WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rhinopithecus roxellana JABR00000000.1 (JABR01) 240 48 45 39 46 51 7 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rhinopithecus roxellana V36 trbv JABR01013263.1 181 HMGAGVSQSPRYKVTKKGQDVVLSCDPISGHEALYWYQQALGQGPKFLTYFNYEAQPDKSGLPNDRFSAERPKGSVSTLTIQRTEQRDSAVYLCASSL
Rhinopithecus roxellana V50 iglv JABR01016432.1 2932 SWAQCVLTQPPSVSAAPGQRVTISCSGSSFNFRRYYVSWYQQLPGAAPKLLIYDVNKRTSGVPERFSGSQSGTSATLSISGLRPEDEANYYCLAWITA
Rhinopithecus roxellana V51 iglv JABR01016432.1 14605 SLSQPVLTQPPSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNIQEEDESDYHCGA
Rhinopithecus roxellana V52 iglv JABR01016432.1 27493 SLSQPVLTQPTSLSASPGASARLTCTLSSGINVGSYRIFWYQQKPGSPPRYLLWYKSDSDKHQGSGVPSRFSGSKDASANAGILRISGLHSEDEADYYCTI
Rhinopithecus roxellana V53 iglv JABR01016432.1 31783 SWAQSVLTQPPSASGPPGQSVTISCSGSSSNIGSNYVYWYQQLSGKAPKLLIYDNNKRPSGVPDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSG
Rhinopithecus roxellana V67 igkv JABR01020048.1 1485 AYGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQAPKLLIYWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDMAVYYCQQYY
Rhinopithecus roxellana V68 igkv JABR01020049.1 29726 AKCDVQLTQSPTFLSASVGDRVTIACRASQSINRGLAWYQQKPGKAPKLLISYASSLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCF
Rhinopithecus roxellana V69 igkv JABR01020050.1 16092 SSGDTVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSHFPGVPDMFTVSGSDTDFTLQISRVKAEDVGVYYCVQCLQI
Rhinopithecus roxellana V153 iglv JABR01043229.1 142543 VVTQEPLLSVSSGGTVAITCGLSSGPVSTSNYPSWYQQTPGQAPRTLIYSTNTRPSGVPDRFSGSILGNKAALTITGAEADDESDYYCVLYMGSGI
Rhinopithecus roxellana V193 trgv JABR01052882.1 79063 SQKSSNLEGRTKSVTRPAGSSAEITCDFSGDSNLYIHWYLHQEGKAPQRLLYYEPYYFKVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGVYYCATWD
Rhinopithecus roxellana V194 trgv JABR01052882.1 83798 SQKSSNLEGRTKSVTRPAGSSAEITCDLPEFSSFYIHWYLHQEGKAPQRLLYCDSSNSRVVLESGISPGKYDTYVSTRRNLRLRLRNLIENDSGVYYCANWD
Rhinopithecus roxellana V195 trgv JABR01052882.1 88184 SQKSSNLEGRTKSVTRPTGSSAEITCDFSGDSNFYIHWYLHQEGKAPQRLLYYDVSNSRDVLESGLSLGKYYTHTRTRWSWILILRNLIENDSGVYYCATWD
Rhinopithecus roxellana V196 trgv JABR01052882.1 102520 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCILDDGTVRKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWE
Rhinopithecus roxellana V197 trgv JABR01052882.1 119743 EQFQLSVSTEVKKSIDIPCKIQSTNFANDVIHWYWQKPNQALEHLIYITSTKSAVQGSMGKRSNKVEARKNSQTLTSILTIKSVEKEDMAIYYCAGWD
Rhinopithecus roxellana V198 trgv JABR01052882.1 133910 TSGDNLITQLVTSVTKKKGNTAFLECQIKSSTFQKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Rhinopithecus roxellana V199 trgv JABR01052882.1 135990 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLEKTIVHWYQQKEGKPLRRILYGSAKNYKQDRPNPHLEADDKHNGIFYLIINNVAKLDEATYYCACWD
Rhinopithecus roxellana V229 iglv JABR01058206.1 332 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPHWFQQKPGQAPKTLIYDTNNKLSWTPARFSGSLAEGKAALTLSGAQPEDEAEYYCLLYYSDA
Rhinopithecus roxellana V232 ighv JABR01059011.1 296 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYHMSWVRQAPGKGLEWVGFIRNKASGGTAEYAASVKGRFTISRDDSKSITYLQMNSLKTEDTAVYYCAR
Rhinopithecus roxellana V233 ighv JABR01059011.1 15568 VQCEVQSVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGPEWVSDISGSTIYYADSVKGRFTVSRDDAKNSLSLQMDSLRAEDTAVYYCARE
Rhinopithecus roxellana V234 ighv JABR01059011.1 21849 AAGGVWGRPGTAWGSLRLSCAASGFTFSSYDMHSIRQAPGKGLQWISVISTSGGTIYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCAR
Rhinopithecus roxellana V235 ighv JABR01059012.1 2631 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLALIYWDDDKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAQG
Rhinopithecus roxellana V236 ighv JABR01059012.1 17064 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYAMNWVRQAHGQRLEWIGWINTNTGNPTYAQGFKERFAFSMDTSISTAYLQISSLKAEDTAVYYCAR
Rhinopithecus roxellana V249 ighv JABR01062345.1 2437 AQSQEQLVQSGAEVKKPGASVKVSCKASGFTFSSDAISWVRQAPGQGLEWMGRIIPILSRTNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Rhinopithecus roxellana V269 ighv JABR01066987.1 11842 VQCEVQLTESGGGLVQPDGSLRLSCAASGFTFSSYAMQWVHQAPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNTKNSLYLQMNSLRAEDTAVYYCAR
Rhinopithecus roxellana V270 ighv JABR01066987.1 19345 AHSQEQLVQSGAEVKKPGASVKVSCKASGFTFDSSAISWVRQAPGQGLEWMGVIIPVAGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAMYYCAA
Rhinopithecus roxellana V284 ighv JABR01070187.1 4811 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPGQGLERMGWINTGSGSTGYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCTT
Rhinopithecus roxellana V285 ighv JABR01070187.1 7646 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMQWVRQAPGKGLQWVGLIRNKANGGTTDYSVSVKGRCTISRDDSKSITSLQMNSLKTEDTAVYYCAR
Rhinopithecus roxellana V286 ighv JABR01070187.1 14435 VQCEMQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWVSAISIGGGTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDMAVYYCAR
Rhinopithecus roxellana V293 ighv JABR01071186.1 7810 VKCEVQLVKSGGGLVQPGGSLRLSCATSGFTFSDHYVEWVSQVPGKGLQWVGQVNPNGGTTFLMDPVKGRFTISRDNAKNTLYLQINSLKTEDTAVYYCAR
Rhinopithecus roxellana V294 ighv JABR01071187.1 5670 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPRKALEWLAHIYWDDDKYYSASLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI
Rhinopithecus roxellana V298 ighv JABR01071886.1 1826 VWSQVTLKESGPALVKPSQTLTLTCTFSGFSISTSGTGVGWIRQPSGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAHI
Rhinopithecus roxellana V307 ighv JABR01074704.1 2138 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYNYWSWIRQPPGKGLEWIGHIYGNSASTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Rhinopithecus roxellana V310 ighv JABR01074958.1 128 VQCEVQLVESGGGLVQPGGPLRLSCAASGFTFSDYYMPWVRQAPGKGLEWVGHIKNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAT
Rhinopithecus roxellana V316 igkv JABR01076259.1 8847 SSGDIVMTQTPLSLPITVGETASISCRSSQSLLSSNGYNYLSWYLQKPGQSLQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCMQTLQTP
Rhinopithecus roxellana V317 igkv JABR01076260.1 857 STGDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSSGNTYLSWFQQKPGQSPRRLIYKVSNRDSGVPDRFTGSGAGTDFTLKISRVEAEDVGVYYCMEG
Rhinopithecus roxellana V318 igkv JABR01076260.1 17031 SKGEIVLTQSPAFRSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSF
Rhinopithecus roxellana V319 igkv JABR01076261.1 12126 TTGEIVLTQSPAILSLSPGERATFSCRASQSIGSNLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQKYSSSP
Rhinopithecus roxellana V320 igkv JABR01076261.1 17939 VRCDIQMTQSPSFLSASVEDTVTITCQVSQSISNDLAWYQQKPGKSPTLLIYDATNLHPGFPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Rhinopithecus roxellana V321 igkv JABR01076261.1 78881 VRCDIQMTQSPSSLSASVGDRVTITCRASQSFSSSLAWYQQKLGKAPKLLIYGASSLQSGIPSRFSGSKSGTDFTLTISSLQPEDVAAYYCQQYYSYP
Rhinopithecus roxellana V322 igkv JABR01076261.1 111084 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYAASSLASGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYNSA
Rhinopithecus roxellana V323 igkv JABR01076261.1 121608 TTGEIVMTQSPATLSLSPGERATLSCRASQSAGSNLAWYQQKPRQAPRLLIYGASSRATGIPARFSGSGSGTDFTLTISSLEPEDVGIYYCQQYNDWP
Rhinopithecus roxellana V324 igkv JABR01076261.1 164506 ARCDIQMSQSPSSLSASVGDRVTITCQASQGISNALAWYQQKPGKAPKLLIYDASSLDSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSDP
Rhinopithecus roxellana V325 igkv JABR01076263.1 15352 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSYLSWYQQKPGKAPKLLIYKASSLASGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQHNSLP
Rhinopithecus roxellana V326 igkv JABR01076263.1 29172 ARCDIQMIQSPSSLPASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYYATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCLQHNSDP
Rhinopithecus roxellana V327 igkv JABR01076263.1 35504 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSNP
Rhinopithecus roxellana V328 igkv JABR01076263.1 51713 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLVWYQQKHGQAPTLLIYGASSRATGIPARFSGSGSGTDFTLTISSLEPEDVGVYYCQQDYSWP
Rhinopithecus roxellana V329 igkv JABR01076263.1 105625 ARCDIQMTQSPSSLSASVGDTVTITCQASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSNP
Rhinopithecus roxellana V330 igkv JABR01076263.1 125400 TTGEIVMTQSPATLSLSPGERATLSCRASQSVGSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYFCQHYNNWN
Rhinopithecus roxellana V331 igkv JABR01076264.1 9606 ARCDIQMTQSPSSLSASIGDTVTITCHASQSISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGRGSGTDFTLTISSLQPEDFATYYCQKCNSNP
Rhinopithecus roxellana V332 igkv JABR01076265.1 8187 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYYCQQGSNLP
Rhinopithecus roxellana V333 igkv JABR01076266.1 4596 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNYLAWYQQKPGKAPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGNSYP
Rhinopithecus roxellana V334 igkv JABR01076266.1 22550 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSYLAWYQQKPGKAPKLLIYDASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFAAYYCQQGNSNP
Rhinopithecus roxellana V362 trav JABR01080842.1 1738 LSGEDQVTQSPEALRLREGESSSLNCSYTVSSLRGLLWYRQDPGKGPEFLFILYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Rhinopithecus roxellana V396 trav JABR01087109.1 21988 MMTGTIETTGNISAKKGGSVLLQCHLSSTMAQVTQVSWEQQDQLLAICNADLGWHISPAFKDRVAPGPGLDLTLQSLTMNDTGEYFCIYHTYPDGT
Rhinopithecus roxellana V401 igkv JABR01088351.1 10563 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGYTYLDWYLQKPGQSPQLLIYEVSNRASGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEYP
Rhinopithecus roxellana V402 igkv JABR01088351.1 62713 ARCDIQMTQSPSSLSASVGDRVTITCRASQSINKELSWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP
Rhinopithecus roxellana V403 igkv JABR01088351.1 74392 SSGEIVMTRTPLSLPITPGEPASISCRSSQSLMDGDDGFTYLYWYLQKPGQSPQLLMHFASYRASGVPDRFSGSGSGTDFTLEISKVEAEDIGVYYCMQALELP
Rhinopithecus roxellana V404 igkv JABR01088351.1 103869 SSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLHSNGYTYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALEFP
Rhinopithecus roxellana V405 igkv JABR01088351.1 113705 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISNDLAWYQQKLGETPKLLIYDASSLQSGIPSRFSGSGSGADFTLTISSLQPEDFATYYCQHYYSAP
Rhinopithecus roxellana V406 igkv JABR01088351.1 136168 ARCDIQMTQSPSSLSASVGDRVTISCQASQNIYSNLGWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHGYSTP
Rhinopithecus roxellana V407 igkv JABR01088351.1 159356 ARCDIQMTQSPSSLSASVGDRITITCQASQGISNDLAWYQQKPGESPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHYYSTP
Rhinopithecus roxellana V408 igkv JABR01088351.1 170247 ARCDIQMTQSPSSLSASVGDRVTISCQASESISDYLNWYQQKPGKAPKLLIYAASTLQSVVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHGYGT
Rhinopithecus roxellana V418 ighv JABR01089346.1 862 AQSQVQLVQSGAEVKKPGASVKVSCKASGYNFRSYAISWVRQAPGQGLEWMGVIIPIRSRTSYAQKFQGRVTITADTSTSTAYMELSSLRSEDMAVYYCAR
Rhinopithecus roxellana V422 ighv JABR01090264.1 62 VWSQVTLKESGPALVKPTQTLTLTCTFSGFSISTSGTGMGWIRQPSGKALEWLASIYWNYSKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAHI
Rhinopithecus roxellana V430 ighv JABR01091180.1 15342 VLSQVQLQESGPAVVKPSETLSLTCAVSGGSISSYYYWSWIRQPPGKGLEWIGYIYGSGGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Rhinopithecus roxellana V431 ighv JABR01091180.1 47021 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSVGSNWWGWIRQAPGKGLEWIGHIHYSGSSYLNPSLKSRVTLSVDKSKNQFSLKLSSVTAADTAVYYCTR
Rhinopithecus roxellana V432 ighv JABR01091180.1 60298 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPEKGLEWVSYINSDGSSTSYADSMKGRFTISRDNAKNSLYLQMNSLRAEDRAVYYCVR
Rhinopithecus roxellana V433 ighv JABR01091180.1 68035 VQCEVQLVESGGGLVQPGGSLRISCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSKNYATDYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTT
Rhinopithecus roxellana V434 ighv JABR01091180.1 78925 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSSYYMHWVRQAPGKGLEWVGLIKNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Rhinopithecus roxellana V444 trbv JABR01092448.1 785 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHSSLFWYRQTMMRGLEFLIYFNNKSPIDDSGMPKDRFSAKMPDASFSTLRIQPSEPRDSAVYFCASSL
Rhinopithecus roxellana V445 trbv JABR01092448.1 15341 LIDAGVTQTPRHKVTEIGQEVTMRCQPILGHNTVFWYRQTMMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Rhinopithecus roxellana V446 trbv JABR01092448.1 22325 HIEPGVTQFPSHRVIEKGQTVTLRCDPISGHDYLYWYRRVIGKEIKFLIYFMRASMQDESGMPKKRFSAERTGGTYSTLKLQPAELEDSGVYFCASSQ
Rhinopithecus roxellana V447 trbv JABR01092448.1 27432 HGDVMVIQNPRYQVTQSGKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Rhinopithecus roxellana V448 trbv JABR01092448.1 32726 SPGEEVTQTPKHLVKGEGQKAKLYCAPITGHSYVFWYQQVLKKEFKFLISFQNEDVVDETQMPKERFSAKCPRNSPCSLEIQATKLKDSATYFCASSQ
Rhinopithecus roxellana V449 trbv JABR01092448.1 49781 LSNAGITQNPRHLVRRRGQEARLRCSPMKGHSHVYWYQQLPEEGLKFMVYLQKEKIIDESGMPKERFSAEFPKEGPSILRIQQAEQEDSAAYFCAS
Rhinopithecus roxellana V450 trbv JABR01092448.1 60805 GFGLGAVVSQSPSRVICKRGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNEGSSVTYEQGIKKDKFPINHSDLTFSTLTVTNAHPEDSSFYICSAR
Rhinopithecus roxellana V451 trbv JABR01092448.1 70825 STDTKVTQRPRLLVKANEQKAKMECVPIKGHSYVYWYRKKLDEELKFLVYFQNEVIIQKAEIINERFSAQCPQNSSCTLEIQSTESGDAALYFCASSK
Rhinopithecus roxellana V452 trbv JABR01092448.1 79739 SFHAKVTQTPGYLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFTFLISFQSEQVLQETELHKKRFSSQCPKNPPCSLEILSSEPGDTALYLCASSQ
Rhinopithecus roxellana V453 trbv JABR01092448.1 88949 SMDADVTQTPRNMIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIYYSFDVKDINKGEISDGYSVSRQEQAQFSLSLESATPNQTALYFCATSD
Rhinopithecus roxellana V454 trbv JABR01092448.1 97428 LMEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRIRIEHFPLTLESASPSHTSQYLCASSE
Rhinopithecus roxellana V455 trbv JABR01092448.1 131674 PLEAQVTQNPRHLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSINVEVIDKGDIPEGYNVSRKEKTNFPLILESPSPSQTSLYLCASSL
Rhinopithecus roxellana V456 trbv JABR01092448.1 137253 LVDVKVTQSSRHLIKRMGEKVFLECVQDMDHERMFWYRQDPGLGLQLIYFSYDVKVNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Rhinopithecus roxellana V467 igkv JABR01094257.1 835 SSGDIAMTQTPLSLPVTPGELASISCRSSQSLLHSDGKTYLNWYLQKPGQSPQLPIYTVSNQASGVQERFSGSGSGTDFTLKISRVEAEDVGVYYCMQD
Rhinopithecus roxellana V483 trbv JABR01095741.1 145130 SLDTAVSQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLQIMFSYNNKELIINETVPNRISPDSPDKAHLILHIKSLELGDSAVYFCASSQ
Rhinopithecus roxellana V484 trbv JABR01095741.1 149742 PTDAGVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPEIMFMYNYEQLSINESVPSRFSPECSKSSLLNLHLQALQPEDSALYLCASSQ
Rhinopithecus roxellana V485 trbv JABR01095742.1 5772 HTEPEVTQTPSHRVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVYFYNDEISEKSEIFDDRFSVGRPDGSNFTLKIKSTKLEDSAMYFCASSE
Rhinopithecus roxellana V486 trbv JABR01095742.1 13383 SLDTAVSQTPKYLVTQMGKKESLKCEQNLGHDAMYWYKQDSKKLLKIMFSYNNKELILNETVPNRISPDSPDKAHLILHIKSLELGDSAVYFCA
Rhinopithecus roxellana V487 trbv JABR01095742.1 21875 HTEPEVTQTPSHQVTRMGQEVILWCVPISNHFYFYWYRQILGQKVEFLVSFVNDNISEKSKIFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Rhinopithecus roxellana V488 trbv JABR01095742.1 32725 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLRHNAMYWYKQKAKKPPELMFSFNYEKLSLNESVPSRFSPECSKSSLLYLHVHALQPEDSALYLCASSQ
Rhinopithecus roxellana V543 iglv JABR01189674.1 738 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKILIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCEAWDDSLSA
Rhinopithecus roxellana V547 igkv JABR01194774.1 890 SSGDIVMTQTPLSLPVTPGEPASDSCRSSQSLLHSDGRTYLCWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Rhinopithecus roxellana V548 trbv JABR01196792.1 5407 SVFSALVSQKPSRDVCQRGTSVTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYEGGFVIDKFPISRPNLTFSTLTVSNTSPEDSSIYLCSVE
Rhinopithecus roxellana V570 ighv JABR01004697.1 66786 VQGEVQLVESGGGLVQPGGSLRLSCAASGFTFGDYAMSWVRQAPGKGLEWVSYISSASSTIYYADSVKGRFTISRDNAKNTLSLQMNNLRAEDTAVYYCAK
Rhinopithecus roxellana V571 ighv JABR01004697.1 16063 AQSQVQLVQSGAEVRKPGDSVKVSCKASGYTFTNHNVDWVRQAPGQGLVWMGGINTNTGGTSCAQTFQGRVTMTRDTSTSTAFMELSCLRSEDTAVYYCAR
Rhinopithecus roxellana V572 ighv JABR01004697.1 6981 AHSQVQLVQSGAEIKQPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNTGYAQNFQGRVTMTTDTSTSTGYMEMSSLRSEDTAVYYCTR
Rhinopithecus roxellana V573 ighv JABR01004698.1 36419 VQCELQLVESGGDLVQPGGYMRLSCAASGFTFSNYCISWVCQAPEKGLEWVSRINRDGSSTYYADSMKGQVTISRENAKNTLYLQMNNLRAEDKAVYYCTR
Rhinopithecus roxellana V574 ighv JABR01004698.1 27711 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSSAMHWVRQASGKGLEWVGRIRSKSNNYATDYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Rhinopithecus roxellana V599 ighv JABR01011024.1 590 VQCEVQLVESGGGLAKPAGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSYINSGGGSTRYADSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAR
Rhinopithecus roxellana V621 igkv JABR01017709.1 4854 SGDIILNQTPASLTAPLGETVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPAQYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Rhinopithecus roxellana V623 trav JABR01018466.1 7046 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Rhinopithecus roxellana V624 trav JABR01018466.1 4793 ATHMFHVQQTEMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGPNRKLIYNFKQGHFPRVKEIGDTNNPGNTDFSIRIHEISLADAGTYYCVK
Rhinopithecus roxellana V666 igkv JABR01032523.1 3227 CNGDIVLTQSPASLAVSPGQRATITCRASESVNFFGINLIHWYQQKPGQPPKLLIYQVSNKDTGVPARFSGIGSGTDFTLTINPVEADDAANYYCLQSKNFP
Rhinopithecus roxellana V678 ighv JABR01035059.1 55357 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMGWVRQAPGKGLEWVGRIKKTTDGGTAEYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAR
Rhinopithecus roxellana V679 ighv JABR01035059.1 35543 VQGEVQLVESGGGLAKPAGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVSAINSGGGSTYYADSVKGRFTISRDNSKNMLYLQMNNLRAEDTAVYYCAR
Rhinopithecus roxellana V680 ighv JABR01035060.1 86575 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRVTISRDDSKSITYLQMSSLKTEDTAVYYCAR
Rhinopithecus roxellana V681 ighv JABR01035060.1 83075 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSLSGYYWGWIRQPPGKGLEWIGYISGSSGSTNYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Rhinopithecus roxellana V682 ighv JABR01035060.1 71625 VQGEVQLVESGGGLVQPEGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVAVIWYDGSQKYYADSVKGRFTISRDNAKNTLYLQMDSLRAEDTAVYYCAK
Rhinopithecus roxellana V683 ighv JABR01035060.1 22081 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGQVTISADKSISTTYLQWSSLKASDTATYYCAK
Rhinopithecus roxellana V700 trdv JABR01039933.1 549 VMSAIELVPEHQTVTVSVGNPATLRCSMKGEAISNYYINWYRKTQDNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Rhinopithecus roxellana V701 trav JABR01039935.1 89442 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINALHWLQQHPGRGIVSLFMLSSEKKKNGRLIATINIQERHSSLHITASQPRDSAIYICAV
Rhinopithecus roxellana V702 trdv JABR01039935.1 8653 VSLDIILEPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILVSKLSNNSNDNLGNNFKVKIDPLKSQFMLDIQKATTQDVGTYYCASD
Rhinopithecus roxellana V703 trav JABR01039937.1 2567 LSGELKVGQNPLFLSTQEGRNYTVYCNYSTASDRLYWYRQNPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLYITAALQDLSATYFCAV
Rhinopithecus roxellana V708 igkv JABR01041956.1 34454 TAGQVILTQSPATLSLSTGEIATLSCRASQSVNRYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYNSRY
Rhinopithecus roxellana V737 ighv JABR01049702.1 1086 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYLSWVRQAPGKGLEWVSFMRNNANGGRTEYAASVKGRCTISRDDSKSITSLQMSSLKTEDTAVYYCAR
Rhinopithecus roxellana V757 ighv JABR01055994.1 15343 AQSQVQLVQSGAEVKKPGASVKLSCKASGYTFTSYNINWVRQAPGQGLEWMGWINPSSGSTGYAQNFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Rhinopithecus roxellana V781 igkv JABR01061517.1 25242 SSGDVVMTQTPLSLPVTPGEPASISCRSSESLLHSNGNTYLHWYLQKPGQSPQLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQGTKAP
Rhinopithecus roxellana V782 igkv JABR01061517.1 4015 ARCDIQMTQSPSSLSASVGDRVTITCRSSQGINNYLSWCQQKPGKAPKPLIYYASSLETGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCQQYDNLP
Rhinopithecus roxellana V789 ighv JABR01063291.1 18385 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHYMHWVHQAPGKGLEWVGFIRNNANGATTEYAASVKGRFTISRDDSKSVASLQMNSLKTEDTAVYYCAR
Rhinopithecus roxellana V790 ighv JABR01063291.1 3340 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMGVGWIRQPPGKALEWLALIYWDDDKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCVRR
Rhinopithecus roxellana V794 igkv JABR01064858.1 389 SSGDVVMTQSPLSLPVTPGQPASISCRSSQSLVHSDGNTYLSWFQQKPGQPPRRLIYKVSNRDSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCLQGTYFP
Rhinopithecus roxellana V806 igkv JABR01067077.1 5343 SSGDVVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYKVTNRESGIPDRFSGSASGTDFTLKINRVEHEDVGVYYCMQSTKF
Rhinopithecus roxellana V813 ighv JABR01068488.1 997 AQSQVQLVQSGAEVKKPGASVKVSCKASGYNFRSSAISWVRQAPGQGLEWMGVIIPILSRTNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCTR
Rhinopithecus roxellana V832 trbv JABR01071814.1 59465 VRSQTVHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGVGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWS
Rhinopithecus roxellana V833 iglv JABR01071855.1 182209 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Rhinopithecus roxellana V834 iglv JABR01071855.1 158827 SWAQSALTQPRSVSGSPGQSVTISCTGTSNDVGSYNSVSWYQQHPGKAPKLVIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSGT
Rhinopithecus roxellana V835 iglv JABR01071855.1 129266 SAASYELTQPPSVSVSPGQTARITCSGDTLPDNYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSSDSSGNH
Rhinopithecus roxellana V836 iglv JABR01071855.1 118485 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGTALKLMIYGVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYSSSYY
Rhinopithecus roxellana V837 iglv JABR01071855.1 100498 CPDSASLSGSSGQLVTISCTGTSSDVGSYNIVSWYQQHPGTGPQLMIYHVSYRPSGVPDRFSGSKSGNTASMIISGFQVEEEADYYCYSYTSS
Rhinopithecus roxellana V838 iglv JABR01071856.1 101374 SVASYELTQPPSVSVSPGQTAKITCSGDILAKYYAQWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGTTVTLTISRAQAEDEADYYCYSGDDNN
Rhinopithecus roxellana V839 iglv JABR01071856.1 91704 SWAQSALTQPRSVSGSPGQSVTISCTGTSNDVGSYNSVSWYQQHPGKAPKLVIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Rhinopithecus roxellana V840 iglv JABR01071856.1 79218 FVASYELTQPPSVSVSPRQTARITCGGDNIGSKAVHWYQQKPAQAPVLVIYNDSERPSGIPERFSGSNSGNTATLTISGVQAGDEADYYCQVWDSSS
Rhinopithecus roxellana V841 iglv JABR01071856.1 72208 SVVSSELTQDPAVSVALGQTVKITCQGDSLSSYYASWYQQKPGQVPVLVIYGNSNRPSGIPDRFSGSYSGNTASLTITGAQVEDEADYYCGSWDSSGNY
Rhinopithecus roxellana V842 iglv JABR01071856.1 51958 SAASYELTQPPSESVSPGQTARITCGGDNIGSKAVHWYQQKPAQVPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Rhinopithecus roxellana V843 iglv JABR01071856.1 47494 SVVSSELTQDPALSVALGHTVRITCQGDSLKTYYASWYQQKPGQVPVLVIYGNSNRPSGIPGRFSSSYSGNTGSLTITAAQVEDEAVYYCHSWDSSGNY
Rhinopithecus roxellana V844 iglv JABR01071856.1 32262 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNLVSWYQQHPGTAPKLVIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGS
Rhinopithecus roxellana V845 iglv JABR01071856.1 22750 SVASYELTQPPSVSVSPGQTARITCSGDVLKENYADWYQQKPGQAPVLVIHEDSKRPSGIPEQFSGSTSGDTNTLTISSSLSEDEADYYCFSGNENN
Rhinopithecus roxellana V846 iglv JABR01071856.1 14425 SAASYDVTQPQSVSVSPGQTARITCGGDNIGSKAVHWYQQKPAQAPVLVIYDDSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Rhinopithecus roxellana V847 iglv JABR01071859.1 172231 SWAQSVLTQPPSASEAARKSVTISCSGSSSNIGSNRVSWYQQLPGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQTEDEADYYCAAWDDSLSS
Rhinopithecus roxellana V848 iglv JABR01071859.1 109512 LTSQAEVIQETSWTTNPGETITLTCGSSARAVTISNYTDWFQQKPNQVPRGLTGDNTYRNPNVPEWFSGSLSAGKAIFTTTGAQPEDEAFYYCALW
Rhinopithecus roxellana V849 iglv JABR01071860.1 32760 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSGNYPYWFQQKPGQAPTALIYATSSKHSWTPARFSGSILGGKAALTLSGAQPEDEADYYCSLYYSGA
Rhinopithecus roxellana V850 iglv JABR01071860.1 14861 SWAQSVLTQPPSVSPDPGQKVTISCSGSSSNIGRSYVSWYQQLPGIAPKLLIYESNKRPSGISDRFSGSKSGTSASLGITGLQTGDEADYYCSAWITA
Rhinopithecus roxellana V851 iglv JABR01071860.1 9405 SWAQSVLTQPPSVSGVPGQKVTISCTGSSSNIGGYYVQWYQQLPGTAPKLLIYQDNKRPSGVSDRFSGSKSGTSASLAITGLQSEDEADYYCGTWDSSLNG
Rhinopithecus roxellana V852 iglv JABR01071860.1 4284 SWAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYYVSWYQQLPGTAPKLLIYQDNKRPSGISDRFSGSKSGTSASLAITGLQTEDEADYYCQSYDSSLSG
Rhinopithecus roxellana V853 iglv JABR01071861.1 16072 SNSQAVVTQEPSLTVSPGGTVTLTCGCSTGAVTSGNYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLAEGKAALTLSGAQPEDEAEYYCLLYYSDA
Rhinopithecus roxellana V854 iglv JABR01071861.1 8014 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYHIHWYQQKPGSPPRYLLWYKSDSDKHQGSGVPSHFSGSKDASANTGILRISGLQSEDEADYYCAI
Rhinopithecus roxellana V855 iglv JABR01071861.1 2595 SWAQSVLTQPPSASGIPGQSVTISCSGSSSNIGSNNVYWYQQFPGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCEAWDDNLSG
Rhinopithecus roxellana V856 iglv JABR01071862.1 97675 SNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPYWFQQKPGQAPRALIYNTNSKYSWTPARFSGSLAEGKAALTLSGAQPEDEAEYYCLLYHSGT
Rhinopithecus roxellana V857 iglv JABR01071862.1 72015 SNSQAVVTQEPSLTVSPGGTVTLTCGCSTGAVTSGNYPYWFQQKPGQAPRTLIYDTSNKLSWTPARFSGSLAEGKAALTLSGAQPEDEAEYYCLLYYSDA
Rhinopithecus roxellana V858 iglv JABR01071862.1 63969 SLSQPVLTQPASLSASPGASASLTCTFSSGINVAGYTIHWYQQKPGSPPRYLLRYKSDSDKHQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Rhinopithecus roxellana V859 iglv JABR01071862.1 59040 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKILIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCEAWDDSLSA
Rhinopithecus roxellana V860 iglv JABR01071862.1 41682 SWAQSVLTQPPSVSGTPGQRVTISCTGSSSNIGVGYYVSWYQQLPGTAPKLLIYQDNKRPSGISDRFSGSKSGTSASLAITGLQSEDEADYYCQSYDNSLSG
Rhinopithecus roxellana V861 iglv JABR01071862.1 13609 SLSQPVLTQPTSLSASPGASARLTCTLSSGINVGSYRIFWYQQKPGSAPRYLLSYYTDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMI
Rhinopithecus roxellana V862 iglv JABR01071862.1 8280 SWAQSVLTQPRSASGTPGQRVTISCSGSSSNTGSNYVSWYQQLPGTAPKPLIYYDDKQASGVSDRFSGSKSGTSASLAISGLQSEDEADYYCATWDNSLSG
Rhinopithecus roxellana V885 iglv JABR01077598.1 23139 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQPEKAPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWDTG
Rhinopithecus roxellana V886 iglv JABR01077599.1 3832 SLSQPVLTQPPSLSASLGASARLTCTLSSDISVGGKIVYWYQQKPGSNPRYLLSYYSESSKHQGSGVPGRFSGSKDASTNLGILHISGLQPEDEADYYCKIWHD
Rhinopithecus roxellana V887 iglv JABR01077601.1 58941 SWANFMLTQPHSVSGSVGQKVVISCTRSSGSIGSYYVQWYQQRPGSAPTTVIYDDNERPSGVPDRFSGSIDSSSNSASLTISGLETEDEADYYCQSYDSSS
Rhinopithecus roxellana V888 iglv JABR01077601.1 29087 PVVQAGLTQPPSVSKGLRQTATLTCTGSSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLS
Rhinopithecus roxellana V889 iglv JABR01077601.1 18743 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIGSYYVQWYQQRPGSAPTTVIYNDNKRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSAADSYS
Rhinopithecus roxellana V890 iglv JABR01077601.1 14262 SVSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQPEKAPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWEGG
Rhinopithecus roxellana V891 iglv JABR01077602.1 65867 SWAQSVLTHLPSVSGSPGQRVTIFCTGSSNNVTDTYPVNWYQHLPGACLDFSSLVIVTDPQESLIDFSGSKSGNLASLTITGLWPEDEADYHCQS
Rhinopithecus roxellana V892 iglv JABR01077603.1 13286 VDSETEVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRMIIYNTNTRPSGVPDRFSGSILGNKAALTITGAEADDESDYYCVLYMGSGI
Rhinopithecus roxellana V893 ighv JABR01077916.1 13346 VQCEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYAMHWVRQAPGKGLEWVSVISTSGGSTYYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Rhinopithecus roxellana V894 ighv JABR01077916.1 8350 VLSQVQLQESGPGLVKPLETLSLTCAVSGYSISSGYYWSWIRQPPGKGLEWIGRIYGSSGSTDYNPSLKSRVTISKDTSKNQFSLKLSSVTAEDTAVYYCAR
Rhinopithecus roxellana V895 ighv JABR01077917.1 13819 VLSQVQLQQWGEGLVKPSETLSLTCAVSGGSISSYWWSWIRQPPGKGLEWIGEINGNSGSTNYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Rhinopithecus roxellana V896 ighv JABR01077917.1 1985 VQCEVQLVESGGGLVQPGGFLRLSCAGSGFAFSSYGMDWVRQAPGKGLEWVAVISYDGSQKYYADSVKDRFTISRDNSKNMLYLQMNNLRAEDTAVYYCAK
Rhinopithecus roxellana V908 ighv JABR01078980.1 3952 AQSQEQLVQSGAEVKKPGASVKVSCKASGFTFDSYAISWVRQAPGQGLEWMGWIVPDYDITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Rhinopithecus roxellana V956 ighv JABR01086102.1 3474 AQSQEQLVQSGAEVKKPGASVKVSCKASGYTFSSYAISWVRQAPGQGLEWMGVINPIVGITNYAQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAR
Rhinopithecus roxellana V962 trbv JABR01088213.1 45257 SVDAGVTQSPTHLIKMRGQQVTLRCSPISGHNSVSWYQQALGQGPQLIVQYYREQENGRGNFPERFSGHQFPNYSSELNVSALLLVDSALYLCASSL
Rhinopithecus roxellana V963 trbv JABR01088213.1 27657 SVAAGVIQAPRHLIKVKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQRDKGSIPDRFSAQQFSDYHSELNMRSLELEDSALYLCASSL
Rhinopithecus roxellana V964 trbv JABR01088213.1 20026 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGYGLRLIHYSYGVEDTDKVEVSDGYSVSRSKTEDFLLTLESATHSQTSVYLCASSE
Rhinopithecus roxellana V965 trbv JABR01088213.1 8651 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLCWYRQNLGQGPELLIRYENKEAIDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Rhinopithecus roxellana V966 trbv JABR01088213.1 2740 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHNSLFWYRQTMMWGLELLIYFNNKAAIDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Rhinopithecus roxellana V967 trbv JABR01088214.1 37062 HTCAGVSQSPRYKVTKRGQDVTLRCDPISGHEYLYWYQQVPGQGREFLTYFQNDAQLDKSGLPSDRFSAERPEGSISILKIQRTEQGDSAVYLCASSL
Rhinopithecus roxellana V968 trbv JABR01088214.1 28652 PVDTGVTQSPTHLIKTRGQQVILRCSPISGHSSVSWYQQALGQGPQFIFEYYKEEERERGNFPERFSGRQFPNYSSELNVNTLEMGDSALYLCASSL
Rhinopithecus roxellana V969 trbv JABR01088214.1 20880 PGNADVTQTPKFQVLKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGAGITDKGDVPNGYNVSRLNTEDFPLRLELAALSQTSVYFCASS
Rhinopithecus roxellana V970 trbv JABR01088214.1 8471 SVDAGVTQSPTHLIKTRGEQVTLRCSPISGHSSVSWYQQALGQGPQFIFEYYEKAERGRGNFPERFSGLQFPNYSSELNVNALLLGDSALYLCASSL
Rhinopithecus roxellana V971 trbv JABR01088214.1 1074 PVNAGVTQTPKFQVLKTGQSMTVQCTQDMNHNYMYWYRQDPGMGLRLIYYSVTAGITTKGEVSNGYNVSRINTEDFLLRLESAAPSQTSVYFCASSY
Rhinopithecus roxellana V972 trbv JABR01088215.1 112825 PVQAGVTQSPTYLIKRRGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFEYSNELRTSEGNFPDRFSGRQFRNYHSEMNVSALELGDSALYLCASSF
Rhinopithecus roxellana V973 trbv JABR01088215.1 110172 SVDSGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGKERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSL
Rhinopithecus roxellana V974 trbv JABR01088215.1 102142 HRDAEIIQSPRHKITETGRQVTLTCHQTWNHNNMFWYRQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSNKEDFPLTLESAASSQTSVYFCASSE
Rhinopithecus roxellana V975 trbv JABR01088215.1 92941 FTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQNEDVVDDSQLPKDRFSAERLKGVNSTLRIQPAELGDSAVYLCASSL
Rhinopithecus roxellana V976 trbv JABR01088215.1 79081 HRDARITQSPRYKITETGRQVTLTCHQTWSHNNMFWYRQDLGHGLRLIYYSAGAGVTDKGEVPDGYVVSRSKTEDFPLTVESATRSQTSVYFCASSE
Rhinopithecus roxellana V977 trbv JABR01088215.1 71162 LREAGVAQSPRYKVIEKSQAVTFWCNPVSGHATLYWYRQILGQGPELLVQFQNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAKLGDSAVYLCASSL
Rhinopithecus roxellana V978 trbv JABR01088215.1 53528 PVNAGVTQTPKFQVLKTGQSMILQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGAGITDKGEVSNGYSVSRSNTEDFPLRLESAAPSQTSVYFCASSY
Rhinopithecus roxellana V979 trbv JABR01088215.1 49336 HTGAGVSQSPRYRVTKRRQEVALRCDPISGHEYLYWYQQAPGQGPEFLIYFRNDAQLDKSGLLSSRFSAERPKGSVSTLKIQHTEQGDAAVYLCASSL
Rhinopithecus roxellana V980 trbv JABR01088215.1 41382 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTNVYWYQQTLDQGLQFILWYDEEEERDRGTFPHRFLGLQFPNYSSELNVSALLLGDSALYLCASSL
Rhinopithecus roxellana V981 trbv JABR01088215.1 30004 HTGAGVLQSPRYRVTKRGQDVTLRCDPISGHEYLYWYQQAPGQGPEFLTYFWNDAQQDKSGLPSGRFSAERPEGSVSTLKIQPTQQGDSAVYLCASSL
Rhinopithecus roxellana V982 trbv JABR01088215.1 15498 LVNAGVTQTSKFQVLKTGQNMTVQCAQDMNHNFMYWYRQDPGMGLRLIHYSGAAGTTDKGEVPNGYNVSRLNTEVFPLRLESAAPSQTSVYICACGY
Rhinopithecus roxellana V983 trbv JABR01088215.1 10918 HTGAGVSQSPRYKVSKRGQEVALRCDPISGHAALYWYQQALGQGPELLTYFNYEAQQDKSGLLSDRFSAERPEGSVSTLTIERTEQGDSAVYLCASSL
Rhinopithecus roxellana V984 trbv JABR01088215.1 2967 PVDTEVTQSPTHLIKTRGQQVTLRCSPISGHSSVYWHQQTLGQGPQLIFEYDRKEERGRGNFPDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Rhinopithecus roxellana V985 trbv JABR01088216.1 49532 PANAGVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSVAENTTDTGEVPDGYSVSRLKKKDFLLRLESAAPSQTSVYFCASSE
Rhinopithecus roxellana V986 trbv JABR01088216.1 36299 PLDTAVSQTLKYLVTQTGEKESLKCEQNLGHNAMYWYKQDSKKLLQIMFIYNNQEPILNETVPDRFSPKSPDKAHLILHIKSVELGDSAVYFCASSQ
Rhinopithecus roxellana V987 trbv JABR01088216.1 32871 PMETGVMQTPRHLVMGMTNKKPLKCEQHLGHNAMYWYKQKAKKPLELMFVYNFKERAENNSVPSRFVPECPDSSHLYLHVRALQPEDSALYFCASSQ
Rhinopithecus roxellana V988 trbv JABR01088216.1 20023 PVNAGVTQTPKFQILKTGQSMTLQCAQDMNHNYMYWYRQDPGMGLRLIHYSVGKGSTDTGEVPDGYSVSRSNLQNFMLRLESAAPSQTSVYFCASSE
Rhinopithecus roxellana V989 trbv JABR01088216.1 16285 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGKDAPDKSGLPSGRFSVERPEGSVSTLKIQPTQQGDSAVYLCASSL
Rhinopithecus roxellana V1008 ighv JABR01092598.1 5315 AHSEVQLVQSGAEVRKPGATVKISCKASGYTFTGYYLHWVRQAPGKGLEWMGLVDPEDGEANYAQKFQGRVTMTADTSTDTAYMELSSLRSEDTAVYYCA
Rhinopithecus roxellana V1054 trav JABR01098590.1 968 FSMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAGYFCAYR
Rhinopithecus roxellana V1055 trav JABR01098592.1 2053 SSMAQTVTQSQPEMSVQEAETVTLNCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNAKENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Rhinopithecus roxellana V1056 trav JABR01098593.1 31867 VRGDAKTTQPNSMESNEEEPVHLPCNHSTVSGTDYIYWYRQLPSQGPEYVIHGLTTNVNNRMVSLTIAEDRKSSTLILHHATLRDAAVYYCILR
Rhinopithecus roxellana V1057 trav JABR01098593.1 27132 VSSQELEQSPQSLIIQEGKNLTINCTSSKTLYSLHWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Rhinopithecus roxellana V1058 trav JABR01098593.1 15395 VSGQQLNQSPQSLSVQEREDVSMNCTSSSTFNNLLWYKQDPGEGPVLLIALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Rhinopithecus roxellana V1059 trav JABR01098593.1 10513 VSSEDKVVQNPLSLVVHEGDTVTLNCSYEVINFRSLLWYKQEKKAPTFLFMLTSSGFDKKKGRLSGILDKKELFSILNITATQTRDSAIYLCAVE
Rhinopithecus roxellana V1060 trav JABR01098595.1 57478 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLIVLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCA
Rhinopithecus roxellana V1061 trav JABR01098595.1 46449 TIIDAKTTQPTSMDCAEGRGANLPCNHSTISGNEYIYWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Rhinopithecus roxellana V1062 trav JABR01098595.1 36890 GTRAQSVTQLGGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLKKPSAHVSDAAEYFCAVS
Rhinopithecus roxellana V1063 trav JABR01098595.1 19420 ASTQQLEQSPRFLSIQEGENFTAYCNSSSVLTSLQWYRQDPGEGPVLLVTVVTGGEVKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Rhinopithecus roxellana V1064 trav JABR01098595.1 703 VRSQKPVQGPQAVILQEGEDAIINCNSSKALYSVHWYRQKHGEVPVFLMILLKGGEQKSHDKIVATFNEKKHQSSLYLMASQLSYSGTYFCGAE
Rhinopithecus roxellana V1065 trav JABR01098596.1 41946 VIGIQVEQSPPDLILQEGANSTLRCNYSATVSNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVTSERYSLLHISSSQTTDSGIYFCAVEPQYSP
Rhinopithecus roxellana V1066 trdv JABR01098596.1 12234 FSVAQKVTQAQSSVSMPVGKAVTLNCQYETSSWSYHIFWYKQLPGKEMIFLIRQGSSEQNAKNGRYSVNFEKAASSITLTISALQLEDSATYFCALWE
Rhinopithecus roxellana V1067 trav JABR01098596.1 4386 MSSILNVEQSPQSLSVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPRALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Rhinopithecus roxellana V1068 trav JABR01098596.1 3726 MSSILNVEQSPQSLSVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPRALFVMTLNGDEKKKGRINVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Rhinopithecus roxellana V1069 trav JABR01098597.1 23631 LSGEDQVTQSPEALRLQEGQSSSLNCSYTASNLRGLLWYRQDPGKGPEFLFILYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Rhinopithecus roxellana V1070 trav JABR01098597.1 11583 VSSKQEVTQIPAALSVPEGDNLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSRHSTLYITASEPGDSATYLCAV
Rhinopithecus roxellana V1071 trav JABR01098598.1 46580 GARAQSVTQPEKLLSVFKGAPVELKCNYSYSGSPDLFWYVQYPKQRLQLLLRHISRESIKGFTADLNKSETSFHLKKLFAQEEDSAMYYCALS
Rhinopithecus roxellana V1072 trav JABR01098598.1 37110 VNSQQGEEDPQALSIQEGENATMNCSYKTSIDNLQWYRQDSGRSLVRLILIRSNEREKSSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Rhinopithecus roxellana V1073 trav JABR01098598.1 30958 RTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFMFWYVQYLNKEPELLLKSSENQETDSRGFQASHVKSDSSFHLEKLSVQLSDSAVYYCVLR
Rhinopithecus roxellana V1074 trav JABR01098598.1 27459 SSMAQKVTQAQTEISVVEKEDVNLDCVYETRDSTYYLFWYKQPPSGELIFLIRQNSFNEQNEINGRYSSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Rhinopithecus roxellana V1075 trav JABR01098599.1 13976 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQYFMWYKQYSRKGPQLLIYTYSSGDKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Rhinopithecus roxellana V1076 trav JABR01098599.1 2147 GTRAQSVTQLDRQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDTAEYFCAVS
Rhinopithecus roxellana V1077 trav JABR01098600.1 75897 VWSQQKVEQNSGSLSVPEGAIASLNCTYSDRGSQSFLWYRQYSGQSPELLISTYSSGDKEDGRFTAQLNKASQYVSLLIRDSQLSDSATYLCVV
Rhinopithecus roxellana V1078 trav JABR01098600.1 69111 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPSLFWYVQYPNQGLQLLLKYISGTALVKGINGFEAEFKKSETTFHLTKASAHVSDAAEYFCAVS
Rhinopithecus roxellana V1079 trav JABR01098600.1 63558 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQYSFNLRKPSVHWSDAAEYFCAAG
Rhinopithecus roxellana V1080 trav JABR01098600.1 49371 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSVSDYFLWYKQESGKGPQFIIDIRSNMAKRQGQRLTVLLNKTVKHLSLQIAATEPGDSAVYFCAEN
Rhinopithecus roxellana V1081 trdv JABR01098600.1 37481 SGIAQKITQTQPAMFMQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLIHQESYDKQNATEGRYSLNFQKARKSINLIISASQVGDSAMYFCAMR
Rhinopithecus roxellana V1082 trav JABR01098600.1 17329 RTRGDSVTQMQGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKAAKDDDKGSNKDFEATYRKETTSFHLEKDSVQESDSAVYFCALS
Rhinopithecus roxellana V1083 trav JABR01098601.1 9400 VNGENVEQHPSILSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Rhinopithecus roxellana V1084 trav JABR01098603.1 8264 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVR
Rhinopithecus roxellana V1085 trav JABR01098603.1 2832 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSPVSPNLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFKAEFKKSETSFHLTKASAHVSDAAEYFCAVS
Rhinopithecus roxellana V1086 trav JABR01098604.1 73609 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNTDLKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES
Rhinopithecus roxellana V1087 trav JABR01098604.1 59887 VKNQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Rhinopithecus roxellana V1088 trav JABR01098604.1 47898 ANGENQVEQSPRFLGPQQGDVAFMSCMYSVSRFNNLQWYRQNTGTGPKHLFSMYSAGYEKQKGRLNATLLKNGSSLYITAMQPEDSATYFCAVD
Rhinopithecus roxellana V1089 trav JABR01098604.1 20574 EINGDSVVQTEGQVLLSEGDSLIVNCSYESTQYPSLFWYVQYPGEGPQLLLKAMMANDKESNKGFEATYHKETTSFHLKKDSVQESDSAVYFCALS
Rhinopithecus roxellana V1090 trav JABR01098604.1 7355 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFNNLRWYKQDTGKGPISLTIMTFSENTKLNGRYTATLDADTKQSSLHITATQLSDSASYICVVS
Rhinopithecus roxellana V1091 trav JABR01098606.1 14880 GLRTQPEDQVTVAEGNPLTVKCTYSVSGNPYLFWYVQYPKQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Rhinopithecus roxellana V1092 trav JABR01098606.1 2858 TLSLAKTTQPISMDSYEGQEVNITCSHNNIATSDYIMWYQQFPNQGPRFIIQGYKANIANEVASLFIPADRKSSTLSLPRVALSDTAVYYCLVG
Rhinopithecus roxellana V1093 trav JABR01098609.1 83411 TAGQSLEQPSEVTAVEGAIVQINCSYQTSRFDGLSWYQQHDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Rhinopithecus roxellana V1094 trav JABR01098609.1 59406 KCLVLGTTGQNIDQPTEMTAMAGAIVQINCTYQTSGFNGLSWYQQHDGEAPTLLFYNVLDGLEEKGRFSSFLSNSKGYSYLLLKELQMKDSASYLCAVR
Rhinopithecus roxellana V1144 trav JABR01181571.1 358 MSSILNVEQSPQSLSVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPRALFVMTLNGDEKKKGRISVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Rhinopithecus roxellana V1145 trbv JABR01184607.1 718 HTGAGVSQSPRNKVTEKGKDVALRCDPISGHTVLYWYRQNLGQGLEFLIYFRGTGAVDDSGLRSDQFSATRPEGSDSTLKIQCTEQRDSAMYFCASSL
Rhinopithecus roxellana V1146 ighv JABR01190886.1 749 VCAEVQLVQSGAEVKRPGESLKISCKTSGYSFTSYWISWVRQMPGKGLEWMGMIYLGDSDTRYSPSFQGQVTISADKSISTTYLQWSSLKASDTATYYCAK