WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Eulemur flavifrons LGHW00000000.1 (LGHW01) 107 13 9 6 45 23 4 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Eulemur flavifrons V13 trgv LGHW01000211.1 168109 SQISANLEGRMMSITRKTGLPVTITCDIQQSTNKYIHWYLFQEGRAPRRLLYYDLHNPRIMVESEISPEKYHAYAPTGRNSRFILQNLEDSDSGMYYCATWM
Eulemur flavifrons V14 trgv LGHW01000211.1 192530 GLGLLKVEQSHISISTEVTKNINIHCKISTVYFETEVVHWYQQKPNQTLKHLIQVSSTKASVQVSSAGRKNKVVAKKYPQNSTSILTINSVQKEDMAIYYCAGWY
Eulemur flavifrons V15 trgv LGHW01000211.1 199729 GLGKFEQPKISVSAATDKSAYISCKAAIQGFDSLPIHWYRQKPNQGLEHIKYVTSTTSSRDRKSSKIEASKDSQTSTSTLRINSLKKEDEAIYYCAYWTG
Eulemur flavifrons V113 trav LGHW01001827.1 7951 AAGQSIEQPRELAAVEGAFIQVNCTYQTSGFNGLSWYQQHDSGAPIFLSYSVLDGLEGRGRFSSFLNRSAGYSYLLLKELQMKDSASYLCAVR
Eulemur flavifrons V114 trav LGHW01001827.1 54673 GLRAQSVTQPEDQVTVSEGDPLTVKCTYSYSGSPYLFWYVQHPNQGLQFLLKYIGGENLVKGSFGFEAEFNKSQTSFHLKKASARGSDSALYFCAVS
Eulemur flavifrons V115 trav LGHW01001827.1 62585 TLSLAKTTQPIAMESHEGEDVDIPCSHTDIATNEYIFWYQQFPNQGPRFIIQGFKTNVTNEVASLFIPADRKSSILSLPRVALSDTAVYYCVVV
Eulemur flavifrons V116 trav LGHW01001827.1 69423 GTRAQSVTQPDGHVTVSEGDPLELRCNYSSPYSPYLFWYVQYHNQGLQLLLKYTSGNSLITGIKSFKAEFSKSETSFHLKKASARLSDSAQYFCALS
Eulemur flavifrons V117 trav LGHW01001827.1 78239 VNSQKIEQHPRALIIHEGETAAVTCNYTSYSPSLFQWYRQDPERGLTFLLLIRENEGEKREGRLKVTFDTTLKQSSFYIPASQPADSATYLCAA
Eulemur flavifrons V118 trav LGHW01001827.1 88447 DASAQSVTQPDGHVTVSEGDYLELRCNYSYGGAFYLFWYVQYPGQGLQLLLRYVSGDTLVKGIKGFEAEVKKSESSFTLRKPSVHWSDAAEYFCALS
Eulemur flavifrons V119 trav LGHW01001827.1 96995 RSHGDSVTQTEGQMRLTEGDSLIVNCSYETTQYPGLFWYVQYPGEGPQVLLKAMKANDKGINKGFEATYNRETTSFHLEKASVHESDSAVYYCALR
Eulemur flavifrons V120 trav LGHW01001827.1 102874 NARAQSATQPDLSITVSEGASLELRCNYSYRGGSAYLFWYVQYPGQGLQLLLQYYSGNTLVQGIKGFEAEVRKNESSFTLRKPSVHWSDAAEYFCALS
Eulemur flavifrons V121 trav LGHW01001827.1 114387 GVRGLEVQQSPSVLSLQEGSSPTLRCNFSATVYNMQWFRQNPGSGLISLFFMTSGTKENGRLNSTMNSKERYSTLHITATRLEDSGTYLCAAQD
Eulemur flavifrons V122 trav LGHW01001827.1 119232 RTYGNTVTQEEGQVTLSEEAFLTINCTYTSTGYPALFWYVQYPGEGPQLLLTAAKANDKGINKGFEATYRRETTSFHLEKASVHESDSAVYYCALS
Eulemur flavifrons V123 trav LGHW01001827.1 128293 VSGQNQVEQGPQSLVILEGENCTLQCNYTVSPFNNLRWYKQETGRGPVSLIIMTYSKNKESDGRYTATLDASTKQSSLHITASQLSDSASYICVVS
Eulemur flavifrons V124 trav LGHW01001827.1 135055 VRSQQEVEQTPESLSVSEGATASLSCTYSNTASQYFMWYRQHSGKGPELLVSTYSAGDKEEGRFIAQLNKASRNVSLLIRDSQPRDSATYLCAV
Eulemur flavifrons V241 trdv LGHW01004546.1 591153 AQAQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSHLELEDEGVYICEF
Eulemur flavifrons V245 trbv LGHW01004621.1 4164 SVNAGVTQTPRFQILETGQNMTLRCVQDMNHDSMYWYRQDPGLGLRLIHYSGTVGSPSKGNIPEGYSVSRSSKEKFPLTLESVTPSQTSVYFCASGD
Eulemur flavifrons V246 trbv LGHW01004621.1 7719 HTGAGVSQSPRHKVTERGQNVTLRCDPISGHTALYWYQQTLGQGLQFLIYFQGKGVPDKSKLTGDRISAERPEGSYSTLKIQPAEQGDSAVYLCASSS
Eulemur flavifrons V247 trbv LGHW01004621.1 12279 PAEAGVTQTPGHLIKARGQQVTLRCSPVSGHNWVYWYQQALGQGPQFLIQYFEGKEAEKGNFPDRFSGHQFSDYRSELNLSALELGDSALYLCASS
Eulemur flavifrons V248 trbv LGHW01004621.1 20460 PGDAGVIQSPRHLIKGKQETAILKCYPFSGHDTVYWYQQAPGQGLQFFISYYDKTQRDKGNMPPRFSAQQFDDRHSELNLSSLELGDSALYLCASSL
Eulemur flavifrons V249 trbv LGHW01004621.1 23579 HTDARITQNPRHKITEIGKKVTLKCHQTDNHNYMYWYRQDLGHGLRLIYYSVGVPTTDKGEVSEGYNVSRSNTEDFPLVLESATRSQTSVYFCASSD
Eulemur flavifrons V250 trbv LGHW01004621.1 27190 LTEAGVTQSPRHKITEKRQAVAFWCDPISGHVTLYWYRQTLRMGLELLIQFQNEAVVEDSGLAKDRFSAERPKGADSTLRIQKAELGDSATYLCASSP
Eulemur flavifrons V251 trbv LGHW01004621.1 32023 HTDAGVIQTPRHKVTEMGQAVTLECEPISSHNTLFWYKQTLAQGLELLTYFRSQSQIDDAGLPTGRFSAKMPNASFSTLNIQPSEPEDSAMYLCASSS
Eulemur flavifrons V252 trbv LGHW01004621.1 41737 HIAAGVTQFPSSEVIQKDQAVTVRCDPISGHEYLFWYRHTVGKEMEFLIYFLKENIQDKSGMPNDRFSAERTEGTYSTLKIQPAELEDSGVYFCASSL
Eulemur flavifrons V253 trbv LGHW01004621.1 47540 HVGAMVMQNPRYQVTSVGKTVTLSCSQNLNHDTMYWYQQKLSQAPKLLFYYYEKEFNNETDTPDNFQPSRPDTSSSSLDIRSPGLGDSAVYLCASSK
Eulemur flavifrons V254 trbv LGHW01004621.1 51062 SAGEEVTQTPGHLLKGKGQKVKMYCVPIEGHRYVLWYQQILEKEFKFLISFQDKAVYEETEMLKQRFSAECLQNSSCSLEIHTAELQDSAVYLCASSK
Eulemur flavifrons V255 trbv LGHW01004621.1 63833 ATDGGITQTPKYLFIKEGQTVTLDCEQNLDHNAMYWYRQDPGQGLRLIYHSQLLSQVLKGDIAQGYSTSREKKAQFPLTVTSPQGNQTALYLCASA
Eulemur flavifrons V256 trbv LGHW01004621.1 67647 SGLGALVTQHPRRAICKSGASVKIECRAVDFQATTMFWYRQFPKQSFMLMATSNEGSNATYEQGVPGNKFPISHPSQTLSTLTVASARPEDSSFYLCSGS
Eulemur flavifrons V257 trbv LGHW01004621.1 76853 SMDTEVTQSPRYLLKGKEEKTKMDCVPMKGHSYVYWYQKKLEEELKFLVYLQNEDIMQKTEIFNDRFSAQCPKNSPCSLEIQSIESGDAALYFCASSQ
Eulemur flavifrons V258 trbv LGHW01004621.1 87509 STDAGVTQTPRNRIAKTGQSILLECSQTEGHDRMYWYRQDPGLGLRLIYYSLAVNSTNKGEVSEGYRVSRKEQAKFSLSLETAVPNQTALYFCASSY
Eulemur flavifrons V259 trbv LGHW01004621.1 97795 LKDAVVTQFPRHRIIGTGRELALHCSQNMNHFAMYWYRQDPRFGLQLLYYSPATTSIEGVTEGYHVSRNKTDYFPLTLESAGTNQMSVYLCASSS
Eulemur flavifrons V260 trbv LGHW01004621.1 103201 PVEAQVTQTPRYLITGTGKNVTATCSQNMDHEYMFWYRQDPGLGLKLIYYSANVDFVTEGDVPHGYTASRREKPSFPLNLESTLTSQTALYLCASSL
Eulemur flavifrons V261 trbv LGHW01004621.1 109119 LVDTKVTQTPRHLIKRTGEKVLLECSQDMDHERMFWYRQDPGLGLRLIYFSYDVDNDEKGDVSEGYSASRKKKEDFPLVLESASTSQTSVYLCASRY
Eulemur flavifrons V262 trbv LGHW01004621.1 117505 SVLAVLVSQTPSRAICQRGTSVTIQCQVDSQVTLMFWYRQLPGQNLMLMATANQGSEATYESGFTKDEFPISRPELTFSNMTVSNVSPKDSSLYLCSAG
Eulemur flavifrons V353 ighv LGHW01007412.1 17203 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYHMHWVHQAPGKGLEWVALVRNKANSYTTEYAASVKGRFTISRDDSKSTVSLQINSLRAEDTALYYCAR
Eulemur flavifrons V354 ighv LGHW01007412.1 21192 VQCEVQLVESGGGLVQPGGSLRLSCAASRFIFSGYYMNWARQAPGKGLEWVSIIYGGGSTYYADAVKGRFTTSRDNSKNMLYLQMNSLRAEDTALYYCVG
Eulemur flavifrons V367 trav LGHW01007813.1 4382 VSGGENVGLHPPTLSVQEGDTSVINCSYSNSASTYFPWYKQELGKGPQFIIDVRSHMDKNQEQRFTVLLNKTAKHLSLRIAATQTGDSAVYFCAES
Eulemur flavifrons V368 trav LGHW01007813.1 9791 FGISQKVTQDQPAMLVQEKEAVTLDCTYDTSTSLGNYALFWYKQPSSGEMILLIRQDSYNEQNAAEGRYSLNFQKASKSIKLVISASQVGDSAIYFCALSE
Eulemur flavifrons V369 trav LGHW01007813.1 16650 VRSQQKEVEQIPKFLSVSEGATASLNCTYSNTAFQSFFWYRQYSGKGPELLVSIYATGDKEEGRFTAQLNKASRYVSLLIRDSQHSDSATYLCAA
Eulemur flavifrons V370 trav LGHW01007813.1 20997 GTRAQTVTQPDLHVTVTERASLELKCNYAVSYTPTLWWYVQYPNQGLQLVLKYASGSTLVKGIQGFEAEFSKSENSFHLKKHSAHLSDSAQYFCALS
Eulemur flavifrons V371 trav LGHW01007813.1 27148 DARAQSVTQPDGHITVSEGAFLELRCKYSYGATPALFWYVQYPGQGLQLLLQYYSGNTLVQGIKGFEAEFRKNESSFTLRKPSVHWSDAAEYFCALS
Eulemur flavifrons V374 trav LGHW01008061.1 12632 GTRAQTVTQPEECLSVFKGAPVQLKCNYSYSGSPVLFWYVQYPKQGLQVLLKHISGESVKGFTAVLNKGEATFHLEKTSVQEEDSAMYYCALS
Eulemur flavifrons V375 trav LGHW01008061.1 16655 VNSQQGEENPQALSIREGENATMNCSYKSSINNLQWYRQDSERGLTLLILIRANKREEHHGRLTATLDTSIKSSSLIITASSAADTATYFCATD
Eulemur flavifrons V376 trav LGHW01008061.1 22896 GTSGDSVTQTEGPVTLPEGKALDLNCTYQSSYAVLLFWYVQFPNKEPELLLKSSSENQELDSRGFQANDVKSDSSFHLKKRSVHLSDSAVYYCAM
Eulemur flavifrons V377 trav LGHW01008061.1 40138 RSNGDSVNQTEGTVTLPEGAPVILNCTYQTTYSVSYLFWYVQYLSQSPQLLLKSSTENQRSENQGFRANLVKSDRSFHLEKSSLHMSDSAVYYCALR
Eulemur flavifrons V378 trdv LGHW01008061.1 46984 SSVSEKITQARAATSVLERKAVTLECLYETITFSYYLFWYKQSPNGEMILLIDQESFNEQNATKGRYTLNFQKSTGSISLTITALQLGDSAMYFCALRE
Eulemur flavifrons V379 trav LGHW01008061.1 57848 VSSKQEVMQIPAALSVPEGESLVLNCSFTDSAIYNLQWFRQDSEKGFTSLLLIQSNQREQKSGRFKASLDKSSRQSTLNIAAAQPGDSATYLCAV
Eulemur flavifrons V380 trav LGHW01008061.1 67324 VRGIKVEQSPPALSLHEGASSMLWCNFSAAPNTVQWFRQNPGEPLINLFYIPSGTKQIGRLTATTVTKERRSSLYISFSQTTDSAIYFCAVEP
Eulemur flavifrons V381 trav LGHW01008061.1 77093 SDQKQVKQSPESLIVQEGGISILKCTYEDRAYTYFPWYRQFPRKAPALLIAISSFDSEKKDGRFTVFFNKSAKHFSLHITPSQPGDSATYFCAA
Eulemur flavifrons V386 iglv LGHW01008731.1 4061 SLSQPVLTQPPSLSASPGTSVRLTCTLSSDISVGGKDLYWHQQKPGSPPRYLLSYYSDSDKHQGSGVPSRFSGSKDASANAGILHISGLQPEDEADYYCVI
Eulemur flavifrons V390 igkv LGHW01008957.1 7094 SRGQIVLTQSPAFLSGTPGEKATLTCRASQGISNNLHWYQQKPGQAPKLLVKYASQSVSSGFSGSGSGTDFTLTINSLKAEDAATYYCQQSNSYP
Eulemur flavifrons V391 igkv LGHW01008957.1 15943 NGDIVLTQTPASLSAHPGDTVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSRGSGTSYVFSISALEPGDSGEYYCMHDYGWP
Eulemur flavifrons V392 igkv LGHW01008957.1 28985 ACGDIVMTQSPGSLAASAGERISINCKSSQSLLSNNKNYLAWYQQKPGQAPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCGQSY
Eulemur flavifrons V394 ighv LGHW01009141.1 1287 VQCEVQLVESGGGMVQPGGSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVSYIRYNGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur flavifrons V395 ighv LGHW01009141.1 6155 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSNINDNGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur flavifrons V396 trav LGHW01009142.1 4105 SDQKQVKQSPESLIVQEGGISILKCTYEDSAFDYFPWYQQLPGKAPALLIAVRSYDSKKEDGRFTVFFNKSAKHFSLHITPSQPGDSATYFCAA
Eulemur flavifrons V397 trdv LGHW01009142.1 12495 STMAQKVTQAQTSTTMTVRQAVTLNCQYETTWSSYYIYWYKQLPSKEMIFLLRQDSDDNQNAKYGRYSVNFQKEAKSIDLIISALRLEDSAKYFCALWD
Eulemur flavifrons V398 trdv LGHW01009142.1 18981 STVAQKVTQAQTATPTTVGRAVTLNCWYETTWSEYNIYWYKQLPSKEMIFLLRQYSGSSSNAKNGRFSVNFQKQAKSIDLTISASQLEDSAKYFCALQD
Eulemur flavifrons V405 ighv LGHW01009654.1 626 VQCEVSGGGLVQSGGSLTLSCAASGFTFTDYWIYWVRQAPGKGLECLSGINGGGSTYYTDTVKGRFTISRDNAKNTVSLQMNSLRAEDTALYYCAR
Eulemur flavifrons V406 ighv LGHW01009654.1 4951 VLSDDHLVQWGDGVVVSSQKLSLTCAAYTRSISEYSVSWVRLPHGKGLEWVGVIWANGNTNYSPYLQSRVGISRNTNKNQVFLELRSVTAEDAGTYYCAQ
Eulemur flavifrons V411 iglv LGHW01010225.1 4635 SVASSEVTQVPAVSVALGQTASITCQGDGISSYYAHWYQQKPGQSPVLLIYDNTYRHSGIPERFSGSILGTTATLTITDTQVGDEVDYYCHTWESSGYN
Eulemur flavifrons V413 ighv LGHW01010421.1 4639 VQSEVQLVESGGRLVQSGESLRLSCAASGFTFSSYGMHWVHQAPGKGLEWVLFINIGGGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAQDTALYYCAR
Eulemur flavifrons V416 ighv LGHW01010907.1 1957 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSKQYYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur flavifrons V418 ighv LGHW01011753.1 526 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSNIDSDGSTSYADAVKGRFTISRDNSKNTLSLQMNSLRAEDTALYYCAR
Eulemur flavifrons V421 ighv LGHW01013865.1 1479 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVQQAPGKGLEWVSRIRSGGSTYYADAVKGRFTISKDNAKNTVSLQMNSLRAEDTALYYCAS
Eulemur flavifrons V423 trav LGHW01014786.1 5742 SDQKQVKQSPESLIVQEGGISILKCTYEDSAFDYFPWYQQSPGKAPALLIAVRSVDSKKEDGRFTVFFNKSAKHFSLHITPSQPGDSATYFCAA
Eulemur flavifrons V424 trav LGHW01014786.1 14898 STVAQKVTQAQTATSMTEGKAVTLNCQHETTWSEYYIYWYKQLPSKEMIFLLRQDSGSSNARNGRFSVNFRKEAKSIDLTISALRLEDSAKYFCALAE
Eulemur flavifrons V427 trav LGHW01015830.1 641 GVRGLEVQQSPSVLSLQEGTSPTLRCNFSATVTSVQWFRQNPGGGLINLFYVASGTKENGRLNSTMNSKERYSTLHITASRLEDSGTYLCAAQE
Eulemur flavifrons V479 trbv LGHW01000445.1 6102 HTEPGVTQTPTHQVTKKGQEVILRCDPMSGHLYFYWYQQIWGQKVEFLVSFYNDNISEKSKIFKDRFSVERQRGSYFALKIRSTELEDSATYFCASKQ
Eulemur flavifrons V584 iglv LGHW01001999.1 91516 SLSQPVVTQPPSLSASPGASVRLTCTLRSDISVGGKNLYWHQQKPGSPPRYLLYYYSDSYKHQGSGVPSRFSGSKDASANAGILHISGLQPEDEADYYCAT
Eulemur flavifrons V585 iglv LGHW01001999.1 75056 ATSQAVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYAKWLQQKSNQAPQSLIGNTNSQGPGVPARFSGSLVGDKAALTITGAQPEDEAEYYCALWFSSR
Eulemur flavifrons V586 iglv LGHW01001999.1 70777 SSSQAVVTQESSMTVSPGGTVTLTCGSSTGAVTDGHYPYWFQQKPGQAPRTLIYNTNNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAVYYCWLVYSGV
Eulemur flavifrons V588 iglv LGHW01001999.1 45912 ATSQAVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYASWVQQKSNQAPQGLIGGTTSRVPGVPARFSGSLVGDKAALTIMGAQPEDEAEYYCALWFSSH
Eulemur flavifrons V628 trgv LGHW01002609.1 11269 SQISCNSEGRIKSIFRKTGSTVDISCDIKQSAKYIHWYFFPEDRAPGRLLYYDTYYSSQQLDSGTRTDKYDASKITDKSFKLHLKRLEASDSGVYYCAAWV
Eulemur flavifrons V647 ighv LGHW01002936.1 432 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWVRQAPGKGLEWVAYISSPSGSNKYYADAVKSRFTISRDNSKNTLSLQMNSLRAEDTALYYCAS
Eulemur flavifrons V661 trav LGHW01003263.1 30829 RTHGDSVMQREGQVTLPEEAFLSINCTYTATGYPTLFWYVQYPGEGPQLLLKATKANDKVINKGFEATYRRETTSFHLEKASVHESDSAVYYCALS
Eulemur flavifrons V662 trav LGHW01003263.1 21428 VKSQQKYVEQNLESLSVSEGATASLNCTYSDTTSQYFAWYRQYSGKGPEFLVSIYSTGDKAEGRFTAQLDKASQNVSLLIRDSQHSDSATYLCAV
Eulemur flavifrons V663 trav LGHW01003263.1 11361 RVRGLEVQQSPSVLSLQEGTSPTLRCNFSATVTSVQWFRQNPGSGLINLFFMASGTKENGRLNSTMNSKERYSTLHITASRLEDSGTYLCAAQE
Eulemur flavifrons V664 trav LGHW01003263.1 3650 VGGEENVGLRPPTLSVQEGDTSVINCSYSDSASSYFLWYKQELGKSPQSIIDIRSNMGKKEEERFTALLNKTAKHLSLRIAGTRPGDSAVYFCAES
Eulemur flavifrons V708 trav LGHW01004129.1 158329 LNGQQIKQIPQFLHLQEGEDFSTYCNSSSTLNTVQWYKQRPGGSPVLLMILVKAGEVKKERKLTAQFGETRKDSSLHITATQTADVGTYFCAE
Eulemur flavifrons V709 trav LGHW01004129.1 139475 RTGAQSVTQPDIHVTVSEGDPLKLRCSYSGGVVTTYLFWYVRYPGQSLQFLLKYTSGDTLVKGVKGFEAEFRKNETSFHLKKHSAHSSDTAEYFCAVS
Eulemur flavifrons V710 trdv LGHW01004129.1 101602 SSMSQQVIQSQSAISKQEGETVELECSYNTSVPYYMLYWYKRPPSGEIIFLIFQRTDADTNATQGRYSVSFQKATKTIRLIISSSQPEDSATYFCCLRE
Eulemur flavifrons V711 trav LGHW01004129.1 88244 ITADAKTTQPNSMEITEEEPVYLPCNHSTISGSEYVYWYRQILLQGPEYVIHGLKSNVTNRMATLSISADRKSSTLILPRVTMGDTAVYYCIVR
Eulemur flavifrons V712 trav LGHW01004129.1 79561 VSSQELEQNPRSLVIQEGEDLTINCNSSKTLYGIHWYRQKYGEGGLIFLMLLLKGGEEKSLEKITAKLDEKKQQSSLHITASQPSHSGIYLCGAE
Eulemur flavifrons V713 trav LGHW01004129.1 69352 VSSEDKVVQSAPSLAVHEGDSATLTCNYEVSYFQSLQWYKQQKNAPVFLFTLTSGGIEKKSGRLSSILDKKERLSTLNITATQTEDSAIYFCAVEE
Eulemur flavifrons V714 trav LGHW01004129.1 66451 PGRADWITSQETEVSRTEGETVDLVCNYSTSGRYTYLHWFRQYPSQDPEYILHRGWGLPGKGDANFARERFYSKSTENMINLYIRNLVPADTALYYCALR
Eulemur flavifrons V715 trav LGHW01004129.1 47836 SSVAQTVTQSQPEMSVQEAETVTLDCTYATSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Eulemur flavifrons V716 trav LGHW01004129.1 28759 MFSWTGLRGEVEVQQSPLSLSTQEGEDCTIYCNHSSSASDRLYWYRQAPGKSLELLFVLLSNGAVKREGPLTASLDTKARLSTLHIGGPQHGLSATYFCAV
Eulemur flavifrons V720 trdv LGHW01004193.1 164774 VMPAVVLVPENQAVTVPVGGSATLRCSMEGGTISSYYANWYRKTQGNTLTFIYRESNIYGPGFQGRFQGGQDLPRNQAVLKIVTTSESDEGFYYCACDL
Eulemur flavifrons V741 trbv LGHW01004621.1 158834 ARAQTIQQWPAVRVQPVGSPLSLKCTVKGTSSPTLSWYRQATGGPLQLLFYSVGVQDIVPEEPLNLSASRPEDSEFILSSEKLLRSHSGFYLCAWS
Eulemur flavifrons V790 iglv LGHW01006027.1 1545 SLSQPVLTQPPSLSASPGTSVRLTCTLRSDISVGGKYVYWYQQKPGSPPWYLLSYYSDSNKHQGSGVPSHFSGSRDASANAGILHTSGLQPEDEADYYCVT
Eulemur flavifrons V791 trdv LGHW01006066.1 17056 STVAQKVTQAQTSATMTVRQAVTLNCQYETIWSLYYIYWYKQLPSKEMIFLLRQHSTRQNAKDGRYSVNFQREAKSIDLIISALQLEDSAKYFCALVE
Eulemur flavifrons V792 trav LGHW01006066.1 6026 LNGQQVKQIPQFLHLQEGEDFSTYCNSSSTLNTVQWYKQRPGGSPVLLMILVKAGEVKKEKRLTAQFGEARKDSSLHITAAQTADVGTYFCAV
Eulemur flavifrons V824 igkv LGHW01007159.1 8831 ARCDIQMTQSPSSLSASVGDTVTITCRASQSISSWLTWYQQKPGKPPKTLINKASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQYDNY
Eulemur flavifrons V825 igkv LGHW01007159.1 1005 SSGDIVMTQTPLSLSVTPGESASISCKASQSLLHSDGKTYLYWFLQKPGQPPRRLIYQVSNRDSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQGIQN
Eulemur flavifrons V835 iglv LGHW01007915.1 4894 SVASQLTQVPAVSVALGQTASITCQGDIVNSYSTQWYQQKPGQAPVLVIYSNNQRPSGIPERFSGSKSGNTATLTISGAQAEDEADYYCGSYTGS
Eulemur flavifrons V841 trav LGHW01008069.1 9749 VSGGENVGLHPPILSVQEGDTSVINCSYSNSNSDYFPWYKQVLGKGPEFITDIRSNRNEKKEGRFTILLTKTAKHLSLRIASTRPGDSAVYFCAES
Eulemur flavifrons V842 trav LGHW01008069.1 2441 SGIAQKVTQSQPAMSVQEKEAVTLDCTYDTSDSNYALFWYKQPSSGEMILLIRQDSYSQQNTTEGRYSLNFQRARKSIHLVISALQLGDSAIYFCALSE
Eulemur flavifrons V856 trav LGHW01008803.1 7503 SGIAQKVTQSQPAMSVQEKEAVTLDCTYDTSDSNYALFWYKQPSSGEMILIIRQDSYNQQNATEGHYSLNFQKASKSIKLVISASQVGDSAIYFCALIE
Eulemur flavifrons V857 trav LGHW01008803.1 710 VRSQQEVEQTPESLSVSEGATASLSCTYSDTTSQNFPWYRQYSGRGPELLVSIYSAGDKEEGRFTAQLNRASRNVSLLIRDSQPSDSATYLCAV
Eulemur flavifrons V860 trbv LGHW01008850.1 22441 PMDTGVTQTPRHLVMGMTEKKSLKCEQNLGHNAMYWYKQSAKKPLELMFYYYLQELRENLTMSSRFSPENPDSSHLYLHLDALQPEDSATYLCASSQ
Eulemur flavifrons V861 trbv LGHW01008850.1 14977 PLDTAVFQTPKYLLSQMGNNVSLKCEQTLGHDTMYWYKQDSKKLLEIMFTYNNKKLILNETISSRFTPESPDKAHLNLHIKSPEPGDSAMYLCASSY
Eulemur flavifrons V862 igkv LGHW01008957.1 44302 TRAETTLTQTPALVSVAPGDKITITCKASQDIDDDIHWYQQKPGASPKFIIKYASTLVSGVPSWFSGSGYGTDFALTINNLESEDAAYYFCQQDDNLP
Eulemur flavifrons V871 trbv LGHW01010814.1 5713 HTDAGITQNPRYKVTETGKQVTLKCHQTDNHDCMYWYRQDLGHGLRLIYYSVGVPTTDKGEVSEGYNVSRSNTEDFPLVLESATRSQTSVYFCASSD
Eulemur flavifrons V878 ighv LGHW01012016.1 892 VQCEVQLVESGGGLVQPGGSLRLSCATSGFTFSSYYMHWVRQAPGKGLEWVSRIYGNGGSTSYADAVKGRFTISTDSSKNTVYLQMNNLRAEDRALYYCTS
Eulemur flavifrons V879 iglv LGHW01012544.1 20228 SVASYELTQPPSVSVSPGQTARITCGGNNIGGKNVYWYQQKPGQTPVLIIYRDSNRPSGIPERFSGSNSGNTATLTISGAQAGDEADYYCQVWDG
Eulemur flavifrons V880 ighv LGHW01012768.1 1193 VQCEVQLVESGGGLVQPGGSLRLSCTASGFTFSDYYMSWVRQAPGKGLEWVALVRNKANSYTTEYAASVKGRFTISRDDSKSTVSLQINSLRAEDTALYYCAR