDSAVYYCA
Mus musculus V482 ighv AAHY01156732.1 542 VQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSNDYMAWVRQTPEKRLEWVASISSGGDYIYYADNVKGRFTISRDNAKNTLYLQMSSLKSEDTAIYYCTR
Mus musculus V484 ighv AAHY01159623.1 830 VLSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMKWVKQSHGKSLEWIGDINPNNGDTFYNQKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCA
Mus musculus V486 ighv AAHY01160550.1 55 VQSEVKIEESGGGLVQPGGSMKLSCAASGFTFSDYRMDWVHHSTENGLDWVAEIRNKASNYATYYVESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCT
Mus musculus V488 ighv AAHY01160788.1 990 ILSDVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGSTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCA
Mus musculus V489 trav AAHY01160922.1 1445 VSSQEKVQQSPESLIVPEGAMASLNCTFSNSASQSIWWYQQHPGKGPEALISIFSNGNKKEGRLTVYLNRASLHVSLHIRDSQPSDSAIYLCAV
Mus musculus V490 ighv AAHY01162471.1 1085 VHSQVQLQQSGAELAKPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGYINPSTGYTEYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V491 ighv AAHY01164722.1 836 VHCQVQLKQSGAELVRPGASVKLSCKASGYTFTDYYINWVKQRPGQGLEWIARIYPGSGNTYYNEKFKGKATLTAEKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V492 ighv AAHY01164764.1 1105 VLSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIGYIYPNNGGNGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V493 ighv AAHY01165985.1 2323 VLSEVQLHQSGPELVKPGASVKMSCKASGYTFTNYYMHWVKQSHGKSIEWIGYIYPNNGDTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V494 ighv AAHY01166011.1 10861 VLSEVQLQQSGPELVKPGASVKIPCKASGYTFTDYNMDWVKQSHGKSLEWIGDINPNNGGTIYNQKFKGKATLTVDKSSSTAYMELRSLTSEDTAVYYCA
Mus musculus V495 ighv AAHY01166067.1 23250 VHCQVQLQQSGAELVRPGASVKLSCKASGYTFTSYWMQWVRQRPGQGLEWIGEIFPGSGSTYYNEKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V496 ighv AAHY01166071.1 2581 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSNMGIGWIRQPSGKGLEWLAHIWWNDDKYYNPSLKSRLTISKDTSNNQVFLKITSVDTADTATYYCAQI
Mus musculus V497 ighv AAHY01166071.1 14926 VHSQRELQQSGAELVRPGSSVKLSCKDSYFAFMASAMHWVKQRPGHGLEWIGSFTMYSDATEYSENFKGKATLTANTSSSTAYMELSSLTSEDSAVYYCA
Mus musculus V498 ighv AAHY01166072.1 6230 VLSQITLKQSGPGIVQPSQPVRLTCTFSGFSLSTSGIGVTWIRQPSGKGLEWLATIWWDDDNRYNPSLKSRLAVSKDTSNNQAFLNIITVETADTAIYYCAQS
Mus musculus V499 ighv AAHY01166074.1 30696 VHSQVQLQQSGAELVKPGASVKMSCKAFGYTFTTYPIEWMKQNHGKSLEWIGNFHPYNDDTKYNEKFKGKATLTVEKSSSTVYLELSRLTSDDSAVYYCA
Mus musculus V500 ighv AAHY01166077.1 13043 VHSEVKLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSSEKSLEWIGEINPSTGGTSYNQKFKGKATLTVDKSSSTAYMQLKSLTSEDSAVYYCA
Mus musculus V501 ighv AAHY01166600.1 12 VLSQVILKESGPGILQPSQTLSLTCSFSGFSLSTYGTAVNWIRQPSGKGLEWLAQIGSDDSKLYNPFLKSRITISKDTSNSQVFLKITSVDTEDSATYYCANR
Mus musculus V502 ighv AAHY01166608.1 9530 VLSQVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARR
Mus musculus V503 ighv AAHY01166611.1 3891 VHSQVQLQQPGAELVMPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKGKSTLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V504 ighv AAHY01166617.1 1255 VYCQVQLQQSGNDLVKPGASVKLSCKASGYTFTSYWINWIKQRPGQGLEWIGRIAPGSGSTYYNEMFKGKATLTVDTSSSTAYIQLSSLSSEDSAVYFCA
Mus musculus V505 ighv AAHY01166620.1 429 VHSQVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V506 ighv AAHY01166622.1 1864 VHSQVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWVKQKPEQGLEWIGYISPGNGDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCK
Mus musculus V507 ighv AAHY01166682.1 1337 VHSQVQLQQSGAELVRPGVSVKISCKGSGYTFTDYAMHWVKQSHAKSLEWIGVISTYYGDASYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCA
Mus musculus V508 ighv AAHY01166682.1 14027 VLSQVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMSVGWIRQPSGKGLEWLAHIWWDDDKYYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARR
Mus musculus V509 ighv AAHY01166682.1 20602 VHSQVQIQQPGAELVRPGASVKMPCKASGYTFTSYRMNWGKQRPGQGLEWIGYIYAGSGSTDYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSGIYYCA
Mus musculus V510 ighv AAHY01166689.1 4071 VHSQVQLQQSDAELVKPGASVKISCKVSGYTFTDHTIHWMKQRPEQGLEWIGYIYPRDGSTKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCA
Mus musculus V511 ighv AAHY01166800.1 4218 VHSEVQLQQSGAELVRPGSSVKLSCKTSGYTFTSYGINWVKQRPGQGLECIGYIYIGNGYTEYNEKFKGKATLTSDTSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V512 ighv AAHY01166802.1 691 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVGWIRQPSGKGLEWLANIWWDDSKYYNAALKSRLTISKDTSKNQVFLKIASVDTADTATYYCARI
Mus musculus V513 trav AAHY01166811.1 12192 ESHGEKVEQHESTLSVREGDSAVINCTYTDTASSYFPWYKQEAGKGLHFVIDIRSNVDRKQSQRLIVLLDKKAKRFSLHITATQPEDSAIYFCAA
Mus musculus V514 trav AAHY01166812.1 14003 RSNGDSVTQTEGLVTLTEGLPVKLNCTYQTAYSDVAFFWYVQHLNEAPKLLLRSSTDNKRTEHQGFHATLHKSSSSFHLQKSSVQLSDSALYFCALS
Mus musculus V515 trav AAHY01166812.1 20840 VKGQQVQQSPASLVLQEGENAELQCNFSTSLNSMQWFYQRPEGSLVSLFYNPSGTKQSGRLTSTTVIKERRSSLHISSSQITDSGTYLCAMEPQC
Mus musculus V516 trav AAHY01166815.1 1214 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSGTPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAA
Mus musculus V517 trav AAHY01166815.1 9097 GVSGDQVKQSPSALSLQEGTNSALRCNFSIATTTVQWFLQNPRGSLMNLFYLVPGTKENGRLKSTFNSKESYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V518 ighv AAHY01166923.1 9778 VLSEVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGDINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V519 ighv AAHY01166927.1 3271 AYSQIQLQQSGAELASPGASVTLSCKASGYTFTDHIMNWVKKRPGQGLEWIGRIYPVSGETNYNQKFMGKATFSVDRSSSTVYMVLNSLTSEDPAVYYCG
Mus musculus V520 ighv AAHY01167192.1 316 VHSPVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCT
Mus musculus V521 ighv AAHY01167558.1 767 VQCEVQLVESGGGLVQPGGSQKLSCAASEFTFSSYAMSWVRQTPEKRLEWVAYTSSSGVSTYYQDTVKGRFTISRDNAKNTLYLQMTSLKSEDTALYYCAR
Mus musculus V522 ighv AAHY01171805.1 282 VHSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYWINWVKQRPGQGLEWIGDIYPGRGITNYNEKFKSKATLTLDTSSSTAYMQLSSLTSEDSAVYYCS
Mus musculus V523 ighv AAHY01171948.1 837 IQAQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCA
Mus musculus V524 ighv AAHY01173761.1 352 VQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVASISSGGSTYYPDSVKGRFTISRDNARNILYLQMSSLRSEDTAMYYCAR
Mus musculus V525 ighv AAHY01177175.1 3138 VQCEVMLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISGGGGNTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTALYYCA
Mus musculus V526 ighv AAHY01177727.1 3390 IQGEVQLVESGGSLGQPGGSTKLSCEEASGFTFSDHWMDWFRQAPGMRLEWLANTNHDESGKGYAESVKDRFSISRDNSENLLYLQMNSLRNEDTALYYCAR
Mus musculus V527 ighv AAHY01177727.1 12378 VNSEVQLQQSVAELVRPGASVKLSCTASGFNIKNTYMHWVKQRPEQGLEWIGRIDPANGNTKYAPKFQGKATITADTSSNTAYLQLSSLTSEDTAIYYCA
Mus musculus V528 ighv AAHY01177793.1 3067 VHCQVQLQQSGPELVRPGTSVKISCKASGYTFLTYWMNWVKQRPGQGLEWIGQIFPASGSTYYNEMFKDKATFTVDTSSSTAYMQLSSLTSEDTAVYFCA
Mus musculus V529 ighv AAHY01178681.1 393 VHSQAYLQQSGAELVRSGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIYPGNGGTNYNQKFKGKATLTADTSSSTAYMQISSLTSEDSAVYFCA
Mus musculus V530 ighv AAHY01180655.1 74 VQCDVKLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTR
Mus musculus V531 ighv AAHY01181222.1 186 VHSQVQLQQSGAELVRPGTSVKMSCKASGYTFTNYWIGWAKQRPGHGLEWIGDIYPGGGYTNYNEKFKGKATLTADKSSSTAYMQFSSLTSEDSAIYYCA
Mus musculus V532 ighv AAHY01181671.1 547 VHSQVQLQQSGAELVRPGTSVKISCKASGYAFTNYWLGWVKQRPGHGLEWIGDIYPGGGNTYYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V533 trav AAHY01182957.1 278 GMRGDQVEQSPSALSLHEGTSSALRCNFTTTTRSVQWFRQNSRGSLINLFYLASGTKENGRLKSAFDSKELYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V534 trav AAHY01187764.1 395 GVRGDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSKERRYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V535 ighv AAHY01188081.1 7307 VHSQVQLQQSGPELVKPGASVKISCKASGYAFSSSWMNWVKQRPGKGLEWIGRIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V536 ighv AAHY01188285.1 665 TLKEYGPGKLQPSQTFSLTCSFSGFSLSTYGMMVSWMCQPSGKDVEWLAHIWWNDDKGYNPSLRSRLTISKDTPNNQVFLKISSVVTADTITYYCA
Mus musculus V537 ighv AAHY01188286.1 3621 VHSQVQLQQPGAELGKPGTSVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGNINPNSGSTNYNEKFKSKATLTVDKSSSTAYMQLSTLTSEDSAVYYCT
Mus musculus V538 ighv AAHY01188654.1 3384 IQCEVKLMESGGGLVQPGASLRLSCAASGFTFTDYYMSWVRQPPGKAPEWLALIRNKANGYTTEYTASVKGRFTISRDNSQNILYLQMNTLRAEDSATYYCVKA
Mus musculus V539 ighv AAHY01188666.1 3574 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDKYYNAALKSRLTISKDTSKNQVFLKIASVDTADTATYYCARI
Mus musculus V540 ighv AAHY01188753.1 780 VHSEVQLQQSGAELGRPGSSVKLSCKTSGYTFTSYGINWVKQRPGQGLEWIGYIYPGNGYTAYNEKFQGEATLTSDTSSSTAYMQLRSLTSEDSAIYFCA
Mus musculus V541 ighv AAHY01188755.1 3686 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFDMGVGWIRQPSGKGLEWLANIWWNDNKYYNSALKSRLTISKDTSNNQVFLKISSVDTADTATYYCAQI
Mus musculus V542 ighv AAHY01188765.1 491 VHSQVQLQQSGAELARPGASVKLSCKASGYTFTSYGISWVKQRTGQGLEWIGEIYPGSGNTYYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V543 trav AAHY01188783.1 861 MAQGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Mus musculus V544 ighv AAHY01188849.1 11963 IHCEVQLVETGGGLVQPGNSLKLSCATSGYPFYDYWMDWVRHSPEKGLEWVARIATKTHNYATYYAESVKGRFIVSRDDSKSSAYMQMNSLRKEDTAVYYCARE
Mus musculus V545 ighv AAHY01188849.1 16920 ILSDVQLQESGPGLVKPSQTVFLTCTVTGISITTGNYRWSWIRQFPGNKLEWIGYIYYSGTITYNPSLTSRTTITRDTPKNQFFLEMNSLTAEDTATYYCAR
Mus musculus V546 ighv AAHY01188962.1 9414 VHSQVQLQQSGPELVRPGVSVKISCKGSGYTFTDYAMHWVKQSHAKSLEWIGVISTYYGDASYNQKFKDKATMTVDKSSSTAYMELARLTSEDSAVYYCA
Mus musculus V547 ighv AAHY01188962.1 20244 VHCQVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V548 ighv AAHY01195304.1 7254 VHSEVQLQQSGPVLVKPGASVKMSCKASGYTFTDYYMNWVKQSHGKSLEWIGVINPYNGGTSYNQKFKGKATLTVDKSSSTAYMELNSLTSEDSAVYYCA
Mus musculus V550 ighv AAHY01195776.1 1376 VHSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGNIYPGSGSTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V551 trav AAHY01195802.1 8312 VKSQQKVQQSPESLSVPEGGMASLNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYFCAVS
Mus musculus V552 ighv AAHY01195901.1 10510 ILSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVDWVRQSPGKGLEWLGVIWGVGSTNYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAS
Mus musculus V553 ighv AAHY01196328.1 11789 IQCEVKLVESEGGLVQPGGSLRLSCATSGFTFTDFYMNWVCQPPRKALEWLGFIRNKANGYTTDYSASMKGRFTISRDNSQSILYLQMNTLRTEDSATYYCARD
Mus musculus V554 ighv AAHY01196566.1 3773 VLSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYNMHWVKQSHGKSLEWIGYINPNNGGTSYNQKFKGKATLTVNKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V555 ighv AAHY01197135.1 351 VQCELQLVESGGGLVQPGGSLKLSCAASGFTFSSHFMAWVRQTPEKRLEWAANIYPDGGTAYYPNTVKGRFTISRDNARNIMYLQMSSLRSEDTAMYYCVRQ
Mus musculus V556 ighv AAHY01197244.1 8322 VHSQVQLQQSGAELAKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGYINPSSGYTKYNQKFKDKATLTADKSSSTAYMQLSSLTYEDSAVYYCA
Mus musculus V557 trav AAHY01197356.1 418 VKGQQVEQSPASLVLQEGEKAELQCNFSSTATELQWFYQSPGGRLVSLLYNPSGTKQSGRLISTTVIKERRSSLHISSSQITDSGTYLCAMEPQCS
Mus musculus V559 ighv AAHY01197658.1 2914 VYAQGQMQQSGAELVKPGASVKLSCKTSGFTFSSSYISWLKQKPGQSLEWIAWIYAGTGGTSYNQKFTGKAQLTVDTSSSTAYMQFSSLTTEDSAIYYCA
Mus musculus V561 ighv AAHY01198453.1 189 VYAQGQMQQSGAELVKPGASVKLSCKTSGFTFSSSYISWLKQKPGQSLEWIAWIYAGTGSTSYNQKFTGKAQLTADTSSSTAYMQLSSLTSEDSAIYYCAR
Mus musculus V564 ighv AAHY01199603.1 1956 VHSQVQLQQPGSELVRPGASVKLSCKASGYTFTSYWMHWVKQRHGQGLEWIGNIYPGSGSTNYDEKFKSKGTLTVDTSSSTAYMHLSSLTSEDSAVYYCT
Mus musculus V565 ighv AAHY01199705.1 1294 VHCQIQLQQSGPELVKPGASVKISCKASGYTFTDYYINWVKQRPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V593 ighv AAHY01230666.1 362 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDVKRYNPALKSRLTISKDTSSSQVFLMIASVDTADTATYYCARI
Mus musculus V594 ighv AAHY01245444.1 181 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDVKRYNPALKSRLTISKDTSSSQVFLKIASVDTADTATYYCARI
Mus musculus V595 ighv AAHY01253143.1 620 VHCQVQLQQSGPELVKPGASVRISCKASGYTFTSYYIHWVKQRPGQGLEWIGWIYPGNGNTKYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V598 ighv AAHY01276907.1 95 VLSEVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGDINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V599 trav AAHY01300097.1 597 RSNGDGDSVTQTEGLVTLTEGLPVMLNCTYQTIYSNAFLFWYVHYLNESPRLLLKSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus musculus V600 ighv AAHY01300691.1 529 IQCEVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAASRNKANDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARD
Mus musculus V603 ighv AAHY01311858.1 368 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLADIWWDDDKYYNPSLKSRLTISKDTSKNQVFLKIASVDTADTATYYCARR
Mus musculus V604 ighv AAHY01316467.1 91 VQCEVKLDESGGGLVQPGRSMKLSCVASGFTFTNSWMNWFRQSPEKGLEWVAQIRSKPYNYETYYSDSVKGRFTISRDDYKSSVYLQMNNLRADDTGIYYCT
Mus musculus V605 trav AAHY01317881.1 223 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAV
Mus musculus V606 trav AAHY01319108.1 445 RSNGDSVTQTEGLVTVTEGLPVKLNCTYQTTYLTIAFFWYVQYLNEAPQVLLRSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus musculus V607 trav AAHY01329689.1 121 ESHGEKVEQHESTLSVREGDSAVINCTYTDTASSYFPWYKQEAGKGLHFVIDIRSNVDRKQSQRLIVLLDKKAKRFSLHITATQPEDSAIYFCAA
Mus musculus V609 trav AAHY01342119.1 737 DAQAQSVTQPDARVTVSEGASLQLRCKYSSFGTPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDWAVYFCAV
Mus musculus V610 ighv AAHY01355058.1 30 VHSEVQLQQSGAELVRPGSSVKLSCKTSGYTFTSYGINWVKQRPGQGLEWIGYIYPGNGYTAYNEKFQGKATLTSDTSSSTAYMQLRSLTSEDSAIYFCA
Mus musculus V612 ighv AAHY01361389.1 342 VLSEIQLQQSGPELVKPGASVKISCKASGYSFTGYIMHWMKQSHGKCLEWIGYISCYIGATSYNQKFKGKAIFTVDKSSSTAYMQFNSLTFEDSAVYYCA
Mus musculus V615 ighv AAHY01371417.1 174 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVDWVRQPPGKGLEWLGVIWGGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCA
Mus musculus V617 trdv AAHY01376335.1 495 SNVAQKVIQVWSTTSRQEGEKLTLDCSYKTSQVLYHLFWYKHLLSGEMVLLIRQMPSTIAIERSGRYSVVFQKSRKSISLVISTLQPDDSGKYFCALWEL
Mus musculus V618 ighv AAHY01386126.1 107 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKLRPGQGLEWIGEINPSNGGTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSVVYYCE
Mus musculus V619 ighv AAHY01387658.1 314 VHSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V620 ighv AAHY01388409.1 456 VHSQVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCA
Mus musculus V621 ighv AAHY01388426.1 116 VHSQVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCA
Mus musculus V627 trav AAHY01395959.1 492 GVRGDQVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFRKNSRGSLINLFYLASGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V628 ighv AAHY01398754.1 547 VHSKVQLQQSGAELVKPGASVKLSCKASGYTFTEYIIHWVKQRSGQGLEWIGWFYPGSGSIKYNEKFKDKATLTADKSSSTVYMELSRLTSEDSAVYFCA
Mus musculus V629 ighv AAHY01398755.1 354 VHSKVQLQQSGAELVKPGASVKLSCKASGYTFTEYIIHWVKQRSGQGLEWIGWFYPGSGSIKYNEKFKDKATLTADKSSSTVYMELSRLTSEDSAVYFCA
Mus musculus V630 ighv AAHY01398757.1 160 VHSKVQLQQSGAELVKPGASVKLSCKASGYTFTEYIIHWVKQRSGQGLEWIGWFYPGSGSIKYNEKFKDKATLTADKSSSTVYMELSRLTSEDSAVYFCARHE
Mus musculus V632 ighv AAHY01404888.1 420 IQCEVKLVESGGGLVQPGGSLRLSCATSEFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARD
Mus musculus V634 ighv AAHY01428288.1 121 VMSQITLKESGPGIVQPSQPFRLTCTFSGFSLSTSGIGVTWIRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNNQAFLNIITVETADTAIYYCAQS
Mus musculus V635 ighv AAHY01428698.1 692 VHSQVQLQQSGPELVRPGVSVKISCKGSGYTFTDYAMHWVKQSHAKSLEWIGVISTYYGNTNYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCA
Mus musculus V636 ighv AAHY01428705.1 19 VHSQVQLQQSGPELVRPGESVKISCKGSGYTFTDYAMHWVKQSHAKSLEWIGVISTYYGNTNYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAIYYCA
Mus musculus V639 trav AAHY01438160.1 365 MSQGEQVEQLPSILRVQEGSSASINCSYEDSASNYFPWYKQEPGENPKLIIDIRSNMERKQIQELIVLLDKKAKRFSLHITNTQPGDSAMYFCAAS
Mus musculus V640 trav AAHY01438166.1 70 VSSQEKVQQSPESLIVPEGAMASLNCTFSNSASQSIWWYQQHPGKGPEALISIFSNGNKKEGRLTVYLNRASLHVSLHIRDSQPTDSAIYLCAV
Mus musculus V641 trav AAHY01439514.1 408 VKGQQVQQSPPASLVLQEGENAELQCTYSTTLNSMQWFYQRPGGRLVSLLYSPSWAEQRGGRLTSSAASNESRSSLHISSSQITDSGTYLCAME
Mus musculus V642 trav AAHY01439528.1 359 AKSQWGEENLQALSIQEGEDVTMNCSYKTYTTVVHWYRQDSGRGPALIILIRSNEREKRSGRLRATLDTSSQSSSLSITAAQCEDTAVYFCATD
Mus musculus V643 trav AAHY01439543.1 457 ATSMAQKVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRE
Mus musculus V644 trav AAHY01439545.1 121 TSMAQKVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRE
Mus musculus V645 ighv AAHY01443354.1 19 VQCEVKLLQSGGGLVQPGGSLKLSCAASGIDFSRYWMSWVRRAPGKGLEWIGEINPDSSTINYAPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCAR
Mus musculus V648 ighv AAHY01462598.1 594 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWNDNKYYNTALKSRLTISKDTSNNQVFLKIASVDTADTATYYCARI
Mus musculus V650 trav AAHY01466456.1 186 RSNGDSVTQTEGLVTLTKGLPVMLNCTYQTTYSPFLFWYVQHLNEAPKLLLKSSTDNKRTEHQGFYATLHKSSSSFHLQKSSVQLSDSALYFCALS
Mus musculus V651 ighv AAHY01467422.1 396 VFSEVQLQQSGPDLVKPGDSVKISCKASGYSFTGYFMNWVKQSHGKSLEWIGRINPYNGVTFYNQKFKGKATLTVDKSSSTAHMELLSLTSEDFAVYYCA
Mus musculus V652 ighv AAHY01480337.1 361 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDKYYNAALKSRLTISKDTSKNQVFLKIASVDTADTATYYCARI
Mus musculus V655 igkv AAHY01509938.1 1023 ACGEIVLTVSAGERVTISCKSNQNLLWSGNQRYCLVWHQWKPGQTPTPLITWTSDRYSGVPDRFIGSGSVTDFTLTISSVQAEDVAVYFCQQH
Mus musculus V656 ighv AAHY01515912.1 702 VHCEVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMHWVRQAPGKGLEWVARIRSKSSNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus musculus V657 ighv AAHY01515914.1 26 VHCEVQLVESGGGLVQPKGSLKLSCATSGFTFNTYAMHWVRQAPGKGLEWVARIRSKSYNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus musculus V660 ighv AAHY01522249.1 264 IQCEVKLVESGGGLVQPGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSASVKGRFTISRDNSQSILYLQMNALRAEDSATYYCARY
Mus musculus V661 ighv AAHY01522641.1 564 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYYMYWVKQRPGQGLEWIGGINPSNGGTNFNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCT
Mus musculus V669 trav AAHY01541646.1 666 GVRGMPVEQNPPALSLYEGADSGLRCNFSTTMKSVQWFQQNHRGRLITLFYLAQGTKENGRLKSTFNSKERYSTLHIKDAQLEDSGTYFCAAE
Mus musculus V671 ighv AAHY01546890.1 457 VHSEFQLQQSGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYIYPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCA
Mus musculus V674 igkv AAHY01555114.1 296 SRGDIVLTQSPATLSVTPGDRVSLSCRASQSISNYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSW
Mus musculus V679 ighv AAHY01573397.1 852 AHSEIQLQQTGPELVKPGASVKISCKASGYSFTDYIMLWVKQSHGKSLEWIGNINPYYGSTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V680 ighv AAHY01573399.1 141 VHSEFQLQQSGPELVKPGASVKISCKASGYSFTDYNMNWVKQSNGKSLEWIGVINPNYGTTSYNQKFKGKATLTVDQSSSTAYMQLNSLTSEDSAVYYCA
Mus musculus V682 ighv AAHY01582769.1 411 INSEVQLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCN
Mus musculus V684 ighv AAHY01587630.1 278 VLSEVQLQQSGPELVKPGASVKISCKASGYTFTDYNMHWVKHGKSLEWIGYIYPNNGGTGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V686 ighv AAHY01605237.1 190 VLSQVQMKESGPDLVQPSQTLSLTCTVSGFSLSSYGVHWFRKPPRKGLEWLGGIWSGGSIYYNPALSSRLSVSRDISKSQVFFKMSSLQSEDTAVYHCAR
Mus musculus V687 ighv AAHY01607332.1 301 VLSQVTVKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVGWIRQPSGKGLEWLADIWWDDNKYYNPSLKSRLTISKDTSKNQVFLKIASVDTADTATYYCARR
Mus musculus V689 ighv AAHY01610283.1 365 VHSQVQLQQPGSVLVRPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGNINPNSGSTNYNEKFKGKATLTVDTSSSTAYMDLSSLTSEDSAVYYCA
Mus musculus V691 ighv AAHY01623900.1 538 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFDTGVGWIRQPSGKGLEWLANIWWNDDKYYNSALKSRLTISKDTSNNQVFLKIASVDTADTATYYCAQI
Mus musculus V693 ighv AAHY01650166.1 58 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFGMGVSWIRQPSGKGLEWLAHIYWDDDKHYNPSLKSRLTISKDTSNNQVFLKITTVDTADTATYYCAQR
Mus musculus V695 trav AAHY01680772.1 344 RSNGDSVTQTEGLVTLTEGLPVMLNCTYQTAYSTFLFWYVQHLNEAPKLLLKSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus musculus V699 ighv AAHY01694198.1 235 VQSQVQLQQSGAELARPGASVKLSCKASGYTFTSYGISWVKQRTGQGLEWIGEIYPRSGNTYYNEKFKGKATLTADKSSSTAYMELRSLTSEDSAVYFCA
Mus musculus V700 ighv AAHY01713673.1 286 VNSQVQLQQPGAELVMPGASVKMSCKASGYTFTDYWMHWVKQRPGQGLEWIGAIDTSDSYTSYNQKFKGKATLTVDESSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V701 trav AAHY01717921.1 428 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSGTPYLFWYVQYPRQGLQMLLKYYPGDPVVQGVNGFEAEFSKSDSSFHLRKPSVHWSDSAVYFCAVS
Mus musculus V705 trav AAHY01740637.1 427 VSSQEKVQQSPESLIVPEGAMSSLNCTFSNSASQSIWWYQQHPGKGPEALISIFSNGNKKEGRLTVYLNRASLHVSLHIRDSQPSDSAVYLCAV
Mus musculus V708 trdv AAHY01760521.1 399 CNVAQRVTQVQPTGSSQWGEEVTLDCSYETSEYFYRIFWYRQLFSGEMVFLIYQPSFDTQNQRSGRYSVVFQKSFKSISLVISASQPEDSGTYFCALSEL
Mus musculus V711 ighv AAHY01802074.1 601 VHSQVQLQQPGSVLVRPGASVKLSCKASGYTFTSSWMHWAKQRPGQGLEWIGEIHPNSGNTNYNEKFKGKATLTVDTSSSTAYVDLSSLTSEDSAVYYCA
Mus musculus V849 trbv AAHY01052872.1 289238 PVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAKKPLEFMFSYSYQKLMDNQTASSRFQPQSSKKNHLDLQITALKPDDSATYFCASSQ
Mus musculus V850 trbv AAHY01052872.1 288412 HTGPKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSL
Mus musculus V851 trbv AAHY01052872.1 277340 PLETAVFQTPNYHVTQVGNEVSFNCKQTLGHDTMYWYKQDSKKLLKIMFSYNNKQLIVNETVPRRFSPQSSDKAHLNLRIKSVEPEDSAVYLCASS
Mus musculus V852 trbv AAHY01052872.1 274423 LMNTKITQSPRYLILGRANKSLECEQHLGHNAMYWYKQSAEKPPELMFLYNLKQLIRNETVPSRFIPECPDSSKLLLHISAVDPEDSAVYFCASSQ
Mus musculus V853 trbv AAHY01052872.1 223172 SADSGVVQSPRHIIKEKGGRSVLTCIPISGHSNVVWYQQTLGKELKFLIQHYEKVERDKGFLPSRFSVQQFDDYHSEMNMSALELEDSAMYFCASS
Mus musculus V854 trbv AAHY01052872.1 220774 HMEAAVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSD
Mus musculus V855 trbv AAHY01052872.1 217875 SANSGVVQSPRYIIKGKGERSILKCIPISGHLSVAWYQQTQGQELKFFIQHYDKMERDKGNLPSRFSVQQFDDYHSEMNMSALELEDSAVYFCASS
Mus musculus V856 trbv AAHY01052872.1 215410 HMEAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGD
Mus musculus V857 trbv AAHY01052872.1 206657 HMEAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSD
Mus musculus V858 trbv AAHY01052872.1 201630 LSEAGVTQSPRYAVLQEGQAVSFWCDPISGHDTLYWYQQPRDQGPQLLVYFRDEAVIDNSQLPSDRFSAVRPKGTNSTLKIQSAKQGDTATYLCASSF
Mus musculus V859 trbv AAHY01052872.1 195587 HTDAGVTQTPRHEVAEKGQTIILKCEPVSGHNDLFWYRQTKIQGLELLSYFRSKSLMEDGGAFKDRFKAEMLNSSFSTLKIQPTEPKDSAVYLCASSL
Mus musculus V860 trbv AAHY01052872.1 185016 PTNAGVIQTPRHKVTGKGQEATLWCEPISGHSAVFWYRQTIVQGLEFLTYFRNQAPIDDSGMPKERFSAQMPNQSHSTLKIQSTQPQDSAVYLCASSL
Mus musculus V861 trbv AAHY01052872.1 173689 FVDTTVKQNPRYKLARVGKPVNLICSQTMNHDTMYWYQKKPNQAPKLLLFYYDKILNREADTFEKFQSSRPNNSFCSLYIGSAGLEYSAMYLCASSR
Mus musculus V863 trbv AAHY01052872.1 134204 SMDSGVVQNPRHLVKGKEQKAKMDCTPINGHSYVYWYYKKPGEELKFLVYFQNEDIIDKIDMIGKNISAKCPAKKPCTIEIQSSKLTDSAVYFCASSQ
Mus musculus V864 trbv AAHY01052872.1 120718 SFDAAVTQKPRYLIKMKGQEAEMKCIPEKGHTAVFWYQQKQSKELKFLIYFQNQQPLDQIDMVKERFSAVCPSSSLCSLGIRTCEAEDSALYLCSSSQ
Mus musculus V865 trbv AAHY01052872.1 109257 ILNSKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSL
Mus musculus V866 trbv AAHY01052872.1 65377 LVDMKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSL
Mus musculus V867 trbv AAHY01052872.1 55274 SVFSVLLYQKPNRDICQSGTSLKIQCVADSQVVSMFWYQQFQEQSLMLMATANEGSEATYESGFTKDKFPISRPNLTFSTLTVNNARPGDSSIYFCSSR
Mus musculus V868 igkv AAHY01052936.1 18977 ATGDIVMTQAAPSVPANPGESVSISCRSSKSLLHSSGNTYLYWFLQRPGQSPQLLIYYISNLASGVPDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQGLEYP
Mus musculus V869 igkv AAHY01052936.1 13936 ARCDIQMTQSPSSMSASLRERVSLTCQASQGINGNLHWFQQKSGGTLKHLIYSTSNLDSGVPSRFSGSGSGSDYSLTISSLESEDFAVYYCLQYDEYP
Mus musculus V875 igkv AAHY01054006.1 73632 TNGDVVMTQTPLTLSVTIGQPASISCKSSQSLLHSNGKTYLNWLQQRPGQAPKRLFYLVSKLDPGIPDSFSGSGSETDFTLKISRVEAEDLGVYYCLQG
Mus musculus V876 igkv AAHY01054010.1 47344 ARCDIQMIQSPSSMFASLGDRVSLSCRASQGIRGNLDWYQQKPGGTIKLLIYSTSNLNSGVPSRFSGSGSGSDYSLTISSLESEDFADYYCLQRNAYP
Mus musculus V877 igkv AAHY01054010.1 35190 TRCDIQMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYASYP
Mus musculus V878 igkv AAHY01054047.1 11012 TRCDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLP
Mus musculus V879 igkv AAHY01054054.1 20111 TRCDIQMTQTTSSLSASLGDRVTISCSASQGISNYLNWYQQKPDGTVKLLIYYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKLP
Mus musculus V880 igkv AAHY01054055.1 42347 IVSNGEIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFSPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSI
Mus musculus V881 igkv AAHY01054055.1 28821 SKGEMVLTQSPVSITASRGEKVTITCRASSSISSNYLHWYQQKPGSSPKLLIYRTSILASGVLDSFSGSGSESSYTLTISCMQDEVAATYYCQQGSSS
Mus musculus V882 igkv AAHY01054055.1 10077 AQCDIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLL
Mus musculus V883 igkv AAHY01054056.1 46302 VVVRCDIQMTQSPASLSASVGETVTITCGASENIYGALNWYQRKQGKSPQLLIYGATNLADGMSSRFSGSGSGRQYSLKISSLHPDDVATYYCQNVLSTP
Mus musculus V884 igkv AAHY01054056.1 18636 ILTNGEILLTQSPAIIAASPGEKVTITCSASSSVSYMNWYQQKPGSSPKIWIYGISNLASGVPARFSGSGSGTSFSFTINSMEAEDVATYYCQQRSSY
Mus musculus V885 igkv AAHY01054059.1 80486 IICDIQMTQSSSYLSVSLGGRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTP
Mus musculus V886 igkv AAHY01054059.1 60626 SRGEIVLTQSPAITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIYEISKLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPL
Mus musculus V887 igkv AAHY01054059.1 30462 VLCDIQMTQSSSFLSASLGDHLTINCRASKDINKYFAWVQQKPRKAPRMLIHFASTLLPGVPEKFSGSGSGTDFSLTIRNIESEDIAMYYCLQYSEHP
Mus musculus V888 igkv AAHY01054059.1 12565 SRGDVVVTQTPLSLPVSFGDQVSISCRSSQSLANSYGNTYLSWYLHKPGQSPQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISTIKPEDLGMYYCLQG
Mus musculus V889 igkv AAHY01054064.1 31915 IMSRGQIVLTQSPAIMSASLGEEITLTCSASSSVSYMHWYQQKSGTSPKLLIYSTSNLASGVPSRFSGSGSGTFYSLTISSVEAEDAADYYCHQWSSY
Mus musculus V890 igkv AAHY01054064.1 6125 IMSRGENVLTQSPAIMAASPGEKVTMTCSASSSVSSSNLHWYQQKSGTSTKFWIYRTSNLASEVPAPFSGSGSGTSYSLTISSVEAEDAATYYCQQWSGY
Mus musculus V891 igkv AAHY01054066.1 9981 IMSRGQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSYLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSY
Mus musculus V892 igkv AAHY01054071.1 31451 QIVLTQSPAIMSASPGERVTMTCSASSSVSSSYLYWYQQKSGSSPKLWIYSISNLASGVPARFSGSGSGTSYSLTINSMEAEDAATYYCQQWSSN
Mus musculus V893 igkv AAHY01054071.1 18708 IMSRGQIVLTQSPAIMSASLGERVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRS
Mus musculus V894 igkv AAHY01054074.1 26065 ILFRGQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKPGSSPRLWIYLTFNLASGVPARFSGSGSGTSYSLSISSMEAEDAATYYCQQWSSN
Mus musculus V895 igkv AAHY01054074.1 9759 IMSRGQIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYATSNLASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQQWSSN
Mus musculus V896 igkv AAHY01054078.1 1652 ILSRGQIVLTQSPAIMSASPGEKVTMTCSASSSISYMHWYQQKPGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQRSSY
Mus musculus V897 igkv AAHY01054079.1 734 IMSRGQILLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKPGSSPKPWIYDTSNLASGFPARFSGSGSGTSYSLIISSMEAEDAATYYCHQRSSY
Mus musculus V898 igkv AAHY01054080.1 9184 IMSRGQIVLTQSPALMSASPGEKVTMTCSASSSVSYMYWYQQKPRSSPKPWIYLTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSN
Mus musculus V899 igkv AAHY01054081.1 75860 IMSRGQIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQQKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQYHSY
Mus musculus V900 igkv AAHY01054081.1 58781 ILSRGQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLWIYDTSNLVSGVPARFSGSRSGTSYSLTISSMEAEDAATYYCQQYSGYP
Mus musculus V901 igkv AAHY01054081.1 36914 IMSRGENVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSSTSPKLWIYDTSKLASGVPGRFSGSGSGNSYSLTISSMEAEDVATYYCFQGSGY
Mus musculus V902 igkv AAHY01054083.1 16290 IISRGQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSN
Mus musculus V903 igkv AAHY01054086.1 4836 ILSSGEIVLTQSPALMAASPGEKVTITCSVSSSISSSYLHWYQQKSGISPKPWIYGTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSS
Mus musculus V904 igkv AAHY01054089.1 7227 IMSRGENVLTQSPAIMAASLGQKVTMTCSASSSVSSSYLHWYQQKSGASPKPLIHRTSNLASGVPARFSGSGSGTSYSLTISSVEAEDDATYYCQQWSGYP
Mus musculus V905 igkv AAHY01054092.1 49706 ILSRGQIVLTQSPAIMSASPGQKVTITCSAISSVNYMHWYQQKPGSSPKLWIYATSKLALGVPACFSGSGSGTSYSLTISSMVAEDATSYFCHQWSSY
Mus musculus V906 igkv AAHY01054092.1 38386 IMSRGQIVLTQSPAIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSY
Mus musculus V907 igkv AAHY01054092.1 6788 AMSRGENVLTQSPAIMSASPGEKVTMTCRASSSVSSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQYSGY
Mus musculus V908 igkv AAHY01054094.1 11570 ILSRGQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTSYSLTISRMEAEDAATYYCQQWSSY
Mus musculus V909 igkv AAHY01054095.1 25769 ILSSGEIVLTQSPALMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLASGVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSY
Mus musculus V910 igkv AAHY01054098.1 15395 IMSRGENVLTQSPAIMAASLGEKVTMTCSASSSVSSSYLHWYQQKSGTSPKLWIYGTSNLASGVPARFSGSGAGISYSLTISSMEAENDATYYCQQWSGYP
Mus musculus V912 igkv AAHY01054100.1 13990 VMSRGENVLTQSPAIMSASLGEKVTMSCRASSSVNYMYWYQQKSDASPKLWIYYTSNLAPGVPARFSGSGSGNSYSLTISSMEGEDAATYYCQQFTSSP
Mus musculus V913 igkv AAHY01054101.1 72744 SRGDIVLTQSPATLSVTPGDRVSLSCRASQSISNYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSW
Mus musculus V914 igkv AAHY01054101.1 61517 ARCDIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGKSPQLLVYAATNLADGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTP
Mus musculus V915 igkv AAHY01054101.1 47816 ARCDIQVTQSPASLSAPVGESVSITCKASEEIYSALNWYQQKPGKSPQLLIYYATSLGDDVPSRFSGSKSGTQYSLKISSLQPEDLATYYCEQSYK
Mus musculus V916 igkv AAHY01054101.1 23567 SRGDILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNSWP
Mus musculus V917 igkv AAHY01054106.1 22155 SRGDIVLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSW
Mus musculus V918 igkv AAHY01054106.1 13432 ARCDIQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTP
Mus musculus V919 igkv AAHY01054107.1 22019 ARCDIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP
Mus musculus V920 igkv AAHY01054110.1 17050 AGCDIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQGKSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINSMQPEDTATYFCKQAYDVP
Mus musculus V921 igkv AAHY01054112.1 9585 SAVTGETTQAPASLSFSLGETATLSCRSSESVGSYLAWYQQKAEQVPRLLIHSASTRAGGVPVRFSGTGSGTDFTLTISSLEPEDAAVYYCQPFKSWS
Mus musculus V922 igkv AAHY01054113.1 8289 ISGDVVMTQTPLTLSATIGQSASVSCRSSQSLLHSNGNTYLNWFVQRPGPSPQLLIYGVFEQESGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCMQATYEP
Mus musculus V923 igkv AAHY01054117.1 22617 AHGSIVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGYGTDFTFTISTVQAEDLAVYFCQQDYSSP
Mus musculus V924 igkv AAHY01054117.1 7234 ACADIVMTQSPTFLAVTASKKVTISCTASESLYSSKHKVHYLAWYQKKPEQSPKLLIYGASNRYIGVPDRFTGSGSGTDFTLTISSVQVEDLTHYYCAQFYSYP
Mus musculus V925 igkv AAHY01054118.1 26455 ADGNIVMTQSPKSMSMSVGERVTLSCKASENVGTYVSWYQQKPEQSPKLLIYGASNRYPGVPDRFTGSGSATDFTLTISSLQAEDLADYHCGQGYSYL
Mus musculus V926 igkv AAHY01054118.1 5083 TCGDIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYYSYP
Mus musculus V927 igkv AAHY01054119.1 32149 TCGNIMMTQSPSSLAVSAGEKVTMSCKSSQSVLYSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCHQYLS
Mus musculus V928 igkv AAHY01054119.1 3938 TCGDIVMTQSPSSLSVSAGEKVTMSCKSSQSLLNSGNQKNYLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYP
Mus musculus V929 igkv AAHY01054121.1 8646 ACADIVMTQSPSSLAMSVGQKVTMSCKSSQSLLNSSNQKNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHY
Mus musculus V930 igkv AAHY01054122.1 1549 VEGDIVMTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYP
Mus musculus V931 igkv AAHY01054131.1 2727 TCGDIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNL
Mus musculus V932 igkv AAHY01054132.1 8410 ADGNIVMTQSPKSMSMSVGERVTLSCKASENVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQSYSYP
Mus musculus V933 igkv AAHY01054133.1 4071 TCGDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYP
Mus musculus V934 igkv AAHY01054136.1 3158 VDGDIVMTQSQKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYNSYP
Mus musculus V935 igkv AAHY01054137.1 38048 VDGDIVMTQSQKFMSTSVGDRVSITCKASQNVGTAVAWYQQKPGQSPKLLIYSASNRYTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSYP
Mus musculus V936 igkv AAHY01054137.1 15499 VDGDIVMTQSQKFMSTSVGDRVSITCKASQNVRTAVAWYQQKPGQSPKALIYLASNRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCLQHWNYP
Mus musculus V1031 iglv AAHY01086815.1 32683 FQPTLTQPDAFSVFPGQDAHLSCTINSQHATAGDIGVSWYQQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAAHNACILTISPVLPEDDADYFCSI
Mus musculus V1080 ighv AAHY01103749.1 11172 VLSQVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCAR
Mus musculus V1081 ighv AAHY01103749.1 1410 VQCEVQLVESGGGLVQPGESLKLSCESNEYEFPSHDMSWVRKTPEKRLELVAAINSDGGSTYYPDTMERRFIISRDNTKKTLYLQMSSLRSEDTALYYCA
Mus musculus V1082 ighv AAHY01103766.1 637 VKCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYYMSWVRQTPEKRLEWVAYISSGGGSTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCA
Mus musculus V1083 ighv AAHY01103767.1 917 VQCDVKLVESGGGLVKPEGSLKLSCAASGFAFSSYGMAWVRQTPEKRLEWVATISNGGVSTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCT
Mus musculus V1084 ighv AAHY01103777.1 4514 ILSQVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGSTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCAR
Mus musculus V1085 ighv AAHY01103786.1 15243 VQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSDYGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNAKNTLFLQMTSLRSEDTAMYYCA
Mus musculus V1088 trgv AAHY01104630.1 44669 RQTSSNLEERIMSITKLEGSSAIMTCDTHRTGTYIHWYRFQKGRAPEHLLYYNFVSSTTVVDSRFNLEKYHVYEGPDKRYKFVLRNVEESDSALYYCASWA
Mus musculus V1089 trgv AAHY01104630.1 37663 GHGKLEQPEISISRPRDETAQISCKVFIESFRSVTIHWYRQKPNQGLEFLLYVLATPTHIFLDKEYKKMEASKNPSASTSILTIYSLEEEDEAIYYCSYG
Mus musculus V1090 trgv AAHY01104630.1 32257 SEGSSLTSPLGSYVIKRKGNTAFLKCQIKTSVQKPDAYIHWYQEKPGQRLQRMLCSSSKENIVYEKDFSDERYEARTWQSDLSSVLTIHQVTEEDTGTYYCACWD
Mus musculus V1091 trgv AAHY01104630.1 30440 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLHNTIVHWYQLKEGEPLRRIFYGSVKTYKQDKSHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Mus musculus V1092 trgv AAHY01104631.1 48804 GLGQLEQTELSVTRATDESAQISCIVSLPCFSNTAIHWYRQKPNQQFEYLIYVETNYNQQPLGGKNKKIEASKDFQTSTSTLKINYLKKEDEATYYCAVWI
Mus musculus V1093 trgv AAHY01104635.1 28137 GLGQLEQTELSVTRETDESAQISCIVSLPYFSNTAIHWYRQKAKKFEYLIYVSTNYNQRPLGGKNKKIEASKDFQTSTSTLKINYLKKEDEATYYCAVWI
Mus musculus V1118 trav AAHY01113909.1 7239 AAGQGVEQPDNLMSVEGTFARVNCTYSTSGFNGLSWYQQREGHAPVFLSYVVLDGLKDSGHFSTFLSRSNGYSYLLLTELQIKDSASYLCAVR
Mus musculus V1119 trav AAHY01113924.1 53439 SWSLAKTTQPPSMEAYEGQEVNVSCSHTNIATSEYIYWYRQVPHQGPQFIIQGYKDYVVNEVASLFISADRKLSTLSLPWVSLRDAAVYYCIVT
Mus musculus V1120 trav AAHY01113924.1 41663 VSRGEQVEQRPPHLSVREGDSAIIICTYTDSATAYFSWYKQEAGAGLQLLMSVLSNVDRKEEQGLTVLLNKKDKRLSLNLTAAHPGDSAVYFCAVS
Mus musculus V1121 trav AAHY01113924.1 6205 KSQGEQVEQLPSSLIVQEGASVLINCSYTDSASVYFPWYKQEPGKRLQFIIDIRSNMERKQNQRLTLLFDKKTKHLSLHITATQPGDSAIYFCSAS
Mus musculus V1122 trav AAHY01113925.1 28600 RTHGDSVTQMQGQVTLSEDDFLFINCTYSTTWYPTLFWYVQYPGEGPQLLLKVTTANNKGISRGFEATYDKRTTSFHLQKASVQESDSAVYYCVLG
Mus musculus V1123 trav AAHY01113925.1 13375 VNSQQKVQQSPESLIVPEGGMASLNCTFSDRNSQYFWWYRQHSGEGPKALMSIFSNGDKKEGRFTAHLNKASLYVSLHIKDSQPSDSALYFCAV
Mus musculus V1124 trav AAHY01113925.1 5427 RTHGNSVTQMQGQVTLSEEEFLFINCTYSTTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCVLG
Mus musculus V1125 trav AAHY01113929.1 11926 VNSQQKVQQSPESLIVPEGGMASLNCTSSDRNVDYFWWYRQHSGKSPKMLMSIFSNGEKEEGRFTVHLNKASLHTSLHIRDSQPSDSALYLCAA
Mus musculus V1126 trav AAHY01113932.1 8991 VNSQQKVQQSPESLIVPEGAMTSLNCTFSDSASQYFAWYRQHSGKAPKALMSIFSNGEKEEGRFTIHLNKASLHFSLHIRDSQPSDSALYLCAV
Mus musculus V1127 trav AAHY01113933.1 3679 MRKTHGDSVTQKQGQVTLSEDDFLFINCTYSTTTYPTLFWYVQYPGQGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQESDSAVYFCALV
Mus musculus V1128 trav AAHY01113934.1 15830 ESNGDSVTQTEGPVTLSEGTSLTVNCSYETKQYPTLFWYVQYPGEGPQLLFKVPKANEKGSNRGFEATYNKEATSFHLQKASVQESDSAVYYCALGDTVAE
Mus musculus V1129 trav AAHY01113934.1 1399 ESHGEKVEQHQSTLSVREGDSAVINCTYTDTASSYFPWYKQEAGKSLHFVIDIRSNVDRKQSQRLTVLLDKKAKRFSLHITATQPEDSAIYFCAA
Mus musculus V1130 trav AAHY01113935.1 8161 RTHGDSVTQTEGQVTVSESKSLIINCTYSATSIAYPNLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Mus musculus V1131 trav AAHY01113935.1 5641 VAGKTQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVHENDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVG
Mus musculus V1132 trav AAHY01113936.1 29577 VKGQQVQQSPASLVLQEGENAELQCNFSTSLNSMQWFYQRPGGSLVSLFYNPSGTKQSGRLTSTTVIKERRSSLHISSSQTTDSGTYLCAMEPQCS
Mus musculus V1133 trdv AAHY01113936.1 14894 SNVAQKVIQVWSTASRQEGEELTLDCSYETSQVLYHLFWYKHLLSGEMVFLIRQMSSSTAKERSGRYSVVFQKSLKSISLVISALQPDDSGKYFCALWEL
Mus musculus V1134 trav AAHY01113938.1 4380 DAQAQSVTQPDARVTVSQGASLQLRCKYSYSGTPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHPRKASVHWSDSAVYFCAVS
Mus musculus V1135 trav AAHY01113939.1 5686 GVSGDKVKQSPSALSLQEGTNSALRCNFSIAATTVQWFLQNPRGSLINLFYLVPGTKENGRLKSTFNSKESYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V1136 trav AAHY01113943.1 57644 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVS
Mus musculus V1137 trav AAHY01113943.1 46576 RSNGDGDSVTQTEGLVTLTEGLPVMLNCTYQTIYSNAFLFWYVHYLNESPWLLLRSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus musculus V1138 trav AAHY01113943.1 33587 VKGQQVQQSPASLVLQEGENAELQCNFSSTATRLQWFYQHPGGRLVSLFYNPSGTKHTGRLTSTTVTNERRSSLHISSSQTTDSGTYFCAIDPQCS
Mus musculus V1139 trdv AAHY01113943.1 19701 CNVAQRVTQVQPTGSSQWGEEVTLDCSYETSEYFYCIIWYRQLFSGEMVFLIYQTSFDTQNQRNGRYSVVFQKSLKSISLVISASQPEDSGTYFCALSEL
Mus musculus V1140 trav AAHY01113943.1 4013 VSRGEQVEQRPPHLSVREGDSAFITCTYTDPNSYYFFWYKQEPGASLQLLMKVFSSTEINEGQGFTVLLNKKDKRLSLNLTAAHPGDSAAYFCAVS
Mus musculus V1141 trav AAHY01113944.1 1137 MAQGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG
Mus musculus V1143 trav AAHY01113961.1 17060 VKGQQVQQSPASLVLQEGENAELQCNFSSTATRLQWFYQRPGGSLVSLLYNPSGTKHTGRLTSTTVTKERRSSLHISSSQITDSGTYFCAMEPQCS
Mus musculus V1144 trav AAHY01113969.1 32525 VKGQQVQQSPASLVLQEGENAELQCSFSISTNQVQWFYQRPGGRLIGLSYIPGMKPTGKQTSSTVTKGRHSSLTISSSQTTDSGTYFCVLSTQCSP
Mus musculus V1145 trav AAHY01113969.1 16742 GNSAQSVDQPDAHVTLYEGASLELRCSYSYSAAPYLFWYVQYPGQSLQFLLKYITGDAVVKGTKGFEAEFRKSNSSFNLKKSPAHWSDSAKYFCALE
Mus musculus V1146 trav AAHY01113970.1 1794 VATQRLEQSPRFLSIQEGQDFTARCSSSTTFPQLYWYRQVPREGPVILVTLVKSGEVKEQKRMTAKFGEARKNSSLFIARAQPGDAGIYFCTG
Mus musculus V1147 trav AAHY01113972.1 28430 IAGDAKTTQPDSMESTEGETVHLPCSHATISGNEYIYWYRQVPLQGPEYVTHGLQQNTTNSMAFLAIASDRKSSTLILTHVSLRDAAVYHCILRV
Mus musculus V1150 trdv AAHY01113976.1 33947 ASMAQTVSQHQQEKSVQVAESATLDCTYDTSDTNYLLFWYKQQGGQVTLVIRQEAYKQYNAMENRFSVNFQKAAKSFSLEISDSQLGDAATYFCALRG
Mus musculus V1151 trdv AAHY01113976.1 23104 ASMAQTVSQPQKKKSVQVAESATLDCTYDTSDTNYLLFWYKQQGGQVTLVILQEAYKQYNATLNRFSVNFQKAAKSFSLEISDSQLGDAATYFCALME
Mus musculus V1152 trdv AAHY01113978.1 105534 TSLDVYLEPVAKTFTVVAGDPASFYCTVTGGDMKNYHMSWYKKNGTNALFLVYKLNSNSTDGGKSNLKGKINISKNQFILDIQKATMKDAGTYYCGSD
Mus musculus V1187 iglv AAHY01126135.1 7999 AISQAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNH
Mus musculus V1188 iglv AAHY01126139.1 12060 ASSQAVVTQESALTTSPGGTVILTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTSNRAPGVPVRFSGSLIGDKAALTITGAQTEDDAMYFCALWY
Mus musculus V1241 ighv AAHY01145058.1 1481 VHCQIQLQQSGPELVKPGAPVKISCKASGYTFTNYYIHWVKQRPGQGLEWIGYIYPGNGGTAYNQKFKGKATLTADNPSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1242 ighv AAHY01145361.1 1154 VNSQVQLQQPGAEIVRPGASVKLSCKASGYTFTDYWMNWVKQRPGQGLEWIGVIDPSDSYTSYNQKFKGKATLTVDESSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1243 ighv AAHY01145572.1 1922 ILSDVQLQESGPGMVKPSQSLSLTCTVTGYSITSGYDWHWIRHFPGNKLEWMGYISYSGSTNYNPSLKSRISITHDTSKNHFFLKLNSVTTEDTATYYCAR
Mus musculus V1244 ighv AAHY01145573.1 4455 VHSEVQLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHGNILDWIGYIYPYNGVSSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V1245 ighv AAHY01145753.1 7645 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFGMGVGWIRQPSGKGLEWLAHIWWDDDKYYNPALKSRLTISKDTSKNQVFLKIANVDTADTATYYCARI
Mus musculus V1247 trav AAHY01146139.1 928 GVSGDKVKQSPSALSLQEGTNSALRCNFSIAATTVQWFLQNPRGSLMNLFYLVPGTKENGRLKSAFDSKESYSTLHIRDAQLEDSGTYFCAAE
Mus musculus V1248 ighv AAHY01146505.1 4884 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVDWVRQPPGKGLEWLGVIWGGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCA
Mus musculus V1249 trav AAHY01146838.1 2405 VKGQQVQQSPSSLVLQEGENAELQCNFSSTATQLQWFYQSPGGSLVSLLSNPSGTKHTGRLTSTTVTKERRSSLHISSSQTTDSGTYLCAIDPQCS
Mus musculus V1250 ighv AAHY01146941.1 2012 VHSEVQLQQSGPELVKPGASVKISCKASGYSFTGYYMNWVKQSPEKSLEWIGEINPSTGGTTYNQKFKAKATLTVDKSSSTAYMQLKSLTSEDSAVYYCA
Mus musculus V1251 ighv AAHY01147958.1 2925 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGMIHPNSGSTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1252 trav AAHY01148095.1 700 RSNGDGDSVTQTEGLVTLTEGLPVMLNCTYQTIYSNPFLFWYVHYLNESPRLLLKSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus musculus V1253 trav AAHY01148104.1 858 DAQAQSVTQPDARVTVSEGASLQLRCKYSSSGTPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCVLS
Mus musculus V1254 ighv AAHY01149287.1 3370 VHSQVQLQQSGAELVKPGASVKLSCKASDYTFTSYDINWVKQRPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1256 ighv AAHY01149404.1 1265 VHSQVQLQQPGAELVRPGTSVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGVIDPSDSYTNYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1258 ighv AAHY01150463.1 2207 GIQSQVHLQQSGSELRSPGSSVKLSCKDFDSEVFPIAYMSWVRQKPGHGFEWIGGILPSIGRTIYGEKFEDKATLDADTLSNTAYLELNSLTSEDSAIYYCA
Mus musculus V1259 ighv AAHY01150934.1 1571 VHCEVQLVESAGGLVQPKGSLKLSCAASGFSFNTYAMNWVRKAPGKGLEWVARTMSKNNNYATYYADSVKDRFTITRDDSQSMLYLQMNNLKTEDTAMYYCVK
Mus musculus V1260 ighv AAHY01151714.1 352 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1261 ighv AAHY01151896.1 790 VLSEVQLQQSGPELVKPGPSVKISCKASGYSFTGYYMHWVKQSHGKSLEWIGLIIPYNGDTFYNQKFKGKATLTVDTSSSTAYMELGSLTSEDSAVYYCA
Mus musculus V1262 ighv AAHY01152941.1 606 VFSEVQLQQSGPELVKPGASVKISCKASGYSFTGYFMNWVMQSHGKSLEWIGRINPYNGDTFYNQKFKGKATLTVDKSSSTAHMELRSLASEDSAVYYCA
Mus musculus V1263 ighv AAHY01152952.1 1260 VLSEVQLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHVKSLEWIGRINPYNGATSYNQNFKDKASLTVDKSSSTAYMELHSLTSEDSAVYYCA
Mus musculus V1264 trav AAHY01153076.1 1166 VRSQQKVQQSPESLSVPEGGMASLNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYFCAAS
Mus musculus V1265 ighv AAHY01154171.1 478 VHSQVQLQQSGPELVRPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGMIDPSNSETRLNQKFKDKATLNVDKSSNTAYMQLSSLTSEDSAVYYCA
Mus musculus V1266 ighv AAHY01154236.1 1928 VHSVVQLQQSGPELVKPGDSVKISCKASGYSFTDYYMHWVKQSPEKSLEWIGEINPSTGGTSYNQKFKGKATLTVDKSSSTAYMQLKSLTSEDSAVYYCA
Mus musculus V1267 ighv AAHY01154627.1 703 VQCEVKLDETGGGLVQPGRSMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRAEDMGIYYCT
Mus musculus V1270 ighv AAHY01155717.1 7273 VQCEVKLLESGGGLVQPGGSLNLSCAASGFDFSRYWMSWARQAPGKGQEWIGEINPGSSTINYTPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCAR
Mus musculus V1271 ighv AAHY01155726.1 8896 VNSEVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYASKFQGKATITADTSSNTAYMQLSSLTSEDTAVYYCA
Mus musculus V1272 ighv AAHY01155735.1 3793 AQAQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDMATYFCA
Mus musculus V1273 ighv AAHY01155751.1 3108 IQAQIQLVQSGPELKKPGETVKISCKASGYTFTGYSMQWVKQAPGKGLKWMGWINTETGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCA
Mus musculus V1274 ighv AAHY01155760.1 1460 VNSEVQLQQSGAELVRPGASVKLSCTASGFNIKDDYMNWVKQRPERGLEWIGWIDPENGDTEYASKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCT
Mus musculus V1275 ighv AAHY01155769.1 4067 ILSDVQLQESGPSLVRPSQTLSLTCTVTGFSINSDCYWIWIRQFPGNKLEYIGYTFYSGITYYNPSLESRTYITRDTSKNQFSLKLSSVTTEDTATYYCAR
Mus musculus V1276 ighv AAHY01155771.1 17011 ILSDVQLQESGPGLVKPSQTVSLTCTVTGYSITNGNHWWNWIRQVSGNKLEWMGYISSSGSTDSNPSLKSQISITRDTSKNQLFLQLNSVTIEDIATYYCAR
Mus musculus V1277 ighv AAHY01155771.1 773 IQCEVKLMESGGGLVQPGASLRLSCEASGFTFTDYYMSWVRQPPGKSPEWLALIRNKANGYTTEYSASVKGRFTISRDNSQNILYLQMNTLRAEASATYYCAKD
Mus musculus V1278 ighv AAHY01155772.1 3818 ILSDVQLQESGPGLVKPSQTVSLTCTVTGISITTGNYRWSWIRQFPGNKLEWIGYIYYSGTITYNPSLTSRTTITRDTSKNQFFLEMNSLTAEDTATYYCAR
Mus musculus V1279 ighv AAHY01155776.1 11024 ILSDVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCAR
Mus musculus V1280 ighv AAHY01155781.1 5684 ILSEVQLQESGPGLAKPSQTLSLTCSVTGYSITSDYWNWIRKFPGNKLEYMGYISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCAR
Mus musculus V1281 ighv AAHY01155783.1 25853 SLSQMQLQESGPGLVKPSQSLFLACSITGFPITSGYYWIWIRQSPGKPLEWMGYITHSGETFYNPSLQSPISITRETSKNQFFLQLNSVTTEDTAMYYCAGD
Mus musculus V1282 ighv AAHY01155783.1 17091 VQCQVQLVETGGGLARPGNSLKLSCVTSGFTFSNYRMHWLRQPPGKRLEWIAVITVKSDNYGANYAESVKGRFTISRDDSKSSVYLQMNRLREEDTATYYCS
Mus musculus V1283 ighv AAHY01155786.1 1574 VQSEVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMYWVRQSPEKGLEWVAEIRLKSDNYATHYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCT
Mus musculus V1284 ighv AAHY01155799.1 1731 VYSQVQLQQSGAELARPGASVKMSCKASGYTFTSYWMQWVKQRPGQGLEWIGAIYPGDGDTRYTQKFKGRATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1285 ighv AAHY01155802.1 815 VHCEVQLVESGGGLVQPKGTLKLSCAASGFSFNTYAMNWVRQAPGKSLEWVARTMSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus musculus V1286 ighv AAHY01155807.1 1327 VHCEVQLVESGGRLVQPKGSLKLSCAASGFTFNTYAMYWIRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus musculus V1287 ighv AAHY01155808.1 2941 VHSQVQLQQSGAELAKPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGYINPSSGYTKYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1288 ighv AAHY01155954.1 1227 VLSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYVMHWVKQSNGKSLEWIGYINPYNDYTSYNQKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCA
Mus musculus V1289 ighv AAHY01155956.1 3104 VHSEIQLQQSGPELVKPGASVKVSCKASGYAFTSYNMYWVKQSHGKSLEWIGYIDPYNGGTSYNQKFKGKATLTIDKSSSTAYMHLNSLTSEDSAVYYCA
Mus musculus V1290 ighv AAHY01155972.1 1068 VLSEVQLQQSGPELLKPGASVKISCKASGYTFTDYTMHWVKQSHGKSLEWIGGINPNYGGTSYNEKFKDKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V1291 ighv AAHY01156001.1 1730 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVGWIRQPSGKGLEWLAHIWWNDDKYYNPTLKSRLTISKDTSNNQVFLKIASVDTADTATYYCARI
Mus musculus V1292 ighv AAHY01159305.1 602 VQSEVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus musculus V1293 ighv AAHY01159937.1 1103 VLSQVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCAR
Mus musculus V1294 ighv AAHY01160340.1 911 VQSDVNLEVSGGGLVKPGGSMQRSCVDSGFTFVDGWMDWVCQSPEKGLEWVAEIANKANNYATYYPESVKGRFTISRDDFKSRVYLQKNSLRAEDTGIYYCT
Mus musculus V1295 ighv AAHY01162200.1 1525 VHSEVQLQQSGAELVRPGSSVKMSCKTSGYTFTSYGINWVKQRPGQGLEWIGYIYIGNGYTEYNEKFKGKATLTSDTSSSTAYMQLSSLTSEDSAIYFCA
Mus musculus V1296 ighv AAHY01163114.1 700 VQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYYCA
Mus musculus V1297 ighv AAHY01166008.1 1314 VHSEIQLQQSGPELVKPGASVKVSCKASGYAFTDYNMYWVKQSHGKSLEWIGYIDPYNGGTSYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCA
Mus musculus V1299 ighv AAHY01166602.1 2078 VHSHVQLQQSGPELVRPGASVKLSCKASGYIFITYWMNWVKQRPGQGLEWIGQIFPASGSTNYNEMFEGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1300 ighv AAHY01166693.1 1549 VHSQVQLQQPGAELVRPGASVKLSCKASSYTFTRYWMNWVKQRPEQGLEWIGRIDPYDSETHYNQKFKDKAILTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1301 ighv AAHY01166795.1 1935 VLSQVILKESGPGILQPSQTLSLTCSFSGFSLSTYGTAVNWMRQPSGKGLEWLAQIGSDDSKLYNPSLKSRITISKDTSNSQVFLKITSVDTEDSATYYCANR
Mus musculus V1302 ighv AAHY01166921.1 980 VQSQVQLQQSGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPVHGLEWIGAIDPETGGTAYNQKFKGKAILTADKSSSTAYMELRSLTSEDSAVYYCT
Mus musculus V1303 ighv AAHY01166925.1 4202 ILSQVQLQQSGPELVIPRASVKLSCKASGYNFNYYEIQWVKQSLKQGLEWIGATHPENGGITYNQKFKGKATFTVDTSSNTAYMQLRSLTSEDTADYYCE
Mus musculus V1304 ighv AAHY01166930.1 754 VHSQVQLQQSGAELMKPGSSVKLSCKATGYTFTGYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCA
Mus musculus V1305 trav AAHY01167586.1 376 VSSQQKVQQSPESLTVSEGAMASLNCTFSDRTSNNFRWYRQHSGKGLEVLVSIFSDGEKEEGRFTAHLNRASLHVSLHIREPQPSDSAVYLCAM
Mus musculus V1307 ighv AAHY01168572.1 394 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVSWIRQPPGKGLEWLGVIWGGGSTYYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCA
Mus musculus V1308 ighv AAHY01171372.1 626 VQCEVKLVESGGGLVQPGGSLKLSCAASGFTFSDYYMYWVRQTPEKRLEWVAYISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCA
Mus musculus V1309 ighv AAHY01171393.1 598 VHSQVQLQQPGAELVKPGTSVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGDIYPGSDSTNYNEKFKSKATLTVDTSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1310 ighv AAHY01171458.1 1163 VHSQVQLQQSGPQLVRPGASVKISCKASGYSFTSYWMHWVKQRPGQGLEWIGMIDPSDSETRLNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCA
Mus musculus V1313 ighv AAHY01174123.1 398 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSNNQVFLKITSVDTADTATYYCAQR
Mus musculus V1314 ighv AAHY01177170.1 5098 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLVVIWSDGSTTYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCA
Mus musculus V1315 ighv AAHY01177177.1 1277 TLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYDISWIRQPPGKGLEWLGVIWTGGGTNYNSAFMSRLSISKDNSKSQVFLKMNSLQTDDTAIYYCVR
Mus musculus V1316 ighv AAHY01177241.1 2380 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEINPSNGRTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1317 ighv AAHY01177243.1 5844 VHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGTIHPYDSETHYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1318 ighv AAHY01177246.1 1374 VHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGMIDPSDSETHYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1319 ighv AAHY01177254.1 12804 VHSEFQLQQSGPELVKPGASVKISCKASGYSFTDYNMNWVKQSNGKSLEWIGVINPNYGTTSYNQKFKGKATLTVDQSSSTAYMQLNSLTSEDSAVYYCA
Mus musculus V1321 ighv AAHY01179626.1 854 VHCQVQLKQSGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRSGQGLEWIARIYPGTGSTYYNEKFKGKATLTADKSSSTAYMQLSSLKSEDSAVYFCA
Mus musculus V1322 ighv AAHY01179676.1 508 VHSQVQLQQPGAELVRPGALVKLSCKASGYTFTRYWIQWVKQRPGQGLEWIGNISPNSGSTNYNEKFKGKATLTVDKSSSTAYMQLNSLTSEDSAAYYCA
Mus musculus V1323 ighv AAHY01179895.1 493 PAEQSGPELVKPGASVKISCKASGYTFTDYYMHWVNQSHGNSLEWIGDINPYYGSTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDTAVYYCA
Mus musculus V1324 trav AAHY01180181.1 462 TSMAQKVTQTQTLISVMEKTTVTMDCVYETRESSYYLFWYKQTASGEMVFLIRQDSYKKENATEGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMTE
Mus musculus V1326 ighv AAHY01182779.1 1077 VQCEVQLLETGGGLVQPGGSRGLSCEGSGFTFSGFWMSWVRQTPGKTLEWIGDINSDGSAINYAPSIKDRFTIFRDNDKSTLYLQMSNVRSEDTATYFCMR
Mus musculus V1327 ighv AAHY01186379.1 777 VHSQVQLQQPGAELVRPGSSVKLSCKASYFAFMASAMHWVKQRPGQGLEWIGSFTMYSDATEYSENFKGKATLTVDTSSSTAYMELSSLTSEDSAVYYCA
Mus musculus V1328 trav AAHY01186459.1 1002 VKGQQVQQSPASLVLQEGENAELQCTYSTTLNSMQWFYQRPGGRLVSLLYSPSWAEQRGGRLTSSAASNESRSSLHISSSQITDSGTYLCAME
Mus musculus V1329 ighv AAHY01188165.1 16490 VQSDVNLEVSGGGLVKPGGSMQLFCVASGFTFVDGWMDWVRQSPEKGLEWVAEIANKANNYATYYPESVKGRFTISRDDFKSSVYLHMNSLRAEDTGIYYCT
Mus musculus V1330 ighv AAHY01188165.1 1726 VQSEVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAQIRLKSDNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus musculus V1331 ighv AAHY01188853.1 4566 VQCEEKLDESGGGLVQPGRSMKLSCVASGFTFTNSWMNWFCQSPEKGLEWVAQIKSKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus musculus V1332 ighv AAHY01188885.1 11708 VQCEVKLVESEGGLVQPGSSMKLSCTASGFTFSDYYMAWVRQVPEKGLEWVANINYDGSSTYYLDSLKSRFIISRDNAKNILYLQMSSLKSEDTATYYCAR
Mus musculus V1333 ighv AAHY01189298.1 960 VHSQVQLQQPGTELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGNINPSNGGTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1334 ighv AAHY01189797.1 426 VNSEVQLQQSGAELVRPGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGRIDPEDGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCT
Mus musculus V1335 ighv AAHY01190169.1 972 VHSEVQLQQSGAELVTPGYSVKLSCKTSGYTFTSYDINWVKQRPGQGLEWIGYIYPGNGYTEYNEMFKGKATLTSDTSSSTAYMQLRSLTSEDSAVYFCA
Mus musculus V1339 ighv AAHY01195392.1 22550 VHSQVQLQQSGAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPSSGYTKYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1340 ighv AAHY01195392.1 14427 VHCEVQLVESGGGLVQPKGSLKLSCAASGFSFNTYAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSESMLYLQMNNLKTEDTAMYYCV
Mus musculus V1343 ighv AAHY01196233.1 4498 AQAQIQLVQSGPELKKPGETVKISCKASGYTFTEYPMHWVKQAPGKGFKWMGMIYTDTGEPTYAEEFKGRFAFSLETSASTAYLQINNLKNEDTATYFCV
Mus musculus V1344 ighv AAHY01196235.1 4683 AQAQIQFVQSGPELKKPGETVKISCKASVYTFTEYPMHWVKQAPGKGFKWMGWINTYSGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCA
Mus musculus V1345 ighv AAHY01196235.1 2919 SALIKPSQPLSLTCTVSGFSITSSSYCWHWICQPPGKGLEWMGHICYEGSLNYSPSLKSRSTISRDTSLNKFFIQLSSLTDEDTVMYYCSRE
Mus musculus V1347 ighv AAHY01196879.1 11333 ALSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYAISWVRQPPGKGLEWLGVIWTGGGTNYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCAR
Mus musculus V1348 ighv AAHY01196879.1 3735 VQCEVKLVESGGGLVKPGQSLKLSCAASGFTFSNYYMSWVHQTPEKRLEWVAYISSSGVSTYYPDNVKGRFAISRDNAKNTLYLQMTSLKSEDTALYYCAR
Mus musculus V1350 ighv AAHY01196960.1 3429 VQSQVQLQQSGAELVKPGASVKISCKASGYAFSSYWMNWVKQRPGKGLEWIGQIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1351 ighv AAHY01197046.1 2374 VLSQIQLKESGPAVIKPSQSLSLTCTVSGFSITSSSYCWHWIRQPPGKGLEWMGRICYEGSIYYSPSIKSRSTISRDTSLNKFFIQLSSVTNEDTAMYYCSRE
Mus musculus V1352 trav AAHY01197924.1 2226 VAGKTQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVG
Mus musculus V1353 ighv AAHY01197935.1 1881 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEIDPSDSYTYYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1354 ighv AAHY01198371.1 1572 VHSEVQLQQSGPELVKPGASVKISCKASDYSFTGYIMHWVKQSHGKSLEWIGEINPYNGGTSYNQKFKGKATLTVDTSSSTAYMELHSLTSEDSLVYYCA
Mus musculus V1355 ighv AAHY01198391.1 978 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSNMGVGWIRQPSGKGLEWLLHILWNDSKYYNPALKSRLTISKDTYNNQVFLKIANVDTADTATYYCARI
Mus musculus V1356 ighv AAHY01198578.1 1387 VLSQVQLKESGPGLVVPSQSLSITCTVSGFSLTSYDISWVRQSPGKGLEWLGMIWGGGSTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAR
Mus musculus V1359 ighv AAHY01200098.1 605 VLSEIQLQQSGPELVKPGASVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIRRVNPNNGGTSYNQKFKDKATLTVEKSSITAYMELRSLTSEDSAVYYCA
Mus musculus V1376 ighv AAHY01253144.1 392 AQAQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCA
Mus musculus V1379 ighv AAHY01269565.1 832 VLSQVTLKESGPGISQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDVKRYNPALKSRLTISKDTSSSQVFLMIASVDTADTATYYCARI
Mus musculus V1380 ighv AAHY01276845.1 629 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSSNQVFLKITSVDTADTATYYCARR
Mus musculus V1381 trav AAHY01279268.1 602 ESNGDSVTQTEGPVTLSEGTSLTVNCSYETKQYPTLFWYVQYPGEGPQLLFKVPKANEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS
Mus musculus V1382 trav AAHY01284867.1 822 VRSQQKVQQSPESLTVSEGAMASLNCTFSDGTSDNFRWYRQHSGKGLEVLVSIFSDGEKEEGRFTAHLNRASLHVSLHIREPQPSDSALYLCAM
Mus musculus V1383 trav AAHY01288899.1 792 VRSQQKVQQSPESLTVSEGAMASLNCTFSDGTSDNFRWYRQHSGKGLEVLVSIFSDGEKEEGRFTAHLNRASLHVSLHIREPQPSDSAVYLCAM
Mus musculus V1384 ighv AAHY01289207.1 348 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSSNQVFLKITSVDTADTATYYCARR
Mus musculus V1385 ighv AAHY01305938.1 386 IQCEVKLVESGGGLVQSGRSLRLSCATSGFTFSDFYMEWVRQAPGKGLEWIAASRNKANDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARD
Mus musculus V1388 trav AAHY01312777.1 724 VQTQTVSQSDAHVTVFEGDSVELRCNYSYGGSIYLSWYIQHHGRGLQFLLKYYSGNPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVS
Mus musculus V1389 ighv AAHY01317374.1 582 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVGWIRQPSGKGLEWLADIWWDDDKYYNPSLKSRLTISKDTSSNEVFLKIAIVDTADTATYYCARR
Mus musculus V1390 ighv AAHY01320410.1 712 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIHQPSGKGLEWLADIWWDDDKYYNPSLKSRLTISKDTSKNQVFLKIAIVDTADTATYYCA
Mus musculus V1392 trav AAHY01327111.1 977 VAGKTQVEQSPQSLVVRQGESCVLQCNYSVTPDNHLRWFKQDTGEGLVSLTVLVHEKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVG
Mus musculus V1393 trav AAHY01331320.1 448 ESHGEKVEQHESTLSVREGDSAVINCTYTDTASSYFPWYKQEAGKGLHFVIDIRSNVDRKQSQRLIVLLDKKAKRFSLHITATQPEDSAIYFCAA
Mus musculus V1394 trav AAHY01332921.1 310 ESHGEKVEQHESTLSVREGDSAVINCTYTDTASSYFPWYKQEAGKGLHFVIDIRSNVDRKQSQRLIVLLDKKAKRFSLHITATQPEDSAIYFCAA
Mus musculus V1395 ighv AAHY01346911.1 486 VQSQVQLQQSGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPVHGLEWIGAIDPETGDTAYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYYCT
Mus musculus V1396 ighv AAHY01355331.1 1102 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLSRYSVHWVRQPPGKGLEWLGMIWGGGSTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAR
Mus musculus V1397 ighv AAHY01357813.1 341 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLSRYSVHWVRQPPGKGLEWLGMIWGGGSTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAR
Mus musculus V1398 trav AAHY01358396.1 518 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSGTPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAA
Mus musculus V1399 trdv AAHY01377397.1 594 SNVAEKVIQVWSTASRQEGEELTLDCSYETSQVLYHLFWYKHLLSGEMVFLIRQTSSSTAKERSGRYSVVFQKSLKSISLIISALQPDDSGKYFCALWEL
Mus musculus V1400 ighv AAHY01378310.1 979 VHSQVQLQQSGAELAKPGTSVKMSCKASGYTFTSYWMNWVKQRPGQGLEWIGAINPSNGYTEYNQKFKDKAILTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1402 ighv AAHY01387470.1 345 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFGMGVSWIRQPSGKDLEWLAHIYWDDDKHYNPSLKSQLTISKDTSNNQVFLKITTVDTADTATYYCARR
Mus musculus V1403 ighv AAHY01387722.1 660 VHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCT
Mus musculus V1404 ighv AAHY01390781.1 691 VHCQVQLKQSGAELVKPGASVKISCKASGYTFTDYYINWVKQRPGQGLEWIGKIGPGSGSTYYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1405 ighv AAHY01394141.1 892 VNSQVQLQQPGAEIVRPGASVKLSCKASGYTFTDYWMNWVKQRPGQGLEWIGAIDPSDSYTSYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1408 ighv AAHY01410109.1 749 VLSEVQLQQSGPVLVKPGPSVKISCKASGFTFTDYYMHWVKQSHGKSLEWIGLVYPYNGGTSYNQKFKGKATLTVDTSSSTAYMELNSLTSEDSAVYYCA
Mus musculus V1409 ighv AAHY01410285.1 486 ILSEVQLQESGPGLAKPSQTLSLTCSVTGYSITSDYWNWIRKFPGNKLEYMGYISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCAR
Mus musculus V1414 ighv AAHY01424549.1 847 VQCEVKLVESGGGLVQPGGSLKLSCAASGFTFSDYGMAWVRQAPRKGPEWVAFISNLAYSIYYADTVTGRFTISRENAKNTLYLEMSSLRSEDTAMYYCAR
Mus musculus V1416 ighv AAHY01433828.1 314 VYSEVQLQQSGTVLARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCT
Mus musculus V1417 trav AAHY01438157.1 662 MSQGEQVEQLPSILRVQERSSASINCTYENSASNYFPWYKQEPGENPKLIIDIRSNMERKQIQGLIVLLDKKAKRFSLHITDTQPADSAMYFCAAS
Mus musculus V1418 ighv AAHY01440566.1 977 VHSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYWINWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSVVYYCA
Mus musculus V1419 ighv AAHY01443353.1 379 VQCEVKLLQSGGGLVQPGGSLKLSCAASGIDFSRYWMSWVRRAPGKGLEWIGEINPDSSTINYAPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCAR
Mus musculus V1421 ighv AAHY01446863.1 420 VLSQVILKESGPGILQPSQTLSLTCSFSGFSLSTYGTAVNWIRQPSGKGLEWLAQIGSDDSKLYNPFLKSRITISKDTSNSQVFLKITSVDTEDSATYYCANR
Mus musculus V1422 ighv AAHY01450266.1 524 VHCQVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQSPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1423 ighv AAHY01456702.1 643 VHCQVQLQQSGPELVKPGASVKISCKASGYAFSSSWMHWVKQRPGQGLEWIGWIYPGDGNTKYNEKFKGKTTLTADKSSSTAYMQLISLTSEDSAVYFCA
Mus musculus V1425 trav AAHY01466463.1 379 RNNGDSVTQTEGLVTLTEGLPVMLNCTYQSTYSPFLFWYVQHLNEAPKLLLKSFTDNKRPEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus musculus V1427 ighv AAHY01472789.1 1203 VHSQVQLQQPGAELVRPGSSVKLSCKASGYTFTSYWMHWVKQRPIQGLEWIGNIDPSDSETHYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1428 ighv AAHY01472791.1 378 VHSQVQLQQPGAELVRPGSSVKLSCKASGYTFTSYWMHWVKQRPIQGLEWIGNIDPSDSETHYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1429 ighv AAHY01472793.1 341 VHSQVQLQQPGAELVRPGSSVKLSCKASGYTFTSYWMDWVKQRPGQGLEWIGNIYPSDSETHYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1435 ighv AAHY01488454.1 550 GIQSQVHLQQSGSELRSPGSSVKLSCKDFDSEVFPIAYMSWVRKKPGHGFEWIGSILPSIGRTIYGEKFEDKATLDADTMSNTAYLELNSLTSEDSAIYYCA
Mus musculus V1438 ighv AAHY01519609.1 324 VLSEVQLQQSGPELVKPGASVKISCKTSGYTFTEYTMHWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus musculus V1440 trav AAHY01527258.1 683 VSRGEQVEQRPPHLSVREGDSAVIICTYTDSATAYFYWYKQEPGAGLQLLMSVLSNVDRKEEQGLTVLLNKKDKRLSLNLTAAHPGDSAAYFCAVS
Mus musculus V1442 ighv AAHY01534570.1 1021 VLSQVQNKSGPGLVEPSQSLSITCTVYWFSLTSYGVSWVRQPPGKGLKWLGVIWAGGSTNYNSALISRLSISKDNSKSQVFLKMNSLQTDDTAIYYCVR
Mus musculus V1444 ighv AAHY01558326.1 767 VQSEGKLEESGGGLVQPGGSIKLSCAASGFTFSDAWMDWVRQSPEKGLEWVAEIRNKASNYATYYAEFVKGRFTISRDDSKSSVYLQMNTLRAEDTGIYYCT
Mus musculus V1446 trav AAHY01563160.1 372 VSRGEQVEQRPPHLSVREGDSAVIICTYTDPNSYYFFWYKQEPGAGLQLLMKVFSSTEINEGQGFTVLLNKKDKQLSLNLTAAHPGDSAVYFCAVS
Mus musculus V1447 ighv AAHY01565008.1 591 VHSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYVMHWVKQKPGQGLEWIGYIYPYNDGTEYTEKFKGKATLTLDKSSSTAYMDLSSLTSEDSTVYYCA
Mus musculus V1449 ighv AAHY01591170.1 760 VHSEVQLQQSGPELVNPVASVKISCKASGYSFTGYYIHWVKQGPRKSLEWIGYISCYNRATSYNQKFKGKAIFTVDKSSSTAYMQFNSLTSEDSAVYYCA
Mus musculus V1452 ighv AAHY01671129.1 329 VHSQVQLQQPGSELVRPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGNIYPGSGSTNYDEKFKSKATLTVDTSSSTAYMQLSSLTSEDSAVYYCT
Mus musculus V1453 ighv AAHY01673787.1 427 VQCDVKLVESGGGLVKPGGSLKLSCAASGFTFSSYYMAWVRQTPDKRLEWVATISSGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTR
Mus musculus V1455 ighv AAHY01685438.1 905 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLSRYSVHWVRQPPGKGLEWLGMIWGGGSTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAR
Mus musculus V1456 ighv AAHY01704201.1 323 VHSQVQLQQSGAELVKPGASVKLSCKTSGYTFTSYWIQWVKQRPGQGLGWIGEIFPGTGTTYYNEKFKGKATLTIDTSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1457 ighv AAHY01709069.1 634 VHSQAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCA
Mus musculus V1460 ighv AAHY01745967.1 964 VHSQVQLQQPGAELVRPGASVKMSCKASGYTFTSYLMDWVKQRPGQGFEWIGNINPNSGSTNYNEKFKGKAKLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus musculus V1466 trav AAHY01785514.1 456 RSNGDGDSVTQTEGLVTLTEGLPVMLNCTYQTIYSNPFLFWYVQHLNESPRLLLKSFTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus musculus V1467 trav AAHY01787473.1 532 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNSFEAEFSKSNSSFHLQKASVHWSDSAVYFCAL