WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ochotona princeps ALIT00000000.1 (ALIT01) 102 6 5 11 36 30 5 9
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ochotona princeps V168 trgv ALIT01034481.1 37627 SQVSANPEQTMTVVIRSAGSSTVISCGIAKQNDFMHWYRYQEGEAPQRLLYYHFFSSSVVTDPGISLTKYHAYKGPQESSNILLRNLEESDSGVYYCATWA
Ochotona princeps V169 trgv ALIT01034482.1 221 IHVTANPEQRTLVTQSAGSSVIITCGISQQSNYIHWYRYQEGKALQRLLYYEFSSSSVAMDSGFNPRKYQAYEGPGKSCKFVIRNLEESDSGVYYCATWN
Ochotona princeps V170 trgv ALIT01034483.1 214 SQVSSKPEQTMTLVSQSAGSSVIITCISKDNDYVHWYRFKDGETPQHLLYYDLSSSSFELDSGVNPNKYHVYDDTGNICNLVLQNLEESDSGVYYCATWA
Ochotona princeps V171 trgv ALIT01034486.1 4049 GLGQLQQSTLLISRTADRSAYISCKVSTQNFDDEVIYWYLQKPNQGIQYLLYIWKSHFGDESHKLEASKNSDTSTAYLKINFLEKGDEAMYYCAIYRWT
Ochotona princeps V172 trgv ALIT01034486.1 9176 GDTNIRILQDQLSFTRKPDRTVHISCQISGVNFKNTIVHWYQQREGEPLKRIIYGSANNYKQDMPNSRLEAGEKDNGIFYLIINNVIKSDEGTYYCACWD
Ochotona princeps V228 ighv ALIT01043827.1 744 VQCQEQLVESGGGLVQPGVTRTLICKASGFDFSSYDMVWVRQAPGKGLEWIAYISSSGGSTSYADSVKGRFTISSSSATSTVSLQMTALTAQDTAIYYCAR
Ochotona princeps V229 ighv ALIT01043828.1 5928 VQCQQLEESGGGLVQPEATLTLTCKASGFTFSSYYMCWIRQAPGKGLEWLACIYAGSGSTYYADSVKGRFTISSSSATSTVSLQMTALTAQDTAIYYCAR
Ochotona princeps V230 ighv ALIT01043828.1 13873 VQCQQLEESGGGLFKPGDTRTLTCKASGFTISSYAMCWVRQPPKKAPEWLAAISSGGSTYYASSVKGRFTISRSTADSTVSLQMTDLKDTDTAIYYCAR
Ochotona princeps V244 trav ALIT01045165.1 49243 TVSLARTTQTTSTEAFEGQNVNISCSHPDIAINEYIFWYQQFPNQGPQFLIQAYKVRVEHEATSLFIAADRKSSTLGLSRLSLKDTAVYYCTVG
Ochotona princeps V245 trav ALIT01045165.1 53681 VRGMQVEQSPSGLNVQKGANSTLRCSFSVTVTSIQWFRQHPGGGLASLLFLTSETKENGRFKSVINFRERYSSLHIAASQLADSGTYLCAADAQCSQ
Ochotona princeps V246 trav ALIT01045168.1 1732 VSGGEQVEQSPAFLSVQEGENCVITCTYSDSATTTLYWYKQEPGKGLQLFVTIFSSMDKKEDKRVTVLMNKKEKQVTLHISAAHPADSATYFCAAS
Ochotona princeps V247 trav ALIT01045168.1 5519 RTHGDSVTQTEGLVILSEGARLILNCTYQTSYSEFLYWYIQNFNQAPQLLLKSATDNHQVEHEGFQATLVKKDSSFHLHKSSVRVSDSAVYYCAVR
Ochotona princeps V248 trav ALIT01045169.1 5036 VSGAEQVEQSPAFQSVREGDSCIITCTYTDSATSYFYWYKQEHGEGLRLLINILSNMDKKEDKRFTVLLKKKEKQVTLHISAAHPADSATYFCAAS
Ochotona princeps V249 trav ALIT01045170.1 3976 ASGAEQVEQSPAFLHVQEGDNCVINCTYKDSTLYSNTFYWYKQEFGEDLRLLVSIISTQGKKEDQRVTVFAKDKQVTLHISAAHSADSATYFCAAS
Ochotona princeps V250 trav ALIT01045171.1 3375 LSGENQLEQSPRSLGVQEGDVTLMSCTHQVNGLGNLQWYKQVPGEGPKLLFSMYSIGDAKQEGRLRATLLKNGSSLSITALQPEDSATYLCA
Ochotona princeps V251 trav ALIT01045172.1 6301 GSSGDSVTQTEGQLTLSEGASLTVNCSYETTQYPALLWYVQYPGEGPQLLLKATKANDKGSNRGFEALYNKEATSFHLQKAVVQESDSAVYYCALS
Ochotona princeps V252 trav ALIT01045172.1 18935 VRGLQVEQSPSALSVQEGASPTLQCNFSDTVKNLQWFHQNPGSSLIRLFYIASGTKENGRLTSTLNSRERYSTLHIAASQLADSGTYLCAAEAQCSQ
Ochotona princeps V253 trav ALIT01045174.1 1179 VRGLQVEQSPSALSVQEGASPTLWCNFSDTIQGMQWFQQNPGSSLIRLFYVASGTKENGRLTSTLNSRERYSTLHIAASQLADSGTYLCAAEAQCSQ
Ochotona princeps V254 trav ALIT01045175.1 5007 VSRGENVEQPSTLSVQEEDTSVINCTYSNSASVYFPWYKQAPGQGPKLIIDIRSNVEKKQDQRFTVWLDKKAKRVSLHIAATQPGDSAVYFCAAS
Ochotona princeps V255 trav ALIT01045180.1 2375 MSRAENVEQPSTLSVQEGNTSVINCTYSDSASAYFPWYKQQAPGQGPKLIIDIRSNVEKKEDQRFTVWLDKKAKRVSLHIAATQPGDSAVYFCAAS
Ochotona princeps V256 trav ALIT01045180.1 10802 GSYGESVTQTEGQMTLSEGDPLTVNCFYETTRVPVLLWYVQYPGEGLQILLKAMKTNDKGSNKGFEALYNKEATSFHLQKVAVQESDSAVYYCALS
Ochotona princeps V257 trav ALIT01045183.1 3285 MSRGENVEQQPSTLRVQEGDTSVINCTYSDSAANYFPWYKQEAGQGPKLFIDIRSNVEKKEDQRFTVLMDKKAKHVSLHIAATQPGDSAVYFCAAS
Ochotona princeps V258 trav ALIT01045183.1 12106 GSSGDSVTQTEGQLTLSEGAVLTINCTYTATGYPALFWYVQYPGEGPQLLLKATKANDKGSNRGFEALYNKEATSFHLQKAVVQESDSAVYYCALS
Ochotona princeps V259 trav ALIT01045183.1 23657 GIRGLEVKQSPSMLNVQEGASPTLNCNFSTSVRSVQWFQQNPGSGLTSLLVIALGTKENGRLKSTINSQERYSTLHIAASQLADSGTYFCAAE
Ochotona princeps V260 trav ALIT01045183.1 29854 MSRGENVEQRPSTLSVQEGGSSIINCTYSDSSSDYFPWYKQEPGQGPKFIIDIRSNAEIKKNKNLTVWLDKKAKHVSLHIAATQPGDSAVYFCAAS
Ochotona princeps V261 trdv ALIT01045183.1 31443 SGIAQEVTQAQPTILVQEKEPVTLDCTYETSAVSYSLYWYKQPSTGEMILLIRQDSYSQHNATQGRYSLNFQKERKSISLIISTSQLEDSAAYFCALRD
Ochotona princeps V262 trav ALIT01045184.1 9344 VRSQQKELEQNPEYLSIAEGALASLNCTYSRASQNFMWYRQYAGKGPELVMSIYASGDKVEGSLRARLNTASQYFSLLIRDSKPSDSATYFCAL
Ochotona princeps V263 trav ALIT01045184.1 13671 GARAQTVTQPQEHISVSEGAPVQVNCNYSYSGSPFLFWYVQYPRGVLQLLLSYTTGKSANGFTADLNKGEKSFHLKKASAQEADTATYYCALS
Ochotona princeps V264 trav ALIT01045186.1 164 VSSQQEEEKLQALIIQEGENATMNCSYKTTITNLQWYRQASGTGPVLLILIRSNEREKPSRRFRATLDTSNKRSTLSITDAQPADTATYFCATD
Ochotona princeps V265 trav ALIT01045186.1 6085 GASGDSVTQTEGLVTLLEGTELTLNCTYQTSYPPFLYWYIQYQHRGLELLLKSSSETQEVNSKGFLASHVKSQSSFHLRKSTVKMSDSAVYFCVLQ
Ochotona princeps V266 trdv ALIT01045186.1 10357 GASVAQKVTQDQTALSVAEKQSVTLDCVYETSDITYYLFWYKQLPSGGMNFLIRQTSFNEQNVTEGRYSLNLQKPVKTISLTIIASQLTDSAVYFCALQES
Ochotona princeps V267 trav ALIT01045186.1 20372 KTSGDSVTQTEGLVTLSEGAALFLNCTYQTSYLSPYLFWYIQYPRKGPQILLKSINDNQKVESQEFEATLMKRNSSFHLQKSTLQRSDSAVYYCVLS
Ochotona princeps V268 trav ALIT01045190.1 362 GGRAQSVTQLDGHLAVPEGSPLELKCNYSSSLPPYLFWYVRYAGQGLQFLLRSTSGSELVSGMKGFEAEFRKNENSFHLRKPSAHWSDSAEYFCALT
Ochotona princeps V269 trav ALIT01045190.1 4943 VTGFQVEQRPPTLSNQEGASSTLQCNFSASVTSVQWFRQTPGGRLINLFYVPVGTKQHGRLSSTTVTQERRSSLHISSSQTTDSATYLCAASHSVP
Ochotona princeps V270 trdv ALIT01045190.1 23122 SSVAQTVTQTQPDIFKSEGSEVTLSCQYDTGLNTYYLLWYKQLFSGEMIFLIRQSSTGQNAKSSRYSINFQKGAKSITLTISALQLDDSSKYFCALW
Ochotona princeps V271 trav ALIT01045190.1 31390 ASSMLNVEQRPQSLHVQEGESTNFTCSFTLDSFYGLYWYKWKPAESPKLMFAMSLNGDEKQAGQVRVTLNTKERHSYMYIKGPQLEDSATYLCAV
Ochotona princeps V272 trav ALIT01045190.1 38180 GSGAQSVTQLDSRITVPEGAAFQLRCNYTYRGTPYLFWYVQYPGQSLQFLLKYMTGEPLVKGTNGFEAEFKKSETSFHLRKLSAQWSDEAQYFCAVS
Ochotona princeps V273 trav ALIT01045193.1 7758 VETQQNNVQQVKQNSPFLSVQEGDISVLNCDYTNNLFDYFLWYKKYPARAPTFLTSIRSVKNKKEDGRFTVFLNKSAQHIALQITASQPEDSALYLCAAS
Ochotona princeps V274 trav ALIT01045193.1 27437 ASGQGKHPVQSPSILNVWEGETAVINCSYTDGASNYFPWYKKEERKGPTLLVDIRSNVNNKQDGRFSVMLNKNAKHVSLNISATRQEDSATYFCAE
Ochotona princeps V275 trav ALIT01045193.1 37930 IMGDAKTTQPSSLEVTEEAPVHLPCNHSTISGNEYIWWYRQIPLQSPEYVIHGLKNNVTNSMASLTITADRKFSTLILLHVTLRDAAVYYCMLR
Ochotona princeps V276 trav ALIT01045193.1 49624 VRAQQLDQSPQSMSIQEGEDISMNCTSSSTLNSLLWYKQDLGQGPDLLIALYKMGELTRIGKLTAQFSETRKQSYLTISASQLEHAGTYFCAG
Ochotona princeps V277 trav ALIT01045194.1 5198 VSSDDKVVQSPPSLVVHEGHSATLTCSYEVKNFQSLQWYKQDKNVPTFLLLLISSGAEKKSGRLTGALNKTELVSTLHIAATQSGDSAMYFCAVE
Ochotona princeps V279 trav ALIT01045195.1 4030 FSMAQTVTQTQPEMSVHEPETVTLDCTYDTQDSNYYLFWYKQLPSRELVLIIRQEAHKPENAMQNRFSVNFQKAAKAFSLKISDLQLEDAGTYLCALRS
Ochotona princeps V280 trav ALIT01045195.1 10014 FSMAQTVTQTQPEMSVHEPETVTLDCTYDTRDSNYYLFWYKQPPGRELILIIRQEAHKPENATQNRFSVNFQKAAKAFSLKISDLQLEDAGTYLCALRS
Ochotona princeps V281 trav ALIT01045195.1 45864 VSGKNKVQQSPQYLRAQEGESVTIHCSYSTGMTTLRWWQQLPWGGIVSLFTLSLEMKRKGRMSATIDTKESHSSLHITASQPGDSATYLCAV
Ochotona princeps V282 trdv ALIT01045196.1 11950 FINSQSVNQPVAVEDIQEGQSVTMECEITVPWSYYTMYWYQQSTTGEMIHLIYLYSDNNYQRTERYSLVFQKSQNLLRFTISALTFRDSAVYFCAVRE
Ochotona princeps V283 trdv ALIT01045198.1 7018 FINSQSVNQPVTVENKQEGQSVIMNCEITITWSNYVMHWYQQSSNGEMIHLIYLYSRNSYQRTERYSLVFQKSQNLLMLTISALTFRDSAVYFCAVAD
Ochotona princeps V284 trdv ALIT01045199.1 143 FINSQSVNQPVAVEDIQEGQSVTMECEITVPWSEYIMHWYQQSSNGEMIHLIYLYSDNKSKRKERYTSVFHKSEKLLRFTISALTFRDSAVYFCAVAE
Ochotona princeps V285 trdv ALIT01045201.1 234 SINSQSVNQPVAVKIKQEGQSVTMECEITVTWSYYTMHWYQQPSSGELIHMIFLQSWETSKRKERYSLVFQKSQNLLMLTISALTYRDSAVYFCAVRE
Ochotona princeps V286 trdv ALIT01045201.1 39023 MSSDIILESEPQTLTVLVGESATFHCNLAGGELKNYQMSWYKKNEENSLIFINNSNSKDNLKRKINTSKNQFVLDIQRATVKDTGTYYCGLN
Ochotona princeps V294 trav ALIT01046862.1 46185 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKVTNGTKQNVAIFNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Ochotona princeps V436 igkv ALIT01074477.1 306 ARWATQVVTQSPSKVSAEVGGTVTIKCESDQSVASNNNLAWYQQKPGQRPKQLIYQASTLADGVPDSFKGSGSGTSFTLTISGVQAEDAGIYYCA
Ochotona princeps V437 igkv ALIT01074483.1 5132 ARCSGQTITQTESPVSAEVGGTVTIKCESDQSVAYNIALSWYLQKPGQPPKRLIYQASTLASGVSSRIKGSGSGKSFTLTISGVQAEDAGIYYCQGGYSDET
Ochotona princeps V438 igkv ALIT01074488.1 17690 ARCSGQTITQTESPATAEVKGKATINCESTQSVYNNKHLSWYQQKPGQPPKLLIYYTSSLASGVPSRFKGSGSGKSFTLTIDPVEAEDAGIYYCQGAYSGSI
Ochotona princeps V439 igkv ALIT01074493.1 20491 DRCAAQVTQSPSVVSAPVGGTVTINCQSSQSVNSNNCLHWFQQKPGQRPKLLINYVSTLAPGIPSRFKGSGSGKSFTLTISGVQADDAGTYYCEAEYSGWI
Ochotona princeps V440 igkv ALIT01074497.1 1204 ARCAAQVTQSPSEVSANVGDTVTINCQSSESVYNNVNVQWFQQKSGQRPKLLIYWASRLASGIPSRFKGSGSGKSFTLTINPMQAEDAGTYYCQGEYGTSGS
Ochotona princeps V441 igkv ALIT01074508.1 106 ATCAAHVTQLPSEVSANVGGTVTIDCQSSQSVYGNNDLTWYQQKPGQRPKPLIYLTSTLASGVPDRFKGSGSGTSFTLTISGVQPENVGTYYCQGDFGSWI
Ochotona princeps V472 iglv ALIT01079907.1 6129 SWAQVVFTQPQSVSGSLGETVSISCTRSSGDIDNDYVSWYQQHPGRAPTLLIYDDDQRPSGVPERFSGSIDSSSNSASLTISGLQAEDEAGYFCQSYDGSGN
Ochotona princeps V473 iglv ALIT01079907.1 10540 SWAQAVFTQPQSVSGSLGETVSISCTRSSGDIGDYYVSWYQQHPGRAPTLLIYDDDQRPSGVPERFSGSIDSSSNSASLTISGLQAEDEAGYYCQSYDSSDN
Ochotona princeps V474 iglv ALIT01079907.1 17583 SLSQPVLTQSPSASASLGASVKLTCTLSSAHSSYVIAWLQQQSGKAPRFLMSVYSDGSDEKGSGVPDRFSGSSSGADRYLTISNLQPEDEANYICATDDSSGY
Ochotona princeps V475 iglv ALIT01079908.1 49914 SWAQASPTQPASVSGALGGSVTITCEGNSNDLGKYYASWFQKLPGVNPKPLIYYGSNRLSGVPERFSGSYSGTKAWLTISGLQPEDEADYYCS
Ochotona princeps V476 iglv ALIT01079908.1 52019 SWAEPAPTQPVSATGALGGSVTIDCEGTGDVMGSFYPSWYQQLPGASPKLLIYVGNERPSGIPERFSGSYSGRTGSLTISGLQPEDEADYYCGKNRSGAA
Ochotona princeps V545 trbv ALIT01092359.1 16416 IRAQTIHQSPASRVQLVGSPLSLECTVKGKSNPNLYWYRQAAGEALQALFFSISAGQVDPQVFQNLKASRPKDDQFILSSEKLLLNDSGFYLCAWS
Ochotona princeps V695 trbv ALIT01128651.1 240 HTDAGVSQDPRHRITGRGQNVTLRCDPESGHTSLYWYRQTPGQGLQFMIYIERKEVLDESGMPGERFSAERPEGSSSTLKIQPAEPGDSAVYLCASSL
Ochotona princeps V916 ighv ALIT01043820.1 4807 VQCQEQLEESDGGLVKPGATLTLTCKASGFTISSYNMVWVRQAPSKGLEWIAYISSSGGSTSYASSMKGRFTISSSSATSTVSLQMTALTAQDTAIYYCAR
Ochotona princeps V917 ighv ALIT01043821.1 24387 VQCQKQLVESSGGLVQVGATLTLTCKACGFTISSYDMNWVRQAPWKCLKWSARIGSGYAYYASSVKGRFTISSSSATSTVSLQMTALTAQDTAIYYCAR
Ochotona princeps V918 ighv ALIT01043821.1 6707 GGVRWRLGPAWGNTDMTLTCKASGFTISSYGMSSVFEAPSKGLEWIAAIDSYGDTYYASSVKGQFTISSSSVTSTVSLQMTALTAQDTAIYYCAR
Ochotona princeps V933 trdv ALIT01045204.1 4860 KGVQCASVTQSLTELTEATGREVTLPCNYEVGYSNPDLYWYQRRPDQSFQFVLYRDNDRAQNAAFTKGRFSVARNQTQKTFHLVISNVRPEDTAVYYCAL
Ochotona princeps V1091 igkv ALIT01074475.1 12440 ARWATQVVTQSPSKVSAEVGGTVTIKCESDQSVAGNNNLAWYQQKPGQRPKQLIYQASTLADGVPDSFKGSGSGTSFTLTISGVQAEDAGIYYCA
Ochotona princeps V1092 igkv ALIT01074508.1 47513 ARCDIQVTQSPSSLSTAVGGTVTIYCEVSEYINKAFAWYQQKPGQPPKLLIYGASSLAEGVPSRFSGSGSGMEFTLTISRVQPEDAATYFCEQSYDWP
Ochotona princeps V1093 igkv ALIT01074508.1 45154 ARCDIQMTQSPSLVSAAVGGTVTMNCQASEDIYSSLAWYQQKPGQPPKLLIYGASYLQSGIPSRFSGSGSGTEYTLTITGVQPEDVATYFCEQSYDWP
Ochotona princeps V1187 trbv ALIT01092360.1 47350 LKDAVVTQSPRHRVLGIGKKLTLQCSQDMNHVGMYWYLQNPGFGLQLIYYSLGAKSTEKGDVSEGFKVSRDEIAHFPLTLEFTNIKQTSTYICASSQ
Ochotona princeps V1188 trbv ALIT01092360.1 36713 SMAAKVTQTPKYIITGTGKKLTMTCSQSMDHDAMFWYRQDPRSSLKLIYYSINVNIINDGDVPNGYTVSRKEKANFPLTLESTNINQTSLYFCASSY
Ochotona princeps V1189 trbv ALIT01092360.1 32706 LMNAEVIQIARYMVKRRGEKVLLECFQDMNHERMYWYRQDPGLGLQLIYFSYDVDNNEEGEVSEGYSVSRKKREHFFLTLESASTNQTSVYHCASSS
Ochotona princeps V1190 trbv ALIT01092360.1 23870 FVFSVLVSQKPIRAICQHGSSMMVQCQADSPASVMFWYRQLPGQSLILIAAANEGSEATYESGFTKDKFPISRPNLTFSTLVVNTLSPEDSSFYFCSFE
Ochotona princeps V1191 trbv ALIT01092363.1 21576 LTNTDITQSPSHLVRGKGEMVNLTCSPVKGHSHVYWYQQHPEQGLKFMIYLQKEKVIDESGMPTQRFSAEFPKEGPNILKIKLAEPQDSAVYFCASSASI
Ochotona princeps V1192 trbv ALIT01092363.1 18098 TADGGIIQIPKYLIRKEGQDTTMECEQNLNYDTMYWYRQDPGQGLKLIYYSLVVTDVQRGDLAEGYSASREKKESFTLAVTLTQTNQTAVYFCATSM
Ochotona princeps V1193 trbv ALIT01092363.1 14680 SGLDALVLQTPSRAILKSGTSVKIECRCVDLQATTVFWYHQLPKQSFTLMATSNAASKAAYEQGFTEAKFPISHPNLTYSSLEVTNAHPEDSSFYFCGAS
Ochotona princeps V1194 trbv ALIT01092363.1 10695 SMNTEVTQTPRHVVRGMAQKAKIECTPVKGHIYVYWYQRKPEEELKFLVYLQNEKIIEKTEFINERLSVQCPKGSPCSMEIQSTELGDSATYFCASSQ
Ochotona princeps V1195 trbv ALIT01092363.1 3647 SMDTEVTQTPRHVVREMAQKAKMECLPVKGHIHVFWYQRKPDEELKFLVYFQNEQIIEKTEMINEQFSVQCPKGSPCSMEIQSTELGDSATYFCASSQ
Ochotona princeps V1196 trbv ALIT01092364.1 51897 AVHTTGVTQMPRHLIKARGQKVTLRCSPLSGHQRVLWYRQVLGQGIHFLFDYYLGSQREKGNVPDRFSAQQFSNYSSEMNLSALELEDSAVYLCASSL
Ochotona princeps V1197 trbv ALIT01092364.1 47734 AAHAGVTQSPTFQILKKGQKLMIICAQDMNHNNMYWYRQDPGMGLKLIHYSVAAGTTDKGEVPDGYNASRPNIQNFLLTVESAAPSQTSVYFCASSD
Ochotona princeps V1198 trbv ALIT01092364.1 45669 HTDAGVSQDPRHKITGRGQNVTLKCDPESDHDALYWYRQTPGQGLQFMIYFNRKEIVDQSGMPGERFSAKRPEGSSSRLKIQPAEPGDSAVYLCASSL
Ochotona princeps V1199 trbv ALIT01092364.1 41025 PVYTEVTQAPRHLIKARGQQVTMNCTPASGHDRVLWYQQTLGQGLQFFFDYYRGSQSGKGNVPDRFSAHQFNDYRSELSVSALELEDSAVYLCASSL
Ochotona princeps V1200 trbv ALIT01092364.1 36576 AAHAGVTQSPTFQILKKGQKLMIICAQDMNHNNMYWYRQDPGMGLKLIHYSVGKDITDKGEVPDGYNASRPNIQNFLLTVESAAPSQTSVYFCASSD
Ochotona princeps V1201 trbv ALIT01092364.1 29436 PVETGVTQTPRHLIKTRGHPVSLQCSPVSGHACVSWYQQVPGQGLQLLFMYYETTENVKGNVPDRFSAQQFRDYRSELNVSALELEDSAVYLCTSSL
Ochotona princeps V1202 trbv ALIT01092364.1 25310 LSSSATGSGDTEVLQSPRHLIKGKGGNCILKCYPISGHNTVFWYQLLPGQGPQLLIQYFEMVEREKGNFPDRFSAQQFQDYHAELNMSFLELEDSALYLCASSL
Ochotona princeps V1203 trbv ALIT01092364.1 18352 PADTGVIQKPRHKVTEKGKEVTLRCEPASGHNALFWYRQIVGQALELLIYFNNQAPIDDSGMPKDRFSAKMPDAKLSTLKIQPTEAKDSAVYFCASSQ
Ochotona princeps V1204 trbv ALIT01092364.1 10266 SLNEVIQTPGHLVKETGRKAKMLCLPIKEHRFVLWYQQLLNEEFKFLISFQDGTIFDETDFPKQRFAAKCPPNSACSLEIESVGPQDSAVYLCASSQ
Ochotona princeps V1205 trbv ALIT01092365.1 3031 HTDAGVSQDPRHRITRRGQNVTLSCDPESGHASLYWYRQNPGQALQFMIYFNRKQVLDESGMPGECFSAKRPEGSSSTLNIQPAEPGDSAVYLCASSL
Ochotona princeps V1206 trbv ALIT01092366.1 864 HTDAGVSQDPRHRVTGRGQNVTLRCDPESGHTSLYWYRQTPGQALQFMIYFQGKGAVDRSGMPGERFSAERPEGSSSTLNIQPTEPGDSAMYLCASSL
Ochotona princeps V1207 trbv ALIT01092368.1 1324 AAHAGVTQSPTFQILKAGQSLTMTCAQDLNHDSMYWYRQDPGMGLKLIHYSVGKDITEKGEVPDGYKVSRPSTENFLLTVESAAPSQTSVYFCASSY
Ochotona princeps V1208 trbv ALIT01092369.1 5823 HVDAGVSQDPRHRITRRGQNVTLSCDPESGHASLYWYRQNPGQALQFMIYFQYEAASDQSGMPGERFSAKRPEGSSSTLNIQPAEPGDSAVYLCASSL
Ochotona princeps V1209 trbv ALIT01092369.1 1639 PVEAEVKQTPRQLIKARGQQVTLNCTPDSGHNRVLWYQQTLGQGLQFFFDYYLESQSEKGNVPDRFSAHQFSDYRSELSVSALELEDSAVYLCASSL
Ochotona princeps V1210 trbv ALIT01092370.1 2117 TVDSEVIQTPEHLIKAKGHQVTLKCSPMSGHLSVYWYQQILGQGPQLLFQYYNGEQRDKGEVPGRFSAWQSKDYRSELTLSALELGDSALYLCASSV
Ochotona princeps V1211 trbv ALIT01092372.1 4442 HTDAGVSQDPRHRITRRGQNVTLKCDPESGHIGLYWYRQTPGQALQFMIYFQCEAASDQSGMPGERFSAKRPEGSSSSLNIQPVEPGDSAVYLCASSL
Ochotona princeps V1212 trbv ALIT01092374.1 4258 HMEPRVSQTPSHDVTEMGQSTVLRCEPISGHYALYWYRHTPEKGMEFLIYFYNKAPAEKADFFKDRFSANMSEDSHATLTIQPVQLGDSATYFCASSL
Ochotona princeps V1213 trbv ALIT01092374.1 669 PVQAAEVTQTPRHLIKTRGQQVTLNCTPASGHDRVLWYQQGMDHGLQFLFDYYLESQSAKGNVPDRFSAHQFRDYRSELSVSALELEDSAMYLCASSF
Ochotona princeps V1214 trbv ALIT01092375.1 5068 HTEPGVTQTPSHQIVKMGQAVTFRCDPIPNHLYFYWYRQILGQKLDFLVYFYNDKPSEKSEIFNDRFTVERPSGSYLILKIQPTQLEDSAVYLCASSL
Ochotona princeps V1311 igkv ALIT01116687.1 21904 ARCAAQMVTQSSSVVSAEVGDTVTINCESSQSVDSNIALSWYLQKPEQPPKLLIYAASSLASGVPDRFKGSGSGKSFTLTVSGVQAVDVVTYYCQGDYSDE
Ochotona princeps V1312 igkv ALIT01116690.1 3977 ARCSGQTITQTPSEVSAEVGGTVTIKCESDQSVLSNNRLAWYQQKPWQHPKQLIYAASTLADGVSDRFKGSGSGTSFTLTINPVQAEDAGIYYCA
Ochotona princeps V1327 trav ALIT01130558.1 901 LHGEDQVEQKPQTLVLQAGRSGSFNCSYKVSRFGALSWYRQAPEKGPKLLFILYSNGDVKHSAGLRATLSSDASVLYISAATPEDAGTYFCAVD