WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pan troglodytes AADA00000000.1 (AADA01) 179 38 20 32 35 47 3 4
Pan troglodytes AACZ00000000.1 (AACZ04) 225 46 27 36 46 55 9 6
Pan troglodytes NBAG00000000.3 (NBAG03) 0 0 0 0 0 0 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pan troglodytes V0 trav AADA01014956.1 7982 VWSQRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCAV
Pan troglodytes V1 trav AADA01014958.1 3004 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQGVFHITASQPADSATYLCAL
Pan troglodytes V2 trav AADA01014960.1 13771 GLRAQSVAQPEDQVKVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Pan troglodytes V3 iglv AADA01019118.1 5899 SWANFMLTQPHSVSESPGQTVTISCTRSSGSIASDYVQWYQQRPGSAPTTVIYEDNRRPSGVPDRFSGSIGSSSNSASLTISGLKSEDEADYYCQSYDSSS
Pan troglodytes V4 igkv AADA01025132.1 18017 SSGDIVMTQTPLSLPVTPGEPASISCRSSESLLDTDDEHTYLNWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan troglodytes V5 igkv AADA01037839.1 13094 TTGEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSRTDFTLTISSVEPEDFAVYYCQQYNNQP
Pan troglodytes V6 trav AADA01039886.1 4833 PGIAQKITQTQPGMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMKE
Pan troglodytes V7 trav AADA01039891.1 15070 VNSQQGEEDPQALSIQEGENAIMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Pan troglodytes V8 trdv AADA01039891.1 25153 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE
Pan troglodytes V9 trav AADA01042440.1 6594 VSGQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTRLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAG
Pan troglodytes V10 trav AADA01042442.1 3237 IMGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQRPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHRATLRDAAVYYCILR
Pan troglodytes V11 trav AADA01042442.1 8006 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGA
Pan troglodytes V12 igkv AADA01055260.1 27261 SSGDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQA
Pan troglodytes V13 igkv AADA01055260.1 43915 SRGEIVLTQSPDFQSVPPKEKVTITCRASQSIGSSLHWYQQKPGQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Pan troglodytes V14 igkv AADA01055261.1 12536 TTGEIVLTQSSATLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGS
Pan troglodytes V15 igkv AADA01055261.1 28038 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP
Pan troglodytes V16 igkv AADA01055261.1 45492 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKPLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSYP
Pan troglodytes V17 igkv AADA01065260.1 2348 TTGEIVLTQSPATLSLSPGEKATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGISARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWH
Pan troglodytes V18 igkv AADA01065844.1 11225 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLSWYQQKPGKAPKLLIYDASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQRGYG
Pan troglodytes V19 igkv AADA01065844.1 33513 ARCDIQLTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRTYNAP
Pan troglodytes V20 igkv AADA01076733.1 19591 SSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLSWIQQRPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCVQGIQLP
Pan troglodytes V21 igkv AADA01076733.1 30177 SSADIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISQVEAEDVGVYYCMQGIQLP
Pan troglodytes V22 igkv AADA01076733.1 42655 SSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNRYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan troglodytes V23 trav AADA01080770.1 8467 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAV
Pan troglodytes V24 ighv AADA01086651.1 8576 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRDTSISTAYMELSSLRSEDTAVYYCAR
Pan troglodytes V25 ighv AADA01086651.1 29355 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMSWVRQAPGKGPEWVANIKKDGSEKYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR
Pan troglodytes V26 ighv AADA01086723.1 4943 VLSQVQLQQSGPGLVKPSQTLSLTCAISRDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAASVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR
Pan troglodytes V27 trav AADA01090011.1 6254 GTSSNSVKQTGQITVSEGASVTMNCTSASTGYPTPFWYVQYPSKPLQLLQRETMENSKNFGGRNIKDKNSPVVKYSVQVSDSAVYYCLLGDTVLK
Pan troglodytes V28 trav AADA01090011.1 12029 VSAARNEVEQSPQDLTAQEGELITINCSYSVGINALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAIYICAV
Pan troglodytes V29 trav AADA01090012.1 17022 LSGELKVEQNPLFLSTQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGQLMASLDTKARLSTLHITAAVHDLSATYFCAV
Pan troglodytes V30 trav AADA01090014.1 3657 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFM
Pan troglodytes V31 trav AADA01090014.1 12823 FSMAQTVTQTQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS
Pan troglodytes V32 igkv AADA01109441.1 4959 ARCAIRMTQSPSSLSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLNYAASTLQSGVPSRFSGSRSGTEFTLTISCLQSEDFATYYCQQYYSYP
Pan troglodytes V33 igkv AADA01112160.1 2124 AKCDIQMTQSPSTLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSSSGSGTEFTLTISSLQPDDFATYYCQQYSSYP
Pan troglodytes V34 igkv AADA01129734.1 14823 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLSWYQQKPGKAPKLLIYDASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQRGYG
Pan troglodytes V35 igkv AADA01129734.1 37152 ARCDIQLTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRTYNAP
Pan troglodytes V36 igkv AADA01129969.1 28254 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFLGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINLVEANDTANYYCLQSKNFP
Pan troglodytes V37 igkv AADA01148935.1 243 ARCAIQMTQPPSSLFASVGDSVTITCRASQSVTNHWYQQKPGKAPKLLIYRVSSLQMGVPSRFSGSGSGTDFTLTISSLQPDDVATYYCQQE
Pan troglodytes V38 trbv AADA01152290.1 5369 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Pan troglodytes V39 trav AADA01167120.1 5187 VNGENVEQHPSTLSVQEGDGAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNMGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS
Pan troglodytes V40 trav AADA01167120.1 24661 VWSQQKEVEQNSGPLSVPEGAIVSLNCTYSDRRSQSFFWYRQYSGKSPELIMSIYSNGDEEDGKFTAQLNKASQYVSLLIRDSQPSDSATYLCAV
Pan troglodytes V41 trav AADA01167120.1 31159 GTRAQSATQLDSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTTGATLVKGINGFEAEFKKSETSFHLTKPSAHVNDAAEYFCAVS
Pan troglodytes V42 ighv AADA01173438.1 2944 AQCEVQLVESGGGLVQPGGSLRLSCPASGFTFSNHYMSWVLQAPGKGLEWVSYISGDSGYTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Pan troglodytes V43 igkv AADA01183666.1 9534 ARCAIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPAKAPKLLIYYASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP
Pan troglodytes V44 ighv AADA01189304.1 5412 AHSQVQLVQSGSEVKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR
Pan troglodytes V45 trav AADA01189647.1 6138 MYLVLGTTGQNTDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSLFLSRSKGYSYLLLKELQVKDSASYLCAVR
Pan troglodytes V46 igkv AADA01191862.1 9100 ARCDIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYS
Pan troglodytes V47 ighv AADA01193666.1 10692 VLSQVTLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLALIYSDNDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHR
Pan troglodytes V48 igkv AADA01203880.1 174 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPFRFSDSGSGTDYTLTISSLQPEDFATYYCQQSDSTP
Pan troglodytes V49 igkv AADA01217400.1 2808 ARCDIQMTQSPSSMSASVGDRVTITCRASQGINNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFCDSGSGTDYTLTISSLQPEDFATYYCQQSDGTP
Pan troglodytes V50 trav AADA01220113.1 14655 VSRGESVGLHLPTLSVQEGDNSITNCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQLGDSAVYFCAEN
Pan troglodytes V51 igkv AADA01223379.1 2753 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSDSGSGTDYTLTISSLQPEDFATYYCQQSDSTP
Pan troglodytes V52 trav AADA01223777.1 2237 VRGIQVEQSPPDLILQEGANSTLRCNFSASVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVEPQCSP
Pan troglodytes V53 trav AADA01224053.1 4338 LSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFALYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Pan troglodytes V54 trav AADA01228752.1 7216 DARAQSVSRHNHHVILSEAASLELGCNYSYGGTVSLFWYVQYPGQHLQLLLKYFSGDSLVKGIKGFEAEFMKSKFSFNLRKPSVQWSDTAEYFCAVN
Pan troglodytes V55 trav AADA01228752.1 21343 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLLWYVQYPGEGPQLLLKAMKANDNGRNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Pan troglodytes V56 trav AADA01228752.1 35430 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS
Pan troglodytes V57 trav AADA01233673.1 203 VRSQQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMMLLKGGEQKGHDKISASFNEKKQQSSLYLMASQLSYSGTYFCGAE
Pan troglodytes V58 trav AADA01234219.1 1409 GTRAQSVTQLDSQVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVKGINGFEAEFKKSETSFHLRKPSVHISDAAEYFCAVS
Pan troglodytes V59 igkv AADA01238119.1 4051 VRFDIQMTQSPSFLSASVGDRVSIICRASEDISSDLAWYLQKPGKSPKFFLYDAKDLRPGVSSRFSGRGSGTDFTLTIISLKPEDFATYYCKQDFSYP
Pan troglodytes V60 ighv AADA01247624.1 3165 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYFIHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQSRVTMTRNTSISTDYMELSRLRSDDTAVYYCPR
Pan troglodytes V61 ighv AADA01251177.1 2851 VQCEVQLVQSGGGLVQPGGSLRLSCAGSGFTFSSYAMHWVRQAPGKGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCAR
Pan troglodytes V62 trav AADA01281501.1 5184 MSRGEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Pan troglodytes V63 ighv AADA01282717.1 8673 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRDTSISTAYMELSSLRSEDTAVYYCAR
Pan troglodytes V64 ighv AADA01282717.1 29417 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMSWVRQAPGKGPEWVANIKKDGSEKYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR
Pan troglodytes V65 ighv AADA01282717.1 53665 VLSQVTLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLALIYSDNDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHR
Pan troglodytes V66 trav AADA01291252.1 13042 VSTQLLEQSPRFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTSGEVKKLKRLTFQFGDARKDSSLHITVAQPGDTGLYLCAG
Pan troglodytes V67 trav AADA01295983.1 10462 TVRAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG
Pan troglodytes V68 trav AADA01309728.1 7245 RTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKDSVQASDSAVYFCALS
Pan troglodytes V69 trdv AADA01314125.1 1981 SSVAQKVTQAQSSVSMPVRKAVTLNCLYEASWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALWE
Pan troglodytes V70 trav AADA01314125.1 11282 VSSILNVEQSPQSLHVQEGDSTSFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKKGYSYLYIKGSQPEDSATYLCAF
Pan troglodytes V71 trav AADA01314125.1 18739 VNGRQVMQIPQYQHVQEGEVFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Pan troglodytes V72 trav AADA01314125.1 30270 TIIDAKTTQSTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Pan troglodytes V73 igkv AADA01319859.1 3555 TIGEIVMTQSPATLSLSPGERATLSCRASQSVSSSYLSWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYKLP
Pan troglodytes V74 igkv AADA01321208.1 4312 ARCAIQLTQSPSSLSASVGDRVTITCRASQGISNRLNWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP
Pan troglodytes V75 igkv AADA01321208.1 10088 ASCDIQMTQSPSSVSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGNGSGTDFTLTISSLQPEDFATYYCQQANSFP
Pan troglodytes V76 igkv AADA01326978.1 3285 AKCAIRMTQSPSSLPVSTGDRVTITCQASQGIGSYLNWYQQKPGKSPKLLIYYASYLQSGIPSRFSGSGSGTEFTLTIGCLQPEDFATYYCEQSYGTP
Pan troglodytes V77 trav AADA01357268.1 202 VWSQQKEVEQDPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSDNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS
Pan troglodytes V78 iglv AADA01004626.1 5345 SLSQPVLTHPTFLSASPGASARLTCTLRSGINLGSYRIYWYQQKPGSPPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGILVISGLQSEDEADYYCMI
Pan troglodytes V79 iglv AADA01004626.1 512 SWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVSDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSG
Pan troglodytes V80 iglv AADA01010643.1 1282 SWANFMLTQPHSVSESPGQTVTISCTRSSGSIASDYVQWYQQRPGSAPTTVIYEDNRRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSS
Pan troglodytes V81 ighv AADA01015663.1 909 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V83 ighv AADA01029791.1 27514 VLSQVTLKESGPVLVKPTETLTLTCTISGFSLSNAGMGVSWIRQPPGKALEWLAHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCTRR
Pan troglodytes V84 ighv AADA01029792.1 3550 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVGFIRTKAKGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR
Pan troglodytes V85 trbv AADA01035842.1 5866 LIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYWQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Pan troglodytes V86 trbv AADA01035844.1 4347 SVAAGVIQSPRYLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSS
Pan troglodytes V87 ighv AADA01037689.1 2098 VQCEVQLVESGGGLVQPESSLKLSCAASGFTFSSYAMNWVRQAPGKGLEWVAHIWNDGSQKYYADSVKGRFTISRDNSKSMLYLQMDSLKAEDTAMYYCT
Pan troglodytes V88 ighv AADA01038240.1 10445 VQCEVQLVESRGGLVQPGGSLRLSCAVSGFTFSDYYMSWVRQAPGKGLEWVGFIRNKANGGTTEYTTSVKGRFTISRDDSKSITYLQMNSLKTEDTAVYYCSR
Pan troglodytes V89 ighv AADA01038240.1 5869 VLSQVTLKESGPALVKPTETLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKYYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI
Pan troglodytes V90 iglv AADA01040880.1 8359 SWAQSALTQPPSASGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTVSRLQAEDEADYYCSSYAGSNN
Pan troglodytes V91 ighv AADA01044092.1 45206 VQSQVQLVQSGAEVKKPGSSVKVSCKVSGGTFSSYAISWVRQAPGQGLEWMGVIIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAT
Pan troglodytes V92 ighv AADA01044092.1 6466 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan troglodytes V93 igkv AADA01044730.1 821 TRCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLAWYQQKPGKAPKLLIYAASRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP
Pan troglodytes V94 iglv AADA01060107.1 373 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCSSLDSSGNH
Pan troglodytes V95 trdv AADA01078305.1 20380 SSVAQKVTQAQSSVSMPVRKAVTLNCLYEASWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALWE
Pan troglodytes V96 trav AADA01078305.1 11491 VSSILNVEQSPQSLHVQEGDSTSFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKKGYSYLYIKGSQPEDSATYLCAF
Pan troglodytes V97 trdv AADA01090005.1 1032 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDAVYSNPDLFWYRIRPDYSFQFVFYGDNSRSQAADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF
Pan troglodytes V98 trbv AADA01103941.1 659 PLDTAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKFLKTMFIYSNKEPILNETVPNRFSPDSPDKAHLNLHINSLELGDSAVYFCASSQ
Pan troglodytes V99 trbv AADA01110558.1 4981 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Pan troglodytes V100 trbv AADA01111602.1 11974 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSACQFPNYSSELNVNALLLGDSALYLCASSL
Pan troglodytes V101 trbv AADA01113372.1 48323 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMLDATLATLKIQPSEPRDSAVYFCASGL
Pan troglodytes V102 trbv AADA01113372.1 41501 HIEAGVTQFPSHSVIEKGQTVTLRCDPVSGHDNLYWYRRVMGNEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Pan troglodytes V103 trbv AADA01113372.1 36382 HGDAKVIQNPRYQVTQFEKPVTLGCSQNLNHNVMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLGDAAMYLCATSR
Pan troglodytes V104 trbv AADA01113372.1 31397 SPGEEVTQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKKEFKFLISFQNENVFDKTGMPKERFSAKCLSNSPCSLEIQATKLEDSAVYFCASSQ
Pan troglodytes V105 trbv AADA01113372.1 13466 LSNAGVMQNPRHLVRRRGQEARLRCSPVKGHNHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQAVRGDSAAYFCAS
Pan troglodytes V106 trbv AADA01113372.1 10347 TVDGGITQSPKYLFRKEGQNVTLNCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTLAQKNPTAFYLCASSI
Pan troglodytes V107 trbv AADA01113372.1 2487 GSGLGAVVSQHPSRVICKSGTSVKIECRCLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR
Pan troglodytes V108 trbv AADA01115985.1 11886 SVFSAVISQKPSRDICQRGTSMTIQCQVDSQVTMMFWYCQQPGQSMTLIATANQGSEATYESRFVIDKFPISRPNLTFSTLTVSNRRPEDSSIYLCSVE
Pan troglodytes V109 iglv AADA01122080.1 29640 SVASYELTQPPAVSVSPGQTARISCSGDVLRDNYADWYPQKPGQAPVLVIYKDGERPSGIPERFSGSTSGNTTALTISRVLTKGGADYYCFSGN
Pan troglodytes V110 trbv AADA01122555.1 18920 LFSAGPMNAGVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKGEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYFCASSY
Pan troglodytes V111 trbv AADA01122555.1 14607 SISTDHTGAGVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPNDRFSAERPEGSNSTQTIQRTEQRDSAMYLCASSL
Pan troglodytes V112 trbv AADA01122555.1 6166 PVDAGVTQSPTHLIKTRGQHVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Pan troglodytes V113 iglv AADA01131845.1 4525 SLSQPVLTQPSSHSASSGASVRLTCTLSSGFSVGDFWIRWYQQKPGNPPRYLLYYHSDSNKGQGSGVPSRFSGSNDASANAGILRVSGLQPEDEAYYYCGT
Pan troglodytes V114 iglv AADA01131845.1 761 SWAQSVLTQPPSVSAAPGQKVTISCSGSSCNIGNNYVSWYQQLPGTAPKILIYDNNKRPSGISDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Pan troglodytes V115 iglv AADA01132701.1 3773 SEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGTY
Pan troglodytes V116 trbv AADA01136627.1 12513 SVFSAVISQKPSRDICQRGTSLTIQCQVNSQVTMMFWYRQQPGQSPTLIATANQGSEATYETGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE
Pan troglodytes V117 trbv AADA01146876.1 36823 STDTKVTQRPRLLVKASEQKAKMDCVPIKGHSYVYWYRKKLEEELKFLIYFQNEELIQKAEIINERFLAQCPKNSSCTLEIQSTESGDTALYFCASSK
Pan troglodytes V118 trbv AADA01146876.1 27741 SFHAKVTQTPGHLVKGKGQKTKMDCTPEKGHVFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNTPCSLAILSSEPGDTALYLCASSQ
Pan troglodytes V119 trbv AADA01146876.1 16994 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSD
Pan troglodytes V120 trbv AADA01146876.1 2957 LMEADIYQTPRYLVIGTGKKIALECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Pan troglodytes V121 iglv AADA01151511.1 2813 VDSQTVVTQEPPFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPGRFFGSIIGNKAALTITGAQADDESDYYCLLYMGSGI
Pan troglodytes V122 iglv AADA01152539.1 14344 SEASYELTQPPSVSVSLGQTARITCSGEALPKKYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGAQAEDEADYYCQSADSSGTY
Pan troglodytes V123 iglv AADA01152539.1 2888 SWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNAVSWYQQHPGKAPKLMIYDVNKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSGGT
Pan troglodytes V124 ighv AADA01153799.1 18564 VQCEDQLVESGGGLVQPGGSLRPSCAASGFAFSSYVLHWVRRAPGKGLEWVSAIGTGGDTYYADSVMGRFTISRDNAKKSLYLQMNSLIAEDMAVYYCAR
Pan troglodytes V125 ighv AADA01153799.1 10936 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYTISWLRQAPGQGLEWMGVISPSDGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
Pan troglodytes V126 ighv AADA01153799.1 6808 AYSQMQLVQSGAEVKKPGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPYNGNTNYAQKFQDRVTITRDRSMSTAYMELRSLRSEDSAVYYCAR
Pan troglodytes V127 ighv AADA01166628.1 3429 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSYISYDSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAT
Pan troglodytes V128 ighv AADA01171075.1 435 VLSQLQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V129 trbv AADA01173227.1 26408 LTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNKISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE
Pan troglodytes V130 trbv AADA01173227.1 18776 PLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLDLHIKSLELGDSAVYFCASS
Pan troglodytes V131 trbv AADA01173227.1 14148 PIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ
Pan troglodytes V132 iglv AADA01173583.1 16613 SWAQSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSS
Pan troglodytes V133 iglv AADA01173950.1 11978 SLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTW
Pan troglodytes V134 iglv AADA01184442.1 890 SLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTINNLQSEDEADYYCETWGS
Pan troglodytes V135 trbv AADA01189839.1 13512 GSRLSAVVSQHPSRVICKSGTSVNIECRSLDFQATTMFWYRQLRKQSLMLMATSNEGSKVTYEQGVKEDKFPINHPNLTFSALTVTSAHPEDSSFYICSAR
Pan troglodytes V136 ighv AADA01221976.1 697 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSLIYSGDSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDTAVYYCAR
Pan troglodytes V137 ighv AADA01235177.1 6711 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDTNWVHQAPGKGLELVSGVSWNGSRMHYADSVKGRFIISRDNSRNSLYLQTNSLRAEDTAVYYCVR
Pan troglodytes V138 ighv AADA01242266.1 4661 AQSRVQLVQSGAEVKKPGASVKVSCKASGYTFTSYRMHWVCQAHAQGLEWMGLVCPSDGSTSHAQKFQGRVTITRDTSMSTAYMELSSLRSEDMAMYYCVR
Pan troglodytes V139 ighv AADA01251173.1 6621 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSLKGQFTISRDNAKNTLYLQMNSLRAEDMAVYYCTR
Pan troglodytes V140 trbv AADA01254170.1 598 PVDAGVTQSPTHLIKTRGQHVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Pan troglodytes V141 iglv AADA01254232.1 12599 LCALPVLTQPPSASASLGASVKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTISNLQSDDEAEYHCGE
Pan troglodytes V142 iglv AADA01254232.1 3282 SVASYELTQPPSVSVSPGQTASITCSGDKLGDKYAYWYQQKSGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDS
Pan troglodytes V143 ighv AADA01258100.1 1301 VQCQVQLWESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAFISYDGSNKHYADSVRGRFTISRDNSKNTLYLQMNRLRAEDTAVYYCAR
Pan troglodytes V144 trbv AADA01259881.1 41513 HTGAGVSQTPSNKVTEKGKDVELRCDPISGHAALYWYRQSLGQGPEFLIYFQGTGAADDSGLPNDRFFAVRPEGSVSTLKIQRTEQGDSAVYLCASSL
Pan troglodytes V145 trbv AADA01259881.1 36682 PVEAGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGHQFISRYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL
Pan troglodytes V146 trbv AADA01259881.1 33940 PVDSGVTQTPKHLITATGQQVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEESAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Pan troglodytes V147 trbv AADA01259881.1 25962 HRDAEITQSPRHKITETGRQVTLACHQTWNHNNMFWYRQDLGHGLRLIHYSYGVQDTNKGEVSDGYSVSRSNTEDFPLTLESAASSQTSVYFCASSE
Pan troglodytes V148 trbv AADA01259881.1 18213 LSEAEVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSILKIQPAELGDSAMYLCASSL
Pan troglodytes V149 trbv AADA01259881.1 868 HRDAGITQSPRHKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE
Pan troglodytes V150 trgv AADA01265967.1 28591 SQKSSNLEGRMKSVTRPTGSSAEITCDLIVINAVYIHWYLHQEGKSPQRLLYYDVSNSRDVLESGLSLGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Pan troglodytes V151 trgv AADA01265967.1 13914 RNLPNLEGRMKSVTRPTGSSAVITCDLPVENAGYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISQEKYHTYASTGKSLKFILENLIERDSGVYYCATWD
Pan troglodytes V152 ighv AADA01267105.1 2901 AAGGVWGRLGTAWGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSAYYADSGKGRFTISRDNSKNTLYLQMNSLRAEDTTVYYCAK
Pan troglodytes V153 ighv AADA01268703.1 13225 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTR
Pan troglodytes V154 ighv AADA01268703.1 5331 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCAR
Pan troglodytes V155 igkv AADA01276495.1 9440 TRAETTLTQSPAFVSATPGDKVTISCKASQDIDDDMNWYQQKPGEAAIFIIQEATTLVSGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQDDNFP
Pan troglodytes V156 trbv AADA01282133.1 8946 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ
Pan troglodytes V157 trbv AADA01282133.1 464 PVNAGVTQTPKFRVLKTGQSMSLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAEGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY
Pan troglodytes V158 iglv AADA01283431.1 4692 SVTSYELTQPPSVSVAPGQTARITCGGNNIGSKAVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSKH
Pan troglodytes V159 ighv AADA01288043.1 26607 VCAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA
Pan troglodytes V160 ighv AADA01293360.1 9521 VLSQLQLQESGPGLVKPSQTLSLTCTVSGGSISSGSYYWSWIRQPAGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V161 ighv AADA01294343.1 953 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKD
Pan troglodytes V162 ighv AADA01295150.1 7715 VQCQVRLVESGGGVVQPGRSLRLSCAASGFTFSSYHMNWVRQAPGKGLEWVAFIQYDGSGKYYADSVKGRFTISKDNSKSMLYLQMNSLRAEDTAVYYCAR
Pan troglodytes V163 trbv AADA01295168.1 15175 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSVGEGTTDKGEVPDGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE
Pan troglodytes V164 trbv AADA01302195.1 688 LTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAMYLCASSL
Pan troglodytes V165 trbv AADA01314073.1 4162 HMDAGITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYDVKDTDKGEVSDGYSVSRSKTEDFLLTLESTTSSQTSVYFCAISE
Pan troglodytes V166 trgv AADA01316184.1 755 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTGYIHWYLHQEGKAPQRLLYYDSYTSRVVLESGISPGKYDTYASTRKNLRLILRNLIENDSGVYYCATWD
Pan troglodytes V167 iglv AADA01318773.1 2919 SWAQSALTQEASMSGTVGQKVTLSCTGNSNNVGNYAVGWYQQISHGAPKTVMFGNSPPSGIPDRFSGSKSGTTASLTISGLQPEDEADYYCPTWDYSLS
Pan troglodytes V168 trbv AADA01321715.1 703 PVNAGVTQSPKFRVLKTGQSMTLQCAQDMNHNYMYWYQQDPGMGLRLIHYSAGEGTTAKGEVPDGYNVSRLNTQNFLLRLESAAPSQTSVYFCATSE
Pan troglodytes V169 trbv AADA01321797.1 17406 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRSNTEDFPLSLVSAAPSQTSVYFCASSY
Pan troglodytes V170 trbv AADA01321797.1 13189 HTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYFRSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL
Pan troglodytes V171 trbv AADA01321797.1 5267 PVDAGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFSPRFSGRQFPNYSSELNVNALELDDSALYLCASSL
Pan troglodytes V172 trbv AADA01322241.1 14980 PVEAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPRRFSGRQFPNYSSELNVNALELEDSALYLCASSL
Pan troglodytes V173 trbv AADA01322241.1 5758 HADTGVSQDPSHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQCPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQHTEQGDSAIYLCASSL
Pan troglodytes V174 ighv AADA01322295.1 1435 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTVSSYHMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRVNSKNTLYLQMNSLRAEDTAVYYCAR
Pan troglodytes V175 igkv AADA01322486.1 4129 ARCDIQVTQSPSSLSASVGDRVTITCRTSQGISNGLSWYQQKPGQAPTLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP
Pan troglodytes V176 ighv AADA01323158.1 1318 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMHWVRQAPEKGLEWVSTISGSGGSTWYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan troglodytes V177 trbv AADA01333857.1 426 PVNAGVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLESAAPSLTSVYFCASSY
Pan troglodytes V178 trbv AADA01359086.1 13974 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHDYMSWYRQDPGLGLRQIYYSVNVEVIDKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Pan troglodytes V179 trbv AADA01359086.1 8673 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL
Pan troglodytes V6 ighv AACZ04001320.1 8315 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKD
Pan troglodytes V7 ighv AACZ04001320.1 35311 VQCEVQLVESGGGLVQPESSLKLSCAASGFTFSSYAMNWVRQAPGKGLEWVAHIWNDGSQKYYADSVKGRFTISRDNSKSMLYLQMDSLKAEDTAMYYCT
Pan troglodytes V8 ighv AACZ04001320.1 56250 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V9 ighv AACZ04001320.1 81138 AAGGVWGRLGTAWGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSAYYADSGKGRFTISRDNSKNTLYLQMNSLRAEDTTVYYCAK
Pan troglodytes V21 igkv AACZ04002323.1 4535 ARCDIQMTQSTSSLSASVGDRVTITCRASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGILSRFSDSGSGTDYTLTISSLQPEDFAAYYCQQSDSTP
Pan troglodytes V33 igkv AACZ04006322.1 20433 ARCDIQMTQSPSSLSASVGDRVTITCRASQSISNYLSWYQQKPGKAPKLLIYDASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQRGYG
Pan troglodytes V34 igkv AACZ04006322.1 42744 ARCDIQLTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRTYNAP
Pan troglodytes V35 igkv AACZ04006322.1 94980 SSGDVVMTQSPLSLPVTLGQLASISCRSSQSLVYSDGNTYLSWIQQRPGQPPRLLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCVQGIQLP
Pan troglodytes V36 igkv AACZ04006322.1 105555 SSADIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISQVEAEDVGVYYCMQGIQLP
Pan troglodytes V37 igkv AACZ04006322.1 118031 SSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNRYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan troglodytes V38 igkv AACZ04006322.1 126313 TRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP
Pan troglodytes V39 igkv AACZ04006323.1 14792 SSGDIVMTQTPLSSPVTLGQPASISCRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQA
Pan troglodytes V40 igkv AACZ04006323.1 31427 SRGEIVLTQSPDFQSVPPKEKVTITCRASQSIGSSLHWYQQKPGQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Pan troglodytes V41 igkv AACZ04006323.1 48663 TTGEIVLTQSSATLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGS
Pan troglodytes V42 igkv AACZ04006323.1 64160 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP
Pan troglodytes V43 igkv AACZ04006323.1 81611 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKPLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSYP
Pan troglodytes V44 igkv AACZ04006323.1 96256 TTGEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSRTDFTLTISSVEPEDFAVYYCQQYNNQP
Pan troglodytes V45 igkv AACZ04006323.1 135457 ARCAIQLTQSPSSLSASVGDRVTITCRASQGISNRLNWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP
Pan troglodytes V46 igkv AACZ04006323.1 141228 ASCDIQMTQSPSSVSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGNGSGTDFTLTISSLQPEDFATYYCQQANSFP
Pan troglodytes V47 igkv AACZ04006323.1 154269 TTGEIVLTQSPATLSLSPGEKATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGISARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWH
Pan troglodytes V48 igkv AACZ04006323.1 171508 VRFDIQMTQSPSFLSASVGDRVSIICRASEDISSDLAWYLQKPGKSPKFFLYDAKDLRPGVSSRFSGRGSGTDFTLTIISLKPEDFATYYCKQDFSYP
Pan troglodytes V49 igkv AACZ04006323.1 191346 ARCAIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPAKAPKLLIYYASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP
Pan troglodytes V50 igkv AACZ04006323.1 208920 ARCAIRMTQSPSSLSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLNYAASTLQSGVPSRFSGSRSGTEFTLTISCLQSEDFATYYCQQYYSYP
Pan troglodytes V77 trav AACZ04010890.1 359 GTRAQSVTQLDGHITVSEEAPLELKCNYSYSGVPSLFWYVQYSSQSLQLLLKDLTETTQVKGIKGFEAEFKKSETSFYLRKPSTHVSHAAEYFCAVG
Pan troglodytes V90 trav AACZ04014807.1 5010 GTRAQSVTQLDGHITVSEEAPLELKCNYSYSGVPSLFWYVQYSSQSLQLLLKDLTEATQVKGIKGFEAEFKKSETSFYLRKPSTHVSDAAEYFCAVG
Pan troglodytes V91 trav AACZ04014829.1 525 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Pan troglodytes V109 igkv AACZ04017688.1 1656 ARCDIQMTQSPSSMSASVGDRVTITCRASQGINNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFCDSGSGTDYTLTISSLQPEDFATYYCQQSDGTP
Pan troglodytes V110 igkv AACZ04017690.1 1669 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFCDSGSGTDYTLTISSLQPEDFATYYCQQSDGTP
Pan troglodytes V215 trgv AACZ04038746.1 85605 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTGYIHWYLHQEGKAPQRLQYYDPYNSKVVLESGVSPGKYYTYASTRKNLRMILRNLIENDSGVYYCATWD
Pan troglodytes V216 trgv AACZ04038746.1 89392 SQKSSNLEGGTKSVTRPTRSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDAGVYYCATWD
Pan troglodytes V217 trgv AACZ04038747.1 52 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTGYIHWYLHQEGKAPQRLLYYDSYTSRVVLESGISPGKYDTYASTRKNLRLILRNLIENDSGVYYCATWD
Pan troglodytes V218 trgv AACZ04038747.1 4401 SQKSSNLEGRMKSVTRPTGSSAEITCDLIVINAVYIHWYLHQEGKSPQRLLYYDVSNSRDVLESGLSLGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWD
Pan troglodytes V219 trgv AACZ04038749.1 2211 SQKSSNLEGGTKSVTRPTRSSAEITCDLTVINALYIHWYLHQEGKAPQRLLYYDVSNSKDMLESGLSPGKYYTHTPRRWSWILILRNLIENDAGVYYCATWD
Pan troglodytes V220 trgv AACZ04038750.1 11112 SQKSSNLEGRMKSVTRPTGSSAVITCDLPVENAGYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISQEKYHTYASTGKSLKFILENLIERDSGVYYCATWD
Pan troglodytes V221 trgv AACZ04038750.1 24968 HLEQPQISSTKTLSKTARLECVVSGVTISATSVYWYRERPGEVIQFLVSISYDGTLRKESSIPSGKFEVDRIPETSTSTLTIHNVEKQDIATYYCALWE
Pan troglodytes V222 trgv AACZ04038750.1 61985 TSGENLITQPVTSVTKKKGNTAFFECQIKSSTFKKNVCIHWYHQKPDRSLKRILYISSNENVVHEQGVSEERYEARKWQRDLSSSLRIHRVAEEDAGIYYCACW
Pan troglodytes V227 trav AACZ04040114.1 406 GTRAQSVTQLDGHITVSEEAPLELKCNYSYSGAPSLFWYVQYSSQSLQLLLKDLTEATQVKGIKGFEAEFKKSETSFYLRKPSTHVSDAAEYFCAVG
Pan troglodytes V260 trav AACZ04046477.1 4454 VSTQLLEQSPRFLSIQEGENLTVYCNSSVFSSLQWYRQEPGEGPVLLVTVVTSGEVKKLKRLTFQFGDARKDSSLHITVAQPGDTGLYLCAGAQCS
Pan troglodytes V266 trav AACZ04048078.1 583221 MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTMNDTGEYFCIYHTYPDGT
Pan troglodytes V300 trav AACZ04052406.1 159686 TAGQSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGHFSSFLSRSDSYGYLLLQKLQMKDSASYFCAVR
Pan troglodytes V301 trav AACZ04052406.1 180779 MYLVLGTTGQNTDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSLFLSRSKGYSYLLLKELQVKDSASYLCAVR
Pan troglodytes V302 trav AACZ04052407.1 83838 GLRAQSVAQPEDQVKVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Pan troglodytes V303 trav AACZ04052407.1 96493 TLSLAKTTQPISMASYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTNVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVG
Pan troglodytes V304 trav AACZ04052407.1 109216 MSRGEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Pan troglodytes V305 trav AACZ04052407.1 128801 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQGVFHITASQPADSATYLCAL
Pan troglodytes V306 trav AACZ04052407.1 143149 ANGENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD
Pan troglodytes V307 trav AACZ04052407.1 157475 DARAQSVSRHNHHVILSEAASLELGCNYSYGGTVSLFWYVQYPGQHLQLLLKYFSGDSLVKGIKGFEAEFMKSKFSFNLRKPSVQWSDTAEYFCAVN
Pan troglodytes V308 trav AACZ04052407.1 171603 GINGDSVVQTEGQVLLSEGDSLIVNCSYETTQYPSLLWYVQYPGEGPQLLLKAMKANDNGRNKGFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Pan troglodytes V309 trav AACZ04052407.1 185704 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS
Pan troglodytes V310 trav AACZ04052407.1 201519 VWSQRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCAV
Pan troglodytes V311 trav AACZ04052407.1 212734 TVRAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG
Pan troglodytes V312 trav AACZ04052407.1 229006 VNGENVEQHPSTLSVQEGDGAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIHSNMGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS
Pan troglodytes V313 trav AACZ04052407.1 248483 VWSQQKEVEQNSGPLSVPEGAIVSLNCTYSDRRSQSFFWYRQYSGKSPELIMSIYSNGDEEDGKFTAQLNKASQYVSLLIRDSQPSDSATYLCAV
Pan troglodytes V314 trav AACZ04052407.1 254981 GTRAQSATQLDSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTTGATLVKGINGFEAEFKKSETSFHLTKPSAHVNDAAEYFCAVS
Pan troglodytes V315 trav AACZ04052409.1 23591 VNRGESVGLHLPTLSVQEGDNSITNCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQLGDSAVYFCAEN
Pan troglodytes V316 trav AACZ04052409.1 29478 PGIAQKITQTQPGMFVQEKEAVTLDCTYDTSDQSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMKE
Pan troglodytes V317 trav AACZ04052409.1 46297 RTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKDSVQASDSAVYFCALS
Pan troglodytes V318 trav AACZ04052409.1 70831 VWSQQKEVEQDPGPLSVPEGAIASLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSDNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS
Pan troglodytes V319 trav AACZ04052411.1 1920 GTRAQSVTQLDSQVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVKGINGFEAEFKKSETSFHLRKPSVHISDAAEYFCAVS
Pan troglodytes V320 trav AACZ04052411.1 13679 GTRAQRVTQPEKLLSVFKGAPVELKCNYSYSGSPELFWYVQYPRQRLQLLLRHISRESIKGFTADLNKGETSFHLKKPFAQEEDSAMYYCALS
Pan troglodytes V321 trav AACZ04052411.1 20904 VNSQQGEEDPQALSIQEGENAIMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Pan troglodytes V322 trdv AACZ04052411.1 30979 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE
Pan troglodytes V323 trav AACZ04052411.1 64601 LSGEDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFALYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ
Pan troglodytes V324 trav AACZ04052411.1 76506 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAV
Pan troglodytes V325 trav AACZ04052411.1 94659 VRGIQVEQSPPDLILQEGANSTLRCNFSASVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVEPQCSP
Pan troglodytes V326 trdv AACZ04052411.1 120380 SSVAQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCAFWE
Pan troglodytes V327 trav AACZ04052411.1 129691 VSSILNVEQSPQSLHVQEGDSTNFTCSFTSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF
Pan troglodytes V370 iglv AACZ04057797.1 16385 SVASYELTQPSSVSVSPGQTARITCSGDVLAKNYARWFQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNN
Pan troglodytes V371 iglv AACZ04057797.1 35057 SEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGTY
Pan troglodytes V372 iglv AACZ04057799.1 12288 SVTSYELTQPPSVSVAPGQTARITCGGNNIGSKAVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSKH
Pan troglodytes V373 iglv AACZ04057799.1 20216 SVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCSSLDSSGNH
Pan troglodytes V374 iglv AACZ04057799.1 36200 QSALTQPPSVSRSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Pan troglodytes V375 iglv AACZ04057799.1 49004 SEASYELTQPPSVSVSLGQTARITCSGEALPKKYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCQSADSSGTY
Pan troglodytes V376 iglv AACZ04057801.1 9208 SWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNAVSWYQQHPGKAPKLMIYDVNKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSGGT
Pan troglodytes V377 iglv AACZ04057801.1 12466 SVASYELTQPPAVSVSPGQTARISCSGDVLRDNYADWYPQKPGQAPVLVIYKDGERPSGIPERFSGSTSGNTTALTISRVLTKGGADYYCFSGN
Pan troglodytes V378 iglv AACZ04057801.1 21722 SATSYELTQPHSVSVATAQTARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSNSNQPSGIPERFSGSNPGNTATLTISRVEAGDEVDYYCQVWDSSSDH
Pan troglodytes V379 iglv AACZ04057801.1 42012 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYS
Pan troglodytes V380 iglv AACZ04057803.1 17620 SEASYELTQPPSVSVSPGQTARITCSGDALPKQYAYWYQQKSGQAPVLIIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH
Pan troglodytes V381 iglv AACZ04057803.1 28624 SWAQSALTQPPSASGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTVSRLQAEDEADYYCSSYAGSNN
Pan troglodytes V382 iglv AACZ04057804.1 6275 LCALPVLTQPPSASASLGASVKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTISNLQSDDEAEYHCGE
Pan troglodytes V383 iglv AACZ04057804.1 15592 SVASYELTQPPSVSVSPGQTASITCSGDKLGDKYAYWYQQKSGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDS
Pan troglodytes V384 iglv AACZ04057813.1 1503 SWANFMLTQPHSVSESPGQTVTISCTRSSGSIASDYVQWYQQRPGSAPTTVIYEDNRRPSGVPDRFSGSIGSSSNSASLTISGLKSEDEADYYCQSYDSSS
Pan troglodytes V385 iglv AACZ04057815.1 7470 SLSQPVLTQPSSHSASSGASVRLTCTLSSGFSVGDFWIRWYQQKPGNPPRYLLYYHSDSNKGQGSGVPSRFSGSNDASANAGILRVSGLQPEDEAYYYCGT
Pan troglodytes V386 iglv AACZ04057815.1 11234 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKILIYDNNKRPSGISDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Pan troglodytes V387 iglv AACZ04057815.1 41683 SLSQPVLTQPTFLSASPGASARLTCTLRSGINLGSYRIYWYQQKPGSPPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGILVISGLQSEDEADYYCMI
Pan troglodytes V388 iglv AACZ04057815.1 46515 SWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVSDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSG
Pan troglodytes V389 iglv AACZ04057816.1 61380 SWAQSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSS
Pan troglodytes V411 trav AACZ04059385.1 19440 IMGDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQRPEYVIHGLTSNVNNRMASLTIAEDRKSSTLILHRATLRDAAVYYCILR
Pan troglodytes V412 trav AACZ04059385.1 24208 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGA
Pan troglodytes V413 trav AACZ04059385.1 38142 VSGQQLNQSPQSMFIQEGEDVSMNCTSSSIFNTRLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAG
Pan troglodytes V414 trav AACZ04059385.1 42908 VSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFQSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNTATQTGDSAIYLCAVE
Pan troglodytes V415 trav AACZ04059387.1 31602 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSESNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFM
Pan troglodytes V416 trav AACZ04059387.1 40773 FSMAQTVTQTQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS
Pan troglodytes V417 trav AACZ04059387.1 62733 LSGELKVEQNPLFLSTQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGQLMASLDTKARLSTLHITAAVHDLSATYFCAV
Pan troglodytes V418 trav AACZ04059387.1 73661 GTSSNSVKQTGQITVSEGASVTMNCTSASTGYPTPFWYVQYPSKPLQLLQRETMENSKNFGGRNIKDKNSPVVKYSVQVSDSAVYYCLLGDTVLK
Pan troglodytes V419 trav AACZ04059387.1 79436 VSAARNEVEQSPQDLTAQEGELITINCSYSVGINALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAIYICAV
Pan troglodytes V420 trdv AACZ04059387.1 161914 VSLDIILEPDTKALTVLIGEAATLRCSITGGDLKNYQMSWYKKSEDNSLILVSKLSNNSNDNLGNNFKVKIDTLKIQLMLDIQKATTQDVGTYYCASD
Pan troglodytes V421 trdv AACZ04059387.1 182902 VMSAIELVPEHQTVTVSMGVPATLSCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEGSYYCAC
Pan troglodytes V426 trav AACZ04059702.1 7024 VNGRQVMQIPQYQHVQEGEVFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Pan troglodytes V444 trbv AACZ04061380.1 78720 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Pan troglodytes V465 igkv AACZ04063128.1 11303 ARCDIQVTQSPSSLSASVGDRVTITCRTSQGISNGLSWYQQKPGQAPTLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP
Pan troglodytes V470 igkv AACZ04063674.1 1583 TRCDIQMTQSPSSLSASVGDRVTITCRASQSISNSLAWYQQKPGKAPKLLIYAASRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP
Pan troglodytes V471 igkv AACZ04063674.1 26533 TRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKAPKLLIYYASRLESGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYNSNP
Pan troglodytes V472 igkv AACZ04063674.1 40612 TIGEIVMTQSPATLSLSPGERATLSCRASQSVSSSYLSWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP
Pan troglodytes V473 igkv AACZ04063674.1 53086 ARCDIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP
Pan troglodytes V474 igkv AACZ04063677.1 12446 AKCDIQMTQSPSTLSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSSSGSGTEFTLTISSLQPDDFATYYCQQYSSYP
Pan troglodytes V475 igkv AACZ04063678.1 28883 CNGDIVLTQSPASLAVSPGQRATITCRASESVSFLGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINLVEANDTANYYCLQSKNFP
Pan troglodytes V501 igkv AACZ04065786.1 10901 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWFLQKPEQSPQLLIYEVSNWASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan troglodytes V541 ighv AACZ04069746.1 2079 AHSQVQLVQSGAEVKKLGASVKVSCKASGYTFTDYFIHWVQQAPGQGLEWMGWINPNSGGTNYAQKFQSRVTMTRNTSISTAYMELSRLRSDDTAVYYCAR
Pan troglodytes V566 igkv AACZ04072040.1 31783 ARCAIQMTQPPSSLSASVGDSVTITCRASQSVTNHWYQQKPGKAPKLLIYRVSSLQMGVPSRFSGSGSGTDFTLTISSLQPDDVATYYCQQE
Pan troglodytes V590 ighv AACZ04001323.1 325253 TYSQVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVRQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSVSTAYLQISSLKAEDTAMYYCAR
Pan troglodytes V591 ighv AACZ04001323.1 268985 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTR
Pan troglodytes V592 ighv AACZ04001323.1 261096 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCAR
Pan troglodytes V593 ighv AACZ04001323.1 248200 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQRNSLKTEDTAVYYCTR
Pan troglodytes V594 ighv AACZ04001323.1 232745 VQCEVQLVESRGGLVQPGGSLRLSCAVSGFTFSDYYMSWVRQAPGKGLEWVGFIRNKANGGTTEYTTSVKGRFTISRDDSKSITYLQMNSLKTEDTAVYYCSR
Pan troglodytes V595 ighv AACZ04001323.1 228169 VLSQVTLKESGPALVKPTETLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKYYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI
Pan troglodytes V596 ighv AACZ04001323.1 219258 VQSQVQLVQSGAEVKKPGSSVKVSCKVSGGTFSSYAISWVRQAPGQGLEWMGVIIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAT
Pan troglodytes V597 ighv AACZ04001323.1 180533 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan troglodytes V598 ighv AACZ04001323.1 163530 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSLIYSGDSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDTAVYYCAR
Pan troglodytes V599 ighv AACZ04001323.1 144165 VLSQLQLQESGPGLVKPSQTLSLTCTVSGGSISSGSYYWSWIRQPAGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V600 ighv AACZ04001323.1 132375 VLSQLQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V601 ighv AACZ04001323.1 117942 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTVSSYHMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan troglodytes V602 ighv AACZ04001323.1 104026 VCAEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCA
Pan troglodytes V603 ighv AACZ04001323.1 67019 VQCEDQLVESGGGLVQPGGSLRPSCAASGFAFSSYVLHWVRRAPGKGLEWVSAIGTGGDTYYADSVMGRFTISRDNAKKSLYLQMNSLIAEDMAVYYCAR
Pan troglodytes V604 ighv AACZ04001323.1 59287 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYTISWLRQAPGQGLEWMGVISPSDGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
Pan troglodytes V605 ighv AACZ04001323.1 55162 AYSQMQLVQSGAEVKKPGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPYNGNTNYAQKFQDRVTITRDRSMSTAYMELRSLRSEDSAVYYCAR
Pan troglodytes V606 ighv AACZ04001323.1 21331 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDTNWVHQAPGKGLELVSGVSWNGSRMHYADSVKGRFIISRDNSRNSLYLQTNSLRAEDTAVYYCVR
Pan troglodytes V607 ighv AACZ04001323.1 5592 VLSQVQLQQWGAGLVKPSETLSLTCAVYGGSFSDYYWGWVRQPPGKGLEWIGHINYGGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V626 ighv AACZ04006124.1 838 AQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYTSWVLQAPGKGLEWVSYISGDRGYTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Pan troglodytes V666 ighv AACZ04016708.1 3334 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSLKGQFTISRDNAKNTLYLQMNSLRAEDMAVYYCTR
Pan troglodytes V684 ighv AACZ04023544.1 14426 AQSRVQLVQSGAEVKKPGASVKVSCKASGYTFTSYCMHWVRQAHAQGLEWMGLVCPSDGSTSYAQKFQGRVTITRDTSMSTAYMELSSLRSEDTAMYYCVR
Pan troglodytes V691 trdv AACZ04025178.1 11219 SSVAQKVTQAQSSVSMPVRKAVTLNCLYEASWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALWE
Pan troglodytes V708 ighv AACZ04026537.1 3200 VQCEVQLVQSGGGLVQPGGSLRLSCAGSGFTFSSYAMHWVRQAPGKGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCAR
Pan troglodytes V714 trav AACZ04027132.1 893 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Pan troglodytes V742 ighv AACZ04030958.1 1131 AQCEVQLVESGGGLVQPGGSLRLSCPASGFTFSNHYMSWVLQAPGKGLEWVSYISGDSGYTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Pan troglodytes V755 trbv AACZ04033411.1 405625 GSRLSAVVSQHPSRVICKSGTSVNIECRSLDFQATTMFWYRQLRKQSLMLMATSNEGSKVTYEQGVKEDKFPINHPNLTFSALTVTSAHPEDSSFYICSAR
Pan troglodytes V756 trbv AACZ04033411.1 393600 SMDTKVTQRPRLLVKANEQKAKTDCVPIKRHSYVYWYHKTLKEELKFLIYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDTAWYFCANSK
Pan troglodytes V757 trbv AACZ04033411.1 360520 LMEAEIYQTPRHRVIGTGKKITLECSQTMGHDKMYWSRSRNGITPHPPFLWVNSTEKGDLSSESTVSRIRIERFPLTLESASPSHTSQYLCASSE
Pan troglodytes V758 trbv AACZ04033411.1 237987 SVFSAVISQKPSRDICQRGTSMTIQCQVDSQVTMMFWYCQQPGQSMTLIATANQGSEATYESRFVIDKFPISRPNLTFSTLTVSNRRPEDSSIYLCSVE
Pan troglodytes V778 trgv AACZ04038748.1 3048 SQKSSNLEGRTKSVIRQTGSSAEITCDLDGGSTSYIHWYLHQEGKAPQRLLYYDSYTSRVVLESGISPGKYDTYTSTRKNLRLILRNLIENDSGVYYCATWD
Pan troglodytes V795 igkv AACZ04042301.1 1371 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPFRFSDSGSGTDYTLTISSLQPEDFATYYCQQSDSTP
Pan troglodytes V814 ighv AACZ04048681.1 838 AQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYTSWVLQAPGKGLEWVSYISGDSGYTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Pan troglodytes V832 igkv AACZ04051617.1 3503 ARCDIQMTQSPSSLSASVGDRVTITCWASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSDSGSGTDYTLTISSLQPEDFATYYCQQSDSTS
Pan troglodytes V856 igkv AACZ04055942.1 3935 SSGDIVMTQTPLSLPVTPGEPASISCRSSESLLDTDDEHTYLNWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Pan troglodytes V885 iglv AACZ04057800.1 2429 SVASYELTQPSSVSVSPGQTARITCSGDVLAKKYAQWFQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISGAQAEDEADYYCQSADSSGTY
Pan troglodytes V906 trav AACZ04059380.1 820 VRSQQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMMLLKGGEQKGHDKISASFNEKKQQSSLYLMASQLSYSGTYFCGAE
Pan troglodytes V907 trdv AACZ04059387.1 229436 RGMLCDKVTQSSPDQTVASGSEVVLLCTYDAVYSNPDLFWYRIRPDYSFQFVFYGDNSRSQAADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF
Pan troglodytes V909 trav AACZ04059701.1 606 VSSILNVEQSPQSLHVQEGDSTSFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKKGYSYLYIKGSQPEDSATYLCAF
Pan troglodytes V916 trav AACZ04059985.1 352 VRSQQPVQSPQAMILREGEDAVVNCSSSKALYSVHWYRQKHGEAPIFLMILLKGGEQKGHDKISASFNEKKQQSSLYLMASQLSYSGTYFCGAE
Pan troglodytes V926 iglv AACZ04060858.1 71854 SLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTINNLQSEDEADYYCETWGS
Pan troglodytes V927 iglv AACZ04060858.1 53748 SWANFMLTQPHSVSESPGQTVTISCTRSSGSIASDYVQWYQQRPGSAPTTVIYEDNRRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSS
Pan troglodytes V928 iglv AACZ04060858.1 34802 SVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEAEYYCSAWDSSLS
Pan troglodytes V929 iglv AACZ04060861.1 83190 SWAQSALTQEASMSGTVGQKVTLSCTGNSNNVGNYAVGWYQQISHGAPKTVMFGNSPPSGIPDRFSGSKSGTTASLTISGLQPEDEADYYCPTWDYSLS
Pan troglodytes V930 iglv AACZ04060861.1 76139 SLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTW
Pan troglodytes V931 iglv AACZ04060861.1 7914 VDSQTVVTQEPPFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPGRFFGSIIGNKAALTITGAQADDESDYYCLLYMGSGI
Pan troglodytes V934 trbv AACZ04061380.1 589301 PVNAGVTQTPKFRVLKTGQSMSLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAEGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY
Pan troglodytes V935 trbv AACZ04061380.1 585615 HTGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL
Pan troglodytes V936 trbv AACZ04061380.1 557754 PVIAGITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD
Pan troglodytes V937 trbv AACZ04061380.1 554021 HTGAGVSQTPSNKVTEKGKDVELRCDPISGHAALYWYRQSLGQGPEFLIYFQGTGAADDSGLPNDRFFAVRPEGSVSTLKIQRTEQGDSAVYLCASSL
Pan troglodytes V938 trbv AACZ04061380.1 549190 PVEAGVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQALGQGHQFISRYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL
Pan troglodytes V939 trbv AACZ04061380.1 546448 PVDFGVTQTPKHLITATGQQVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEESAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Pan troglodytes V940 trbv AACZ04061380.1 538481 HRDAEITQSPRHKITETGRQVTLACHQTWNHNNMFWYRQDLGHGLRLIHYSYGVQDTNKGEVSDGYSVSRSNTEDFPLTLESAASSQTSVYFCASSE
Pan troglodytes V941 trbv AACZ04061380.1 530731 LSEAEVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSILKIQPAELGDSAMYLCASSL
Pan troglodytes V942 trbv AACZ04061380.1 513382 HRDAGITQSPRHKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE
Pan troglodytes V943 trbv AACZ04061380.1 504405 LTEAGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAMYLCASSL
Pan troglodytes V944 trbv AACZ04061380.1 487407 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGAGITDKGEVPNGYNVSRSNTEDFPLSLVSAAPSQTSVYFCASSY
Pan troglodytes V945 trbv AACZ04061380.1 483192 HTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYFRSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL
Pan troglodytes V946 trbv AACZ04061380.1 475269 PVDAGVTQSPTHLIKTRGQQVTLRCSPQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFSPRFSGRQFPNYSSELNVNALELDDSALYLCASSL
Pan troglodytes V947 trbv AACZ04061380.1 468822 PVNAGVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLESAAPSLTSVYFCASSY
Pan troglodytes V948 trbv AACZ04061380.1 455808 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSACQFPNYSSELNVNALLLGDSALYLCASSL
Pan troglodytes V949 trbv AACZ04061380.1 438367 LVDAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSGLNVNALLLGDSALYLCASSL
Pan troglodytes V950 trbv AACZ04061380.1 431104 LFSAGPMNAGVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKGEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYFCASSY
Pan troglodytes V951 trbv AACZ04061380.1 426796 SISTDHTGAGVSQSPRYKVTKRGQDVTLRCDPILSHATLFWYQQALGQGPEFLTYFNYEAQPDKSGLPNDRFSAERPEGSNSTQTIQRTGQGDSAMYLCASSL
Pan troglodytes V952 trbv AACZ04061380.1 418358 PVDAGVTQSPTHLIKTRGQHVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL
Pan troglodytes V953 trbv AACZ04061380.1 411039 PVNAVVTQTPKFQVLKTGQSMTLQCAQDMNHDCMSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNKEDLPLRLESAAPSQTSVYFCASSY
Pan troglodytes V954 trbv AACZ04061380.1 406419 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFRNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL
Pan troglodytes V955 trbv AACZ04061380.1 398205 PVEAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPRRFSGRQFPNYSSELNVNALELEDSALYLCASSL
Pan troglodytes V956 trbv AACZ04061380.1 388983 HADTGVSQDPSHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQCPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQHTEQGDSAIYLCASSL
Pan troglodytes V957 trbv AACZ04061380.1 382453 SVAAGVIQSPRYLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSS
Pan troglodytes V958 trbv AACZ04061380.1 374220 HMDAGITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYDVKDTDKGEVSDGYSVSRSKTEDFLLTLESTTSSQTSVYFCAISE
Pan troglodytes V959 trbv AACZ04061380.1 363544 LIEAGVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYWQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Pan troglodytes V960 trbv AACZ04061380.1 357948 HTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMQGLELLIYFNNNVPIDDSGMPKDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL
Pan troglodytes V961 trbv AACZ04061380.1 340353 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMLDATLATLKIQPSEPRDSAVYFCASGL
Pan troglodytes V962 trbv AACZ04061380.1 333532 HIEAGVTQFPSHSVIEKGQTVTLRCDPVSGHDNLYWYRRVMGNEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Pan troglodytes V963 trbv AACZ04061380.1 328413 HGDAKVIQNPRYQVTQFEKPVTLGCSQNLNHNVMYWYQQKSSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLGDAAMYLCATSR
Pan troglodytes V964 trbv AACZ04061380.1 323428 SPGEEVTQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKKEFKFLISFQNENVFDKTGMPKERFSAKCLSNSPCSLEIQATKLEDSAVYFCASSQ
Pan troglodytes V965 trbv AACZ04061380.1 305493 LSNAGVMQNPRHLVRRRGQEARLRCSPVKGHNHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQAVRGDSAAYFCAS
Pan troglodytes V966 trbv AACZ04061380.1 302374 TVDGGITQSPKYLFRKEGQNVTLNCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Pan troglodytes V967 trbv AACZ04061380.1 294514 GSGLGAVVSQHPSRVICKSGTSVKIECRCLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR
Pan troglodytes V968 trbv AACZ04061380.1 284530 STDTKVTQRPRLLVKASEQKAKMDCVPIKGHSYVYWYRKKLEEELKFLIYFQNEELIQKAEIINERFLAQCPKNSSCTLEIQSTESGDTALYFCASSK
Pan troglodytes V969 trbv AACZ04061380.1 275456 SFHAKVTQTPGHLVKGKGQKTKMDCTPEKGHVFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNTPCSLAILSSEPGDTALYLCASSQ
Pan troglodytes V970 trbv AACZ04061380.1 264717 SMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSD
Pan troglodytes V971 trbv AACZ04061380.1 250702 LMEADIYQTPRYLVIGTGKKIALECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Pan troglodytes V972 trbv AACZ04061380.1 206037 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHDYMSWYRQDPGLGLRQIYYSVNVEVIDKGDVPEGYNVSRKEKRNFPLILESPSPNQTSLYFCASSL
Pan troglodytes V973 trbv AACZ04061380.1 200743 LVDVKVTQSSRYLVKRMGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL
Pan troglodytes V974 trbv AACZ04061380.1 181958 SVFSAVISQKPSRDICQRGTSLTIQCQVNSQVTMMFWYRQQPGQSPTLIATANQGSEATYETGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE
Pan troglodytes V975 trbv AACZ04061381.1 70022 LTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNKISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE
Pan troglodytes V976 trbv AACZ04061381.1 62404 PLDTAVSQTPKYLVTQMGNDKSLKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLDLHIKSLELGDSAVYFCASS
Pan troglodytes V977 trbv AACZ04061381.1 57785 PIDTEVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ
Pan troglodytes V978 trbv AACZ04061381.1 49916 PVEAGVTQTPRYLIKARGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL
Pan troglodytes V979 trbv AACZ04061381.1 42678 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSVGEGTTDKGEVPDGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE
Pan troglodytes V980 trbv AACZ04061381.1 25586 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHALQPEDSALYLCASSQ
Pan troglodytes V981 trbv AACZ04061381.1 20384 PVNAGVTQSPKFRVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGTTAKGEVPDGYNVSRLNTQNFLLRLESAAPSQTSVYFCATSE
Pan troglodytes V982 trbv AACZ04061381.1 10515 PLDTAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKFLKTMFIYSNKEPILNETVPNRFSPDSPDKAHLNLHINSLELGDSAVYFCASSQ
Pan troglodytes V983 trbv AACZ04061381.1 7063 PMEMGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ
Pan troglodytes V1018 igkv AACZ04063676.1 3425 AKCDIQMTQSPSTLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYAASTLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYSSTP
Pan troglodytes V1019 igkv AACZ04063678.1 58422 AYGDIVMTQSPDSLAVSLGGRATINCKSSQSILYSSNNKNYLAWYQQKPGQPPKLLIYWASTRQSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQHYSAP
Pan troglodytes V1020 igkv AACZ04063678.1 46761 TRAETTLTQSPAFVSATPGDKVTISCKASQDIDDDMNWYQQKPGEAAIFIIQEATTLVSGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQDDNFP
Pan troglodytes V1062 ighv AACZ04067065.1 2665 VQCEVQLVQSGGGLVQPGGSLRLSCAGSGFTFSSYAMHWVRQAPGKGLEWVSAIGTGGGTYYADSVKGRFTISRDNAKNSLYLQRNSLRAEDMAVYYCAR
Pan troglodytes V1099 ighv AACZ04069745.1 70468 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYFIHWVRQAPGQGLEWMGRINPNSGGTNYAQKFQSRVTMTRNTSISTDYMELSSLRSEDTATYYCTT
Pan troglodytes V1100 ighv AACZ04069745.1 38088 VLSQVQLQQSGPGLVKPSQTLSLTCAISRDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAASVQSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR
Pan troglodytes V1101 ighv AACZ04069747.1 17971 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPRQRLEWMGWINTGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR
Pan troglodytes V1102 ighv AACZ04069748.1 89649 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMSSLRAEDTALYYCAR
Pan troglodytes V1103 ighv AACZ04069748.1 76630 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRDTSISTAYMELSSLRSEDTAVYYCAR
Pan troglodytes V1104 ighv AACZ04069748.1 55883 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMSWVRQAPGKGPEWVANIKKDGSEKYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR
Pan troglodytes V1105 ighv AACZ04069748.1 31631 VLSQVTLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLALIYSDNDKRYSPSLKSRLTITKDTSKNQVVLTMTNMDPVDTATYYCAHR
Pan troglodytes V1106 ighv AACZ04069748.1 18882 AHSQVQLVQSGSEVKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR
Pan troglodytes V1107 ighv AACZ04069748.1 5989 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V1108 ighv AACZ04069749.1 59833 THAQVQLVQSGAEVKKPGATVKISCKASGYTLTELSMHWVRQAPGKRLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
Pan troglodytes V1109 ighv AACZ04069749.1 50146 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMHWVRQAPEKGLEWVSTISGSGGSTWYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Pan troglodytes V1110 ighv AACZ04069749.1 39278 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVGFIRTKAKGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTK
Pan troglodytes V1111 ighv AACZ04069749.1 16561 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSYISYDSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAT
Pan troglodytes V1112 ighv AACZ04069750.1 11371 VLSQVTLKESGPVLVKPTETLTLTCTISGFSLSNAGMGVSWIRQPPGKALEWLAHIFWNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCTRR
Pan troglodytes V1113 ighv AACZ04069751.1 399 VLSQVQLQESGPGLVKPSQTLSLTCAVSGGSISSSGYYWSWIRQPPGKGLEWIGYIDYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCAR
Pan troglodytes V1119 ighv AACZ04069893.1 3740 VQCQVRLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR