WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Lipotes vexillifer AUPI00000000.1 (AUPI01) 49 11 6 4 12 12 2 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Lipotes vexillifer V14 igkv AUPI01003946.1 13629 SNGDIVLTQTPLSLSVIPGDPASISCRSSQSLLDSDGDTYLNWYLQKPGQSPQLLIYGASNWASGVPDRFTGSGSGTDFTLKISRVEAEDAGVYYCQHGMENP
Lipotes vexillifer V15 igkv AUPI01003949.1 1386 SSGDIVMTQTPLSLSVIPGETASISCKSSQSLVHSDGNTYLNWLQQKPGQSPQLLIYKVSNRDSGVSDRFSGSGSGTDFTLKISRVEAGDAGVYYCHQGTKAP
Lipotes vexillifer V16 igkv AUPI01003949.1 24318 CWGQITLTQTPETLEASQGSFVSITCKSSVEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFQGSGSGFDFSLAIRGVEAEDVGVYYCQ
Lipotes vexillifer V17 igkv AUPI01003949.1 39763 TTGEATLTQSPASLSLSPGESATLTCRASQSVSNYLAWYQQEPGQALRLLIYGATTRASGIPARFSGSGSGTDFTLTISSLEPEDAAVYYCYQYYSGY
Lipotes vexillifer V84 trav AUPI01026583.1 37304 VSLGEKVEQSPSTLTVQEGNSSVITCTYTDTALDYFLWYKKEPGKGPQLLTDIRSNKSKKEHQRWSVLLNDKAKRLSLHISDTQPGDSAVYFCAAS
Lipotes vexillifer V85 trav AUPI01026584.1 5708 SSIAQKVTQDQPVILVQEKEVVTLDCMYDTNVLGYSLYWYKQPSSGAMILLIRQDSYNQQNATEGRYSVNFQKANKSIKLAISASQLEDSAVYFCALSE
Lipotes vexillifer V86 trav AUPI01026584.1 10557 QTREDSVTQMDGQMTLPEGAALTINCTYSATGYPVTFWYVQYPGEGPQVLLKAMKDNEKGTNKEFEATYHRESKSFHLEKASVQVSDSAVYYCALS
Lipotes vexillifer V87 trav AUPI01026584.1 13738 GTRAQTVTQPEDHISVFEGSPVQVKCNYSYSGSPVLFWYVHYPKQHLQLLLRHTSRESIRGFTADLNKGEASFHLKKLSAQEEDSAVYYCALR
Lipotes vexillifer V88 trav AUPI01026586.1 1942 VKSQQGEENLQALSIQEGENATMNCSYKTAIDTLHWYRQDSRRGFAHLILIRSNEREKRSGRLRVTFDNSIKGSSLSITASQAADTATYLCATD
Lipotes vexillifer V89 trav AUPI01026586.1 14273 GTNGDSVTQTEGPVTVSEGAPRTLHCTYQTSGSNPYLFWYVQYLHKAPQLLLKGSKANRKAEHQGFQATLVTSDSSFHLQKPSVQASDSAVYYCALS
Lipotes vexillifer V90 trav AUPI01026587.1 6563 LRGEDQVKQSPQTLKIQEGDSLILNCSYTVSSFNGLLWYRQDPGKGPELLFILSSVGKEKQKERLKATLLKKGSSLHIAAPKPEDSATYLCAVE
Lipotes vexillifer V91 trdv AUPI01026588.1 11997 FGVAQKVTQVQPAISSQLGEAVTLNCEYETSWSQYSIFWYKQLPSGEMTFLIHQRSSGQNAKNGRYSVNFQERHKFISLTISALLVEDSANYFCALWE
Lipotes vexillifer V92 trav AUPI01026588.1 23382 GAGAQSVTQPDSHITVSEGARLELRCSYSSSASFYLFWYVQYPNQGLQLLLKYISGNSLVSGIKGFEAEFRRSEKSFHLRKTSARWKDSAKYFCALS
Lipotes vexillifer V93 trav AUPI01026588.1 37108 SSVAQMVTQPQPEVSVQEAQTVTLDCTYSTSDSDYYLLWYKQPPSGEMIFIIGQEAYKQQNATNSRYSVNFQKEAKSFSLRISDSQLEDAAMYFCAYSG
Lipotes vexillifer V94 trav AUPI01026589.1 59 SSVAQMVTQPQPEVSVQEADTVTLDCTYSTSKSDYYLLWYKQPSSGEMIFIIGQEAYKQQNATNSHYSVNFQKEAKSFSLSISDSQLEDAAMYFCT
Lipotes vexillifer V95 trav AUPI01026589.1 45146 VSGKNDVEQSPRYLSALEGDFVTINCSYSEEMTTLQWLQQNPGRGVVSLFILSLEMKKKGRVSTTINRKERHSSLHITASQPQDSATYFCAVE
Lipotes vexillifer V96 trdv AUPI01026597.1 18089 VMSAVMLVPQDQARSVSVGESVTLRCSMKGESISNYYTFWYRKTPGNTMTFIYREGGTYGPGFKDNFQGEIDSLNNQAVLNILEASERDEGSYYCAS
Lipotes vexillifer V205 trgv AUPI01063753.1 7075 HLEQPQPSSTKKLSKTARLECVLSGVTISKMSVYWYQERPGEAVQHLLHISSNDTVKRESDVTLGKFEADKKPETSTSTLTIHNVQEQDAATYYCAFWE
Lipotes vexillifer V206 trgv AUPI01063753.1 21233 GLGQLKWEQPEISVTGARDKSVVISCKVSSEDFSREYIHWYRHKQNQGIEHLAYVVTVPALKHLGGKKNKIEARKDVPTSTSTLEIRFLEKEDEATYYCASWFN
Lipotes vexillifer V228 trav AUPI01069615.1 864 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Lipotes vexillifer V235 ighv AUPI01070484.1 50684 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVGWVRQASGKGLEWVGEMGYSGSTYYNPTLKSRLSITRDTSKSQVYLSLSSLTTQDTAVYYCAK
Lipotes vexillifer V236 ighv AUPI01070484.1 58871 RGAAGGVWGRLGEAWGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWISAISGNGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDMAVYYCVKD
Lipotes vexillifer V237 ighv AUPI01070484.1 65402 VLSQVQLQESGPSLVKPSQTLSLTCTFSGFSLSSYGVGWVRQAPGKGLEWVGSIYSGGSTYYNPTLKSRLSITRDTSKSQVYLSLSSLTTQDTAVYYCAR
Lipotes vexillifer V238 ighv AUPI01070484.1 72697 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWISAISSSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Lipotes vexillifer V239 ighv AUPI01070484.1 79229 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAVGWVRQAPGKGLESVGWIYSGGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAG
Lipotes vexillifer V240 ighv AUPI01070484.1 87374 VQCEVQLVESGGGLVKPGASVRLSCAASGFTFDDYAMSWVRQAPGKGLEWISAINWSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Lipotes vexillifer V241 ighv AUPI01070484.1 92690 ILSQVQLQDSGPSLVKPSQTISLTCTVSGFSLSSYGVGWVRQAPGKGLESVGGINTVGSTGYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAK
Lipotes vexillifer V242 ighv AUPI01070484.1 100002 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWISAISGNGGYTNYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKE
Lipotes vexillifer V243 ighv AUPI01070484.1 111205 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLSSYAVGWVRQAPGKGLESVGEMGYSGSTYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAR
Lipotes vexillifer V244 ighv AUPI01070484.1 119191 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWISAISSSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCAKD
Lipotes vexillifer V245 ighv AUPI01070484.1 125736 VLSQVQLQESGPSLVKPSQTLSLTCAVSGFSLSSYAVGWVRQPPGKGLEWVGGINSGGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYYCAK
Lipotes vexillifer V404 trbv AUPI01124048.1 4559 ASADTEITQIPKYLVMGTRNKKSLRCEQRLGHNSMYWYKQSAQKPPELMFTYNYKELASNETVPSRFRPECPDSSHVYLHVDTLKPEDSALYLCASSK
Lipotes vexillifer V405 trbv AUPI01124049.1 1207 PGNAGVTQDPKFQVLRTGQSTTLKCAQDLDHYSMYWYRQDLGHGLRLIHYSSATGTTNKGDVPNGYSVSRSNLENFPLTLAASTHSQTSVYLCASSY
Lipotes vexillifer V406 trbv AUPI01124049.1 11337 PLEAGVTQTLRHLIKTTGQTVTLRCSPVSGHHNVSWYQQALSQGPQFLSEFYENMQREKGNFPDRFSAQQFRDTRSELNVSSLELRDSALYLCARSL
Lipotes vexillifer V407 trbv AUPI01124051.1 4219 LSITGPVEAGITQKPRHKITVTGETVTLECHLTDNHDYMYWYRQDLGHGLRLIHYSYGVGNTEKGEIPDGYNVSRSNREDFPLTLESVIPSRTSVYFCASSD
Lipotes vexillifer V408 trbv AUPI01124051.1 17986 PTGAGVTQTPRREVTEMGHAVTLSCEPISGHTVLYWYRQTLVQGLEFLIYFVNQAPTDESGMPKDRFSAQMPNTSFSTLKIQPTEPGDSATYLCASSK
Lipotes vexillifer V409 trbv AUPI01124052.1 3092 TVDGRVTQTPKYLFKVEGRDVTLKCDQDFGYDVMYWYRQDPGQGLRLIYYSPIEKDVQKGDIAEGYSASREKSLFHLTLTSTQKNQMALYLCATSI
Lipotes vexillifer V410 trbv AUPI01124053.1 1881 SGLSASVSQHPSRAICKSGASVTIQCHSVDLQATTVFWYHQFPKQGLVLIATSNKDSDATYEQGYTKAKYPVSHPDLTFSSLVVTNVHPADSSLYFCGAR
Lipotes vexillifer V411 trbv AUPI01124055.1 1559 PMDAEIYQVRFLLAEAGRDMTLECKQNLTYNSMYWYRQDPGQGLRLIYYSMVVKDVQRGDISEGYSVSREEKGLFPLTVKVAHTSQTALYLCSGS
Lipotes vexillifer V412 trbv AUPI01124055.1 9855 SMDVVITQTPRNRVANTGKSTVLECSQTKGHESMYWYRQDPGLGLRLIYYSHSVNDINKGDVSDGYRVSRKEKTKLSLFLEPATPNQTALYFCASSI
Lipotes vexillifer V413 trbv AUPI01124055.1 17430 LKDAVVTQFPRHKVSKTGKELTLQCSQNRSHYSMYWYRQDPGFGLRLIYYSTDTGTTEKGDVPEGYRVSRNKLEYFPLTLESASTNQTSVYLCASSE
Lipotes vexillifer V414 trbv AUPI01124056.1 7351 ALEADVTQSPRHQITETRKRVTLTCSQNMQHDAMYWYRQDPGLGLKLIYFSRSVDLVEKGDVPDGYIVSRKKKPDFPLTLASASTSQTSSYLCASSL
Lipotes vexillifer V614 iglv AUPI01037438.1 25477 SWAQSGLTQPPSVSGNPGQTVTISCAGTSNDIGGYNRVGWYQQLPGMAPKTLIYDVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYRSGYS
Lipotes vexillifer V615 iglv AUPI01037438.1 20190 SWAQSGLSQPPSVSGNPGQTVTISCAGTSNDIGKYNAVGWYQQLPGMAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSARSG
Lipotes vexillifer V616 iglv AUPI01037438.1 7540 SWAQSGLTQPPSVSGNPGQTVTISCAGTSSDIGYYNGVGWYQQLPGTAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSATSGYS
Lipotes vexillifer V617 iglv AUPI01037438.1 2214 SGNPGQTVTISCAGTSNDIGKYNATVTISCAGTSNDIGGYNRVGWYQQLPGMAPKTLIYEVNKRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCSSARSG
Lipotes vexillifer V654 iglv AUPI01050472.1 13032 SWAQSGLTQEGSMSGSVGQQVTLSCTGNGNNVGANIMNWYQQISHGAPKMAMLAGSLPSGIPDLCSGSTSVNTASLTISGLQPEDKADYYCSTWDDSISG
Lipotes vexillifer V655 iglv AUPI01050473.1 5654 ALSQPVLTQPSSLSSYLGASARLTCTLNSGFNVGNFWIRWYQQKPGNPPRYLLTFHSDSDKHQGSGVPSRLSGSNDASTNAGTLLISGLQPEDEADYYCAT
Lipotes vexillifer V890 trbv AUPI01124061.1 2324 VRAQTIRQWPLIRVQPAGSLLSLECTVKGTSNPRLYWYRQEAGGALQLLFHSISLDQIDAEKPQNFEASRPQDGLFILSSKKLLPSNSGFYLCAWN