WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Peromyscus maniculatus bairdii AYHN00000000.1 (AYHN01) 551 104 12 197 173 34 5 26
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Peromyscus maniculatus bairdii V298 ighv AYHN01090089.1 91 HLEQSGGGFIQPGGSLRLYCEGSGFTFSDFYIHWHRQAPGKSLEWVGFIRDKPRGHTTEYAASVKQRFAISRDDSKNTAYLHMSSLRAEDSVMYYCARER
Peromyscus maniculatus bairdii V299 ighv AYHN01090089.1 8180 VLSQVTLRESGPGLLQPSQTLSLTCSFSGFSLSTSGIGVGWIRQPSGKGLEWLARIDWDDDKYYNPSLKSRLTISKDTSKNQVFLKITSVDSADTATYYCARR
Peromyscus maniculatus bairdii V300 ighv AYHN01090091.1 7917 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLESLALIYWNDDKYYNPSLKSRLTISKDTSKNQVFLKITSVDTADTATYYCARR
Peromyscus maniculatus bairdii V301 trav AYHN01090091.1 21819 VHSQVQLQQSGPELVKPGASVKFSCKASGYTFTSYFMHWVKQRPGQGLDWVGVIDPGSGSTRHNQKLQGKATLTTDTSSSTAYIELSSLTSEDSVVYFCAR
Peromyscus maniculatus bairdii V302 ighv AYHN01090091.1 33263 VLSQVTLRESGPGLLQPSQTISLTCSFSGFSLSTSGMGVNWIRQPSGKGVEWLAQIWWDDDKYYNPSLKSRLTISKDTSKNQVFLKITSVDTADTATYYCAR
Peromyscus maniculatus bairdii V303 ighv AYHN01090091.1 52401 VHSQVQLQQSGPGLGKPGSSVKLSCKASGYTFTDYAMHWVKQSPGQGLEWIGAINPGNGGTAYNQKFKGKATLTADTSSSTAYMDLSSLTSEDSAVYYCAR
Peromyscus maniculatus bairdii V304 ighv AYHN01090091.1 61952 VHSQVQLQQSGPGLGKPGSSVKLSCKASGYTFTDYAMHWVKQSPGQGLEWIGWIYPGDGDTKYNQKFKDKATLTADTSSSTAYMELRSLTSEDSADYYCAR
Peromyscus maniculatus bairdii V305 ighv AYHN01090092.1 5154 VHCQAQLQQSGSELRLPGASVKVTCKDFDSDNFPISYMNWVRQKPGHGFEWIGNILPSIGRTNYGQKFEDRATLDADTMSNTAYMELRSLTSEDSAVYYCAR
Peromyscus maniculatus bairdii V306 ighv AYHN01090092.1 24313 VHCEVQLVESGGGLVQPKGSLKLSCAASGFTFSDYAMSWFRQAPGKGLEWVAAIDPKSYNYATFYADSVKDRFTISRVDSQSMVYLQMNNLKTEDTATYYCA
Peromyscus maniculatus bairdii V307 ighv AYHN01090092.1 37311 VLSQVTLRESGPGLLQSSQTLSLTCSFSGFSLSTYGIGVNWIRQPSGKGLEWIADIWWDDDKFYNPSLKSRLTISKDTSKNQVFLKITSVDSADTATYYCAR
Peromyscus maniculatus bairdii V313 trav AYHN01092053.1 2056 RTHGNSVTQTGGQVTISEGGFLTINCTYSFTTIGSPTLFWYVQYPGETLQLLLKVLTAGTKGSSRGFEATHDKGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V314 trav AYHN01092053.1 4663 VAGKTQVEQSPQSLTVLEGENCILHCNYTVSPANNLRWYRQDTGRGLVSLAVMAYTENKKSNGRYLATVNTNAQQSTLHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V315 trav AYHN01092053.1 16670 VIQGEQVEQHPSTLRVQEGDSAVINCTYTDSASSYFPWYKQEPGEHPQLITDIRSTVERKQEQRLIILQDKKAKHFSLHITDTRPGDSAMYFCAAS
Peromyscus maniculatus bairdii V316 trav AYHN01092053.1 18453 RSKGDSVTQTEDLVTVTEGLPVMMNCTYQTTYSPFLFWYVQYPNKAPRLLLKSATDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V317 trav AYHN01092053.1 28880 ANGQQVEQRPLSLVLQEGERAELQCNFSTTATQMQWLHQSPGGRLISLFSNPSAAKQSGRLTSTTVAKEYRSSLYISSSQTTDSGTYLCAVNAQCS
Peromyscus maniculatus bairdii V318 trav AYHN01092053.1 35582 RSNGDSVTQTEGRVTVTEELPVMMNCTYQTTSSIPTLFWYVQYPNRAPRLLLRSATDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V319 trdv AYHN01092054.1 18259 SILGQKVTQVQSTASTREGEEITLDCSYDTSWNFYYLFWYKQLLSGEMIFLIRQFSSSTQTERRSRYSVVFWKSAKSIRLVISASQLEDSVKYFCALCE
Peromyscus maniculatus bairdii V320 trav AYHN01092057.1 10951 VIQGEQVEQHPSTLRVQEGASTVINCTYTDSASYYFPWYKQGPGEHPQLMTDIYSTVERKQEQRLIVLLDKKAKHFSLHITDTCPGDSAMYFCAAS
Peromyscus maniculatus bairdii V321 trav AYHN01092057.1 12740 RSNGDSVTQTESQVTVTEGMPVMMNCTYKTTYSNTFLWWYVQYPNKAPQLLLRSATDNQRTEHQGFQATLQKSNSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V322 trav AYHN01092057.1 20631 VKGQQVEQSPVSLVLQEGERAELQCNFSTTLYQMQWFLQSPGGRLVSLFSNPSGTKQSGRLKSTTVTQESRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V323 trav AYHN01092057.1 30523 RSNGDSVTQTKDLVTVTEGLPVMMNCTYKTTYSAPFLFWYVQYPNRAPQLLLKSSTDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V324 trav AYHN01092059.1 3349 VKGEQVEQSPVSLVLQEGERAELQCNFSTIVAQVQWFHQSPGGRLISLLSNPSGTKKSGRLMSTTVTRESRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V325 trav AYHN01092060.1 6556 VIQGEQVEQHPSTLRVQEGASAVINCTYTDSTMYYFSWYKQGPGEHPQLIIDIRSTVERKQRLIVLQDKKAKHFSLHITDTRPGDSAMYFCAAG
Peromyscus maniculatus bairdii V326 trav AYHN01092061.1 2666 RTQGESVAQTEGQVVLSEDDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALS
Peromyscus maniculatus bairdii V327 trav AYHN01092062.1 5821 VSTQQKVQKNPESLSVSQGAVASLNCTSSDRNYNYFWWYKQHSRKGLEMLMSIFSDGEKEEGRFKVHLNKASLHVSLHIRDSQPSDSAVYFCAV
Peromyscus maniculatus bairdii V328 trdv AYHN01092064.1 16264 SSVAQKATEVQPAIIKQEGEQVTMDCSYETSMSFYQLYWYKQPPSGDMIFLIRQISSSHHNESSGRYSVIFQKSAKSISLIISASQVEDSMNYFCALGKP
Peromyscus maniculatus bairdii V329 trav AYHN01092064.1 23601 VNSQQGEENPLALSIQEGENVIMNCSYKTYSTTLQWYKQDSGRGPELLIFMRSNEREKRSGRLRATLDTSTQSSSLSITAAQAADTAVYFCATD
Peromyscus maniculatus bairdii V330 trdv AYHN01092064.1 30295 TSMAQKVTQAQTSVSVMEKKTVTLDCVYETRESTYYLFWYKHTASGEMVFLIRQESYKKENATEGRYSLNFQTSESSVGLIITDAQVEDSGVYFCSMRE
Peromyscus maniculatus bairdii V331 trav AYHN01092065.1 5137 VKGQQVEQSPVSLVLQEGERAELQCTSSTFLTSVQWFYQSPRGHLKSLFYNPSGTQQSGRLTSTTVAKEYRSSLYISSSKTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V332 trav AYHN01092066.1 18393 KSAGDSVTQTEGSVTLTVGAPLLLNCTYQTFYLEPLLLWYVQYLNEAPQLLLKSSTDNRRTEHQGFQATLQKSSSSFPLQKSSVQLADSALYYCCVR
Peromyscus maniculatus bairdii V333 trav AYHN01092066.1 59056 GNRAQSVAQPDAHLTVSEGASLEIKCSYSYGATPYLFWYVQYPGQSLQLLLKYAARDTLIKGINGFEAEFMKSNSSFNLRKSPAHWRDSAKYFCALS
Peromyscus maniculatus bairdii V334 trav AYHN01092066.1 90169 LDSQQLEQNPQFLSIQEGQDLTVYCNSSSTFPQFYWYRQVPKEGPVILMTLVKSGEVKEQKRMTAKFGEARKDSSLHIIRAQPGDTGIYFCAG
Peromyscus maniculatus bairdii V335 trav AYHN01092066.1 105812 KNDGQEVRQNSPSLTVQEGGISILTCDYNNNMFDYFAWYKKYPANSPTFLISLRSNVDKNEDGRFTIFFNKSGKRFSLHIATSQPGDSAMYFCAAG
Peromyscus maniculatus bairdii V336 trav AYHN01092066.1 124885 VSGQANTVMQSPSILDVWEKETAAINCTYTNSASNYFLWYKKDRREGLTLLADIRSNVDRRKEGRFTVILDKNARHVSLHISAAQTEDSALYLCAA
Peromyscus maniculatus bairdii V337 trav AYHN01092068.1 5531 IVGDAKSTQPSSMESTEEEPVHLPCSHSTISGNEYIYWYRQVPLRGPEYIIHGLKQNTSNRMAFLAIPSDRKSSTLILPRVSLSDAAVYYCIVIV
Peromyscus maniculatus bairdii V339 trav AYHN01092069.1 6130 VNGQVLSQSAQYISIPEGKDVSMSCNSSSTLERFLWYKQDPGEGLVLLVAIYKSGDLVRHGKVTAEMGATRKDSVLTISASEPVDTSTYFCAG
Peromyscus maniculatus bairdii V341 trdv AYHN01092071.1 10698 ASVAQTVTQRQQEQSVLETESATLDCTYDTTDTNYNLFWYKQRRGQMILVIRQEAYKQQNATEDRFSVNFQKAAKSFSLKISDLQLEDAATYFCALMER
Peromyscus maniculatus bairdii V342 trav AYHN01092071.1 29940 ASMAQIVTQRQQEQSVQKTESATLDCTYHATDTNYNLFWYKQQRGQMTLVIHQESYIKHNTKKDRFSVNFKKAAMSFSLKISDLQLEDAATYFCALMER
Peromyscus maniculatus bairdii V343 trdv AYHN01092078.1 13041 VSLDVILEQVDKSLNVSAGNHAIFYCIVTGGDLKTYQMSWYKKSEHNALVLVFKLNNNSTDDVMGNFKGKIDISKSEFVLEIQKVTLEDAGTYYCGSD
Peromyscus maniculatus bairdii V398 igkv AYHN01113137.1 3804 ARCDIQMTQSPSSLSASLGDRVTITCRASQGISNYLNWYQQKPGSAPKLLIYYTNRLVEGVPSRFSGSGSGTDYSLTISSLESEDIATYYCLQYDKRP
Peromyscus maniculatus bairdii V399 igkv AYHN01113142.1 696 SKCDIQMTQSPSQTVSLGDTITINCQASQSIGAALAWYQQNPGNSPKLLIYAASSLHAGVPSRFSGSGSGTDFTLTISSLKPEDIGTYYCQHYSSY
Peromyscus maniculatus bairdii V400 igkv AYHN01113150.1 2984 ARCDIQMIQSPSSLSASLGDRVTITCRASQGISNYLNWYQHKPGKSPKLLIYYTNRLVEGVPSRFSGSGSGTDYSLTISNMESEDIATYYCLQYDELP
Peromyscus maniculatus bairdii V401 igkv AYHN01113152.1 2959 ARCDIQMTQSPSSLSASLGDKVTITCRASQGISNYLNWYQQKPGKAPKLLIYDSDSLADGVPSRFSGSGSGTDYSLTISSLESEDIATYYCLQYDEFP
Peromyscus maniculatus bairdii V402 igkv AYHN01113158.1 572 ARCDIQMTQSPSSLSASLGDRVTITCRASQGISNYLSWYQQKPGSAPKLLIYYTNKLVEGVLSRFSGSGSGTDYSLTIGSLESEDIATYYCQQGY
Peromyscus maniculatus bairdii V403 igkv AYHN01113159.1 321 ARCDIQMTQSPSSLSASLGDRVTITCRASQGISNDLNWYQQKPGSAPKLLIYYTNRLVEGVPSRFSGSGSGTDYSLTIGSLESEDIATYYCQQGYTP
Peromyscus maniculatus bairdii V404 igkv AYHN01113166.1 106 SRGDVVMTQTPTSLPVSLGDQTSISCRSSQSLLLSSGHTYLHWYLQKPGQFPQILVYKVSNRFSGVSDRFSGSGSGTDFTLKISRVEPEDVGVYYCLQT
Peromyscus maniculatus bairdii V405 igkv AYHN01113172.1 1243 ARCDIQMTQSPSSLSASLGDRVSITCRASQGISNYLNWYQQKPWKAPKLLIYYTSRLADEVPLRFSGSGSGTDYSLTISSLEAEDIATYYCLQSSNLS
Peromyscus maniculatus bairdii V406 igkv AYHN01113178.1 819 ARCDIQMTQSPSSLSASLGDRVTITCRASQGIDNNLNWYQQKPGKAPKLLIYYTSRLADGVPSRFSGSGSGTDFSLTISSLEAEDIATYYCQQSNNLP
Peromyscus maniculatus bairdii V407 igkv AYHN01113197.1 665 ARCDIQMTQSPSSLYASLGDRVTITCQASQDISSSLIWLQQKPENPPKRLIYGASNLADGVPSRFSGSGSGTDYSLSISSLESEDMGIYYCLQDAQFP
Peromyscus maniculatus bairdii V408 igkv AYHN01113199.1 2009 ARCDIQMTQSPSSLSASVGDRVTITCTASQGISNYLSWFQQKPGKAPKRLIYAASTLADGVPSRFRGSGSGTDYSLSISSLESEDLATYYCLQYDKRP
Peromyscus maniculatus bairdii V409 igkv AYHN01113205.1 1073 SRGDVVMTQTPTSLPVRLGDQASISCRSSQSLVLSSGNTYLDWYLQKPGQSPQLLIYKVSNRFSGVPDRFSRSGSGTGFTLKISRVEPEDLGVYYCMQSSYVP
Peromyscus maniculatus bairdii V422 igkv AYHN01118806.1 6276 VQCDIHMTQSPVSLSAFIGDTVTITCRISQDIGRYLGWYQQKVGESPRFLIYYASNLLSGVPKRFSGSGFGAEYTLTINSIEPEDAGTYYCQQCFSYP
Peromyscus maniculatus bairdii V423 igkv AYHN01118806.1 8445 VTGETTTQSPPSLSFSPGETATLTCISSQSVGTYLAWYQQKPGQVPRLLIHSASTRASDVPVRFSGSGSGTDFTLTISTLEPEDVATYYCQPMSGWS
Peromyscus maniculatus bairdii V424 igkv AYHN01118815.1 1756 TSGDVVLTQTPLSLPVTIGQSASISCRSSQSLLQRNGETYLYWFLQKPGQSPKLLIYLVSKRVPGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCMQATYAP
Peromyscus maniculatus bairdii V425 igkv AYHN01118816.1 2587 SRGDIVLTQSPATLSVIPGERVTMTCKASQSIYTSIHWYQQKPNDVLRLLIKFASGSVSRIPSRFSGTGSGTDFTLSINNLEAEGVAIYYCQQSNSWP
Peromyscus maniculatus bairdii V426 igkv AYHN01118820.1 16 TSGDDVVLTQTPLSLPVTIGQSASISCRSSQNLLNSYGITYFYWFLQKPGQSPQRLIYWVSNRDTGVPDRFSGSGARTDFTLKISRVEAEDLGVYYCMQGTHTP
Peromyscus maniculatus bairdii V427 igkv AYHN01118820.1 15354 SRGNIVLTQSPATLSVTPGERVTMACKASQGIGTSLHWYQQKPNEAPRILIKYASESISGIPSRFSGSGSGTDFTLSINTVEAEDVVLYYCQQGNSLP
Peromyscus maniculatus bairdii V428 igkv AYHN01118821.1 6780 SRDDIVLTQSPAILSVTPGERVTMACKASQGISTSLHWYQQKPNEAPRLLIQYASASVSGIPSGSGSGTDFTLSINTVEPEDVATYYCQQSSSYP
Peromyscus maniculatus bairdii V429 igkv AYHN01118822.1 7300 SRGDIVLTQSPATQSVTPGERVTMACKASQGIDTNLHWYQQKPNEAPRLLIKYASESISGIPSRFSGSRSGTDFTLSINTVEAEDVALYYCQQGNSFP
Peromyscus maniculatus bairdii V430 igkv AYHN01118823.1 5869 SRGDIVLTQSPATLSVTPGERVTMTCKASQGIGTNLHWYQQKPNETPRLLIKYASQSVSGIPSRFSGSGSGTDFTLNINTVEPEDVATYYCQQSSSLP
Peromyscus maniculatus bairdii V431 igkv AYHN01118825.1 9146 SRGDIVLTQSPATLSVTPGERVTMACKASQGISKNLHWYQQKPNEAPRLLIKYASQSVSGIPSRFSGSGSGTDFTLSINKVEPEDVATYYCQQSYNRP
Peromyscus maniculatus bairdii V432 igkv AYHN01118826.1 6337 SRGDVVLTQSPATLSVTPGERVTMTCKASQGVSNYLHWYQQKPNEAPRLLIKYASQSVSGIPSRFSGSGSGTDFTLSINTVEPEDVATYYCQQSNN
Peromyscus maniculatus bairdii V433 igkv AYHN01118827.1 2260 SRGDIVLTQSPATLSVTPGERVTMACKASQGISTSLHWYQQKPNEAPRLLIKHAYQSISGIPSRFSGSGSGTDFTLSINTVEPEDVATYYCLQSSSFP
Peromyscus maniculatus bairdii V434 igkv AYHN01118827.1 10673 SRGDVVLTQSPATLSVTPGERVTMACKASQGVSNNLHWYQQKSNEAPRLLIKYASQSVSGIPSRFSGSGSGTDFTLSINTVEPEDVATYYCQQSNN
Peromyscus maniculatus bairdii V435 igkv AYHN01118827.1 19959 SRGDIVLTQSPATLSVTPGERVTMTCKASQGVSNYLHWYQQKSNEAPRLLIKLASQSVSGIPSRFSGSGSGTDFTLSINTVEPEDVATYYCQQGYSGC
Peromyscus maniculatus bairdii V436 igkv AYHN01118831.1 10166 SRGDVVMTQTLLSLPVSLGDEASISCRSSQSVVHSNGNTYLHWYLQKPGQSPQLLIYKVSNRYSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCFQ
Peromyscus maniculatus bairdii V437 igkv AYHN01118833.1 8665 SRGDIVMIQTPVSLPVSLGDKASISCRSSQSLAHSNGNSFLEWYLQKPGQSPQPLIYEVSKRLSGVPDRFSGSGSGTDFTLKISRVEPDDLGVYFCLQASYLP
Peromyscus maniculatus bairdii V438 igkv AYHN01118834.1 40961 ARCEIQMTQSPAFLSTSLGDSVIITCRASEDIYSSLAWYQQKPGKPPKLLIYRANILEDGVPSRFSGSGSGTQYFLKISSLQAEDVATYYCQQGSSYP
Peromyscus maniculatus bairdii V439 igkv AYHN01118845.1 3291 SRGDVVLTQTPLSLPVSLGDKASISCRSSQSVVHSNGYTYLDWYLQKPGQSPQLLIYEVSKRLSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCFQG
Peromyscus maniculatus bairdii V462 igkv AYHN01129990.1 1526 VRCDIQMTQSPASLSVSLGESVTMTCQASQAIGTLLAWYQQKPGKSPQLLMHYANSLADGVPSRFSGSGSGTQFSLKINGLQPEDVATYYCQQGSSYP
Peromyscus maniculatus bairdii V463 igkv AYHN01129994.1 7709 SSGEIVLTQSPASMAASQGDKVTMTCITSSSISNSRLHWYQQKPGASPKLLIYGTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWNTS
Peromyscus maniculatus bairdii V464 igkv AYHN01129996.1 5520 ARCDIQMTQSPASLSTSVGDSVTITCRASEDIDGYLAWYQQKPGKSPKLLIYYANSLADGVPSRFSGSGSGTQYSFKVRSLQLEDFATYYCQQHYSTP
Peromyscus maniculatus bairdii V465 igkv AYHN01130029.1 735 ARCEIQLTQSPASLSASLGESVTITCRASQDISGWLAWHQQKPGNPPKLLIHSATSLADGVPSRFSGSRSGTQFSLKISSLQPEDVASYYCQNHNNIP
Peromyscus maniculatus bairdii V466 igkv AYHN01130033.1 721 VKCAIQMTQSPPTLSVSPGDRVTITCHANQNINRLLVWYQQKPGNAPKQLIYEASSLQTGVPSRFSGSGSGTDYSFTISSLQLDDVATYYCQQYLGSP
Peromyscus maniculatus bairdii V481 igkv AYHN01135753.1 603 TCADIVLTQSPSSLAVSAGEKVTISCKSSQSLTSGSSHYLAWYQQKTGQFPKLLIYLASTRYTGVPDRFTGSGSGTDYTLTISSVQDEDLADYYCQQGYSNF
Peromyscus maniculatus bairdii V482 igkv AYHN01135755.1 2014 TCADIVMTQSPSSLAVSAGEKVTISCKSSQSLTLGSNHHLAWYQQKPGQAPKLLIYWASTRNTGVPDRFTGSGSGTDYILTISNVQAEDLADYYCQQYRSDP
Peromyscus maniculatus bairdii V483 igkv AYHN01135767.1 3518 STADIVLTQTPPSLTVSLGQSATMSCRSSQRVTIGRIQFMHWYQQKPGQPPKLLIYRASNLESGVPARFSGSGSGTDFTLTIHPVEADDAATYYCQQGKEVP
Peromyscus maniculatus bairdii V484 igkv AYHN01135767.1 21711 ICGDIVMTQSPSSLAVSAGEKVTISCKSSQSLFGSNSRNYLSWYQQKPGQAPKRLIYWASTRDTGVPDRFIGSGSETDYTLTINSVQAEDLADYYCQQ
Peromyscus maniculatus bairdii V485 igkv AYHN01135783.1 3421 ICGDIVMTQSPSSLAVSVGEKVTISCKSSQSLLGSTTKKNRLIWLQQKPGQAPKLLIYYASTLDTGVPDRFIGSGSGTDYTLTISSVQAEDLADYYCVQDLSYP
Peromyscus maniculatus bairdii V486 igkv AYHN01135792.1 1016 ACADIVMIQSPSSLAVSAGEKVTISCKSSHSLIFSSNHYLAWYQQKPGQAPKLLIYLASTRYTGVPDRFTGSGSGTYYTLTISSVQAEDLADYYCQQYRSDP
Peromyscus maniculatus bairdii V492 igkv AYHN01138377.1 376 SAGDIVLTQTPPSLTVSLGQRATMSCRSSQSVTISTFHFMHWYQQKPGQPPKLLIYGASNLESGVPARFSGSGSGTDFTLTINPVEADDAATYYCQQSRDYP
Peromyscus maniculatus bairdii V493 igkv AYHN01138383.1 2621 ICGDIVMTQSPSSLAVSAGEKVTISCKSSQSLFGKNSKNYLNWYQQKPGQAPKLLIYLASTRYTGVPDRFIGSGSETDYTLTISSVQPEDLADYFCQQQYSKP
Peromyscus maniculatus bairdii V494 igkv AYHN01138383.1 21265 ACADIVMTQSPSSLAVSVGEKVAINCRSSQSLTSGSSHYLAWYQQKRGQSPKLLIYYASTRYTGVPDRFTGSGSGTDYTLTITSVQDEDLADYFCQQHYSNP
Peromyscus maniculatus bairdii V495 igkv AYHN01138391.1 882 ACADIVMTQSPSSVAVSLGEKVTISCKSSQSLYSSFLQKNALAWYQQKPGQAPKLLIYLASTQDTGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCQQFYNTP
Peromyscus maniculatus bairdii V497 igkv AYHN01139401.1 3815 STGDIVLTQSPASLAVSLGQKATISCKSSESVKFFGTDLLHWYQQKPGQPPKLLIYRASNTESGIPARFSGSGSRTDFTLTIHPVEADDAAIYHCQQGKEDP
Peromyscus maniculatus bairdii V498 igkv AYHN01139417.1 1022 TTGDIMLTQSPASLAVSLGQRATISCKASQSVSNIFLNSMHWYQQKPGQPPKLLIYRASNTASGVPARFSGSGSETDFTLTIHPVEADDAATYYCQQSKELP
Peromyscus maniculatus bairdii V499 igkv AYHN01139563.1 489 ACADIVMTQSPSSLAVSAGEKVTISCKSSQSLTSGSYNFLTWYQQKPGQSPKLLIYWASTRNTGVPDRFTGSGSGTGYTLTITSVQDEDLADYYCQQHYSTP
Peromyscus maniculatus bairdii V500 igkv AYHN01139568.1 639 TCADIVLIQSPSSLAVSAGEKVTISCKSSQSLTSGSYNFLTWYQQKPGQSPKLLIYYASTRNTGVPDCFTGSGSGTGYTLTISSVQDEDLADYYCQQSYSTP
Peromyscus maniculatus bairdii V501 igkv AYHN01139581.1 2816 ACADTVMTQSPSSLAVSAGEKVTISCKSSQNLFYSENKKNYLAWYQQKPGQSPKLLIYWASTRNTGVPDRFIGSGSGTDFTLTISSVQAEDLGDYYCMQDYYFP
Peromyscus maniculatus bairdii V502 igkv AYHN01139586.1 9517 ACADIVMTQSPSLLAVSAGEKVTISCKSSQSLLYNKDQKNYLNWYQQKPGQSPKLMIYYASTRYTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCQQSYSNP
Peromyscus maniculatus bairdii V503 igkv AYHN01139590.1 6367 TSGDVVLTQTPLSLSVSIGQSASISCRSSQSLLYSDGTTHLYWFLQRPGQSPQRLIYWVSNLGTGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCMQS
Peromyscus maniculatus bairdii V504 igkv AYHN01139591.1 1942 SRGNIMLTQSPATLSMTPGEKVTMTCKASQAISTNLHWYQQKPNEAPRLLMKYASQSISGIPSRFSGSGSGTDFTLSINTVEPEDVVSYYCKQGNSLP
Peromyscus maniculatus bairdii V505 igkv AYHN01140107.1 2240 ARCDIQMTQSPSSLSASLGDRVTINCKASQGISNYLSWYQQKPGKAPKLLIYRASNLADGIPSRFSGSGSGTDFTLTISNLESEDIAAYYCLQTDKYP
Peromyscus maniculatus bairdii V509 ighv AYHN01143197.1 14447 VHSQVQLQQSGPGLGKPGSSVKLSCKASGYTFTSYDINWVKQSSGQGLEWIGAINPGNGDTGYNQKFKDKATLTVDKSSSTAYMDLRSLTSEDSAVYFCAR
Peromyscus maniculatus bairdii V510 ighv AYHN01143197.1 35778 VHCQVQLQQSGPELGKPGSTVKLSCKASGYSFTSYDINWLKQRPGQGLEYIGWIYPGDGDIGCAEKFQGKATLTIDTSSSTAYMQLSSLISEDSVVYYCA
Peromyscus maniculatus bairdii V511 ighv AYHN01143198.1 14068 VHSQVQLQQSGPELVKPGVSVKLSCKASGYTFTNEYMQWVKQRPGQGLEWIGYIYPGNGNSGCAQKFQGKATLTADTSSSTAYMDLSSLTSEDSAVYYCAR
Peromyscus maniculatus bairdii V512 ighv AYHN01143198.1 23950 VHSQVQLQQSGAELLKPGVSVKLSCKASGYTFTSYGIHWMKQRSGQGLEWIGYVNTGHGGTAYIQKLKDRVKLTADKSSSTAYMELRSLTFEDSGVYYCAR
Peromyscus maniculatus bairdii V513 ighv AYHN01143198.1 41266 VHCKVQLVESGGGLVQPKAALKLSCAASGFTISDFTIHWIRQAPGKGLEWVASIRSKDYNSQTYYADSVKDRFTISRDDSQSMAYLQVNSLKTEDTASYYCA
Peromyscus maniculatus bairdii V514 ighv AYHN01143201.1 6530 VHSQVQLQQSGAELVKPGSSVKLSCKASGYTFTDYGMNWVKQRSGQSLEWIGWIGTSSGNTEYNQKFQGKAKLTIDKSSSTAYMDLSSLTSEDSAVYYCAR
Peromyscus maniculatus bairdii V515 ighv AYHN01143202.1 6740 VHSQVQLQQSGPGLGKPGSSVKLSCKASGYTFTNYGINWVKQRPGQSLEWIGFINANGGTDYNQKFQGKAKLTVDKSSSTAYMELSSLTSEDSAVYYCAR
Peromyscus maniculatus bairdii V516 ighv AYHN01143207.1 24354 VQCEVQLVESGGGLMHPGKSLKLSCAASGFTFSNYWMNWVRQVPGKGLEWVALIMDKVNNYEARYVESVKGRFTISRDDSKSSIYLQMNSLKPEDTAIYYCTR
Peromyscus maniculatus bairdii V517 ighv AYHN01143208.1 8668 VHSQVQLQQSGAKLAKPGVSVKLSCKASGFDIVDTYMHWVKQRPGQGLEWIAWIDPENGNTEYNQKFQDKAKLTADTSSNTAYMDLSSLTSEDSAVYYCA
Peromyscus maniculatus bairdii V518 ighv AYHN01143208.1 21802 VHCQVQLQQSGPGLGKPGATVKLSCKASGFNIVDTYIHWVKQRPGQGLEWIGSIDPANGNTEYNQKFRSKAKLTADKSSNTAYMDLSSLTSEDSAVYYCAK
Peromyscus maniculatus bairdii V519 ighv AYHN01143210.1 11595 VHSQVQLQQSGAELKKPGSSVKLSCKASGFNIVDTYMHWVKQRPDQGLEWIGRIDPANGNTNDNQKFKGKATLTADKSSNTAYMDLSSLTSEDSAVYYCAK
Peromyscus maniculatus bairdii V520 ighv AYHN01143213.1 15267 VLSQVTLRESGPGLLQPSQTISLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLANIWWKDNKYYNPSLKSRLTISKDTSKNQVFLQITSVDTADTATYYCAQA
Peromyscus maniculatus bairdii V521 ighv AYHN01143213.1 33034 VHSQVQLQQSGPELKKPGSSVKLSCKASGYTFTNYFMHWVKQRSGQGLEWIGWIDPSDSETKYVQKFQNKAKLTVDKSSSTAYMELSSLTSEDSAVYYCA
Peromyscus maniculatus bairdii V522 ighv AYHN01143213.1 47739 VHCEVQLVESGGGLVQPQGSLKLSCAASGFTFSDYAMSWVRQAPGKGLEWVGRIRSKSNNYATYYADSVKGRFTISRDDSQSTAYLQMNSLKTEDTATYYCAR
Peromyscus maniculatus bairdii V524 ighv AYHN01143213.1 73841 VHCQVQLQQSGPGLGKPGSSVKLSCKTSGYTFTSYVMHWVKQSPGQGLEWIGWIYPKNGNTKYNQKFQDKAILTADTSSSTAYMELRSLKSEDSAVYYCGR
Peromyscus maniculatus bairdii V525 ighv AYHN01143215.1 15946 VYSQVQLQQSGAELGKSGASVKLSCTAYGYTFTDHYLTWVKQMPEQGLEWNAWIIPGSGDTDYNQKFQGKDTLTADKSCSTAYMELSSLTSEDSAVYYCV
Peromyscus maniculatus bairdii V526 ighv AYHN01143215.1 22909 VHCQVQLQQSGPGLVKPGSSVKLSCKASGYTFTSYVMHWVKQSPGQGLEWIGWIYPGDGDTDYNQKFKDKAILTADTSSSTAYMELRSLTSEDSAVYYCAR
Peromyscus maniculatus bairdii V527 ighv AYHN01143215.1 33263 VQCEVQLVEFGGGLAQPGNFLKLSCAASGFTFSSYFMNWFHQSPGKGLEWVAETRNKANNCATYYAESVKGRFTVSRDDSKSSVYLQMSRLRAKDIAIYYCA
Peromyscus maniculatus bairdii V528 ighv AYHN01143216.1 11220 VQGEVQLVESGGVLVQPGKSLKLSCAASGFTFNDAYVHWVCQTPEKRLEWVAEIRNKANNYATYYLESVKGRFTISKDDPKSSVYLQMNSLRAEDTAIYYCTR
Peromyscus maniculatus bairdii V533 trav AYHN01145328.1 601 GVRGMQVEQNPPGLTLQEGAGSAMRCNFSTTTRSVQWFRQNPGGSLLSLFFMTPGTKENGRLKSTFDSKESYSTLHIRDAQLEDSGTYLCAAD
Peromyscus maniculatus bairdii V534 trav AYHN01145329.1 3471 ESRGEQVEQHPSTLVVQEGDSAAINCTYTDSASVYFPWYKQEPGKHPQFIIDIRPNVERKQSQRLILLLDKKAKHLSLHIAATQPADSAIYFCASD
Peromyscus maniculatus bairdii V535 trav AYHN01145329.1 11917 RTHGYSVTQKQGQVTLSEDDFLFINCTYSTTGYLTLFWYVQYPGEGPELLLKVTTANNKGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCALS
Peromyscus maniculatus bairdii V536 trav AYHN01145329.1 26569 VSSQQKVQQNPEFLSVPEGAMTSLNCTFTDSASQSFWWYRQQPGKSPKALISIFSNGEKEEGRFTVHLNKASLHVSLHIRDSQPSDSAVYLCAV
Peromyscus maniculatus bairdii V537 trav AYHN01145331.1 4444 VSSQQKVQQNQESLSVPEGAMVSLNCTFTDSASQFFWWYRQQPGKSPKALMSIFSNGDKEEGRFTVHLNKASLLVSLNIRDSQPSDSAVYLCAV
Peromyscus maniculatus bairdii V538 trav AYHN01145332.1 4623 GVRGMQVEQNPPALTLQEGAGSALRCNFSTTMRSVQWFRQNPRGSLVNLFSLTPGTKENGRLKSTFNSKERYSTLHIRDAQLEDSGTYLCAVQ
Peromyscus maniculatus bairdii V539 trav AYHN01145337.1 1887 ESRGEQVEQHPSTLSVQEGDSAAINCTYTDSTSVYFPWYKQELGKHPQFIIDIRSNAERKQNQRLTLLLDKKAKHLSLHIKATQPADSAIYFCAAD
Peromyscus maniculatus bairdii V540 trav AYHN01145337.1 4415 RTHGDSVIQKQGQVTLSEDDFLFINCTYSTTSYPTLFWYVQYPGEGPELLLKVETANNKGSSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALS
Peromyscus maniculatus bairdii V541 trav AYHN01145338.1 7207 VSCQQKVLQNPEFLSVPEGAMVSLNCTYSDQNSQYFWWYRQHSAKSPKALMSIFSNGEKEEGRFTVHLNKANGHVSLHIRDSQPSDSAVYLCAV
Peromyscus maniculatus bairdii V542 trav AYHN01145339.1 7311 VSCQQKVQQNQESLSVPEGAMVSLNCTYSDQNSQYFWWYRQQPGKSPKALMSIFSNGEKEEGRFTVHLNKASRHVSLHIRDSQSSDSAVYFCAV
Peromyscus maniculatus bairdii V543 trav AYHN01145341.1 605 GVRGMQVEQNPPALTLQEGAGSAMRCNFSTTTRSVQWFRQNPGGSLLSLFFMTPGTKENGRLKSTFDSKESYSTLHIRDAQLEDSGTYLCAAD
Peromyscus maniculatus bairdii V544 trav AYHN01145341.1 5389 ESRGEQVEQHPSTLVVQEGHSAAINCTYTDSASVYFPWYKQEPGRHPQFIIDIRSNAERKQNQRLILLLDKKAKHLSLYITAIQPADSAIYFCTTN
Peromyscus maniculatus bairdii V545 trav AYHN01145341.1 13869 RTHGYSVTQKQGQVTLSEDDFLFINCTYSATGYLTLFWYVQYPGEGPELLLKVTTANNKGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCALR
Peromyscus maniculatus bairdii V546 trav AYHN01145342.1 8523 VSSQQKVQQNPEFLSVPEGAMTSLNCTFTDSASQSFWWYRQQPGKSPKALISIFSNGEKEEGRFTVHLNKASLHVSLHIRDSQPSDSAVYLCAV
Peromyscus maniculatus bairdii V547 trav AYHN01145346.1 2738 GVRGMQVEQNPPALSLQEGAGSSLRCNFSTTMVRVQWFRQNPRGSLVNLFSLTSGTKENGRLKSTFDSKERYSTLHIRDAQLEDSGTYLCAAE
Peromyscus maniculatus bairdii V548 trav AYHN01145347.1 3121 ESRGEQVEQHPSTLSVQEGDSAAINCTYTDSLSVYFLWYKQEPGKHPQFIIDIRSNSERKQEQRLTLLLDKKAKHLSLYITATQPADSAIYFCAAD
Peromyscus maniculatus bairdii V549 trav AYHN01145347.1 5684 STHGYSVTQKQGQVTLSEDDFLFINCTYSATGYPTLFWYVQYPGECPELLLKVTTANNKGSSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V550 trav AYHN01145347.1 7887 GNSQVGEENAWFLSIQEGENVTVNCSYKTTITALQWYRQESGRGPAMLILIRSNEREKRSGRLRATLDTSTQSSSLSITAAQAADTAVYFCATD
Peromyscus maniculatus bairdii V551 igkv AYHN01145465.1 4538 ARCDIQVTQSPSSLPASLGDRVTITCRASQDIKKYMAWYQQKPGEVPKLLIYYASILQSGVPSRFSGSGSGTDYSFTISSLEPEDVATYYCQQGYNL
Peromyscus maniculatus bairdii V552 igkv AYHN01145465.1 16932 AKCDVQMTQSPASLSASVGESVTMTCQASQDIYSNLAWYQQKTREPPKFLIRGAKYLADGVPSRFSGSGSGTQYYLKISSLQPEDVATYYCQQYSVLP
Peromyscus maniculatus bairdii V553 igkv AYHN01145481.1 8877 ARCDIQVTQSPSTLSVSLGDRVTITCKASQTITNRMAWYQQKPGEVPKVLIYAASTLQSGVPTRFSGSGSGTDFSFTISQLVSEDVATYYCQQGYSL
Peromyscus maniculatus bairdii V554 ighv AYHN01145666.1 12916 IQCEVQLLESGGGLVQSEGSLKLSCAASGFTLSDFYMIWVRQPSGKELEWIAVSRNKDNGYSAEYSASVNGRFAISRDDSKNTLYLQMNSLKAEDTATYYCARV
Peromyscus maniculatus bairdii V555 ighv AYHN01145667.1 19813 VQCEVQMVESGGGLVHPGSSLKLSCVASGFTFSNYWMYWVRQAPGKGLEWVGVVKLKSNNYATSYAESVKGRFTISRDDSKSSIYLQMTSLKVEDTAIYYCTTD
Peromyscus maniculatus bairdii V556 ighv AYHN01145667.1 24233 VQCEVQLVESGGRLVQPGESLRLSCAASGFTFSNNWMDWVRQAPGKGLEWVGEINGDSSTIKYAPSLKDRFTISIDNAKNTLYLQMNSVRSEDTATYYCTR
Peromyscus maniculatus bairdii V557 ighv AYHN01145671.1 2426 VQCEVQLVETGGGLLQPGAALRLSCAASGFTFSDYWMYWVRQAPGKGLEWIGRISPNGGTTDYVSSLKDRLTISRDNAKQTLHLQMNSVRSEDTATYYCTK
Peromyscus maniculatus bairdii V558 ighv AYHN01145672.1 4555 VHSEVELQQSGPELGIPASSVKLSCKASGYTFTSYYMHWVKERPGQGLEWIGWINGGSGDTYYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAIYYCARQ
Peromyscus maniculatus bairdii V559 ighv AYHN01145672.1 21628 ILSQVQLQESGPGLVKPSQTLSLTCSVTGYSITSDYTWNWIRQSPWKKLEWMGYINSAGSTYYNPSFKSRISITREASKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V560 ighv AYHN01145676.1 27507 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYCWTWIRQSSGKKLEWMGCIDYGGSTYYNPSLQSRISITRETSKNQFSLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V561 ighv AYHN01145676.1 41861 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSDYWSWIRQSPGKKLEWMGYISYSGSTSYNPSFKSHISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V562 ighv AYHN01145678.1 11029 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITTSGYGWTWIRQSSGKKLEWMGYIYYSGSTSYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V563 ighv AYHN01145680.1 12415 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSAYYWHWIRQSPGKKLEWMGYITYAGGTGYNPSLKSRISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V564 ighv AYHN01145681.1 7671 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYWWTWIRQSPGKKLEWMGYISYDGSTYYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V565 ighv AYHN01145684.1 122 VQTEVQLVESGGGLVQPGGSLKLSCATSGFTFTDYWMHWVRQAPGKGLEWVGVIKHKPDNYATVYAESVKGRFAISRDDSKSSIYLQMNHLKVEDTAIYYCTS
Peromyscus maniculatus bairdii V566 ighv AYHN01145689.1 18029 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSTYWSWIRQSPGKKLEWMGYIISGGGTNYNPSLQSRISITIETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V567 ighv AYHN01145690.1 20079 ILSQVQLQESGPDLVKPSQSLSLTCSVTGFSITSGYYWNWIRQSPGKKLEWMGYIGSGGSTYYNPSLQSRISITIETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V568 ighv AYHN01145691.1 12199 ILSQLQLQESGPGLVKPSQSLSLTCSVAGYSITSGYWWSWIRQSPEKKLEWMGYIGYDGSTCYNPTLQSRISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V569 ighv AYHN01145692.1 10574 ILSQIQLQESGPGLVKPSQSLSLTCSVTGDSITSYPWSWIRQSPGKKLEWMGYISSGGSTSYNPSLKSRISITRETSKNQFFLQLNSVTPEDTATYYCAR
Peromyscus maniculatus bairdii V573 igkv AYHN01147903.1 790 ARCDIQVIQSPSSLSVSLGDRVTINCLASQGISYELNWYQQKSGQAPTCLIYNANNLQPGVPSRFSGQYSGKSFTLTISSMEPEDVGTYYCLQHSSAP
Peromyscus maniculatus bairdii V575 ighv AYHN01148521.1 2090 IQCEVQLVESGGGLVQPGQSLKLSCAASGFTFSNAWMNWVRQAPGKGLEWVAQIRNKASNYATHYVESVKGRFTISRDDSKSSLYLQMNNLRAEYTAIYYCTT
Peromyscus maniculatus bairdii V576 ighv AYHN01148521.1 7737 VYSQVQLQQSGPELVRPGASVKLSCKASGFTFTSYHMNWVKQRPGQDLEWIGNIYPGNGNTYYIQTFQGKAKLTVDKSSSTAYMELSSLTSEDSAVYYCA
Peromyscus maniculatus bairdii V577 ighv AYHN01148522.1 5560 IQCEVQLVESGGGLVRPGQSLKLSCAASGFTFSNYWMNWVRQAPGEGLEWVAQIRNKAYNYATHYAESVKGRFTISRDDSKSSLYLQMNSLRAEDTAIYFCT
Peromyscus maniculatus bairdii V578 ighv AYHN01148523.1 6454 VHSQIQLQQPGAELVRPGSSVKLSCKASGYSFTGYYMHWVVQRPGQGLGWIGRINPANGNTKNNQKFQSKATLTVDKSSSTAYMELSSLISENSAVYYCT
Peromyscus maniculatus bairdii V579 ighv AYHN01148524.1 5450 VHCQVQLQQSGPELRKPGSSVKLSCKASGYTFTEYYIDWLRQSPGQGLEWIGAINPGNDNTNYNQKFKGKATLTADKSSSTAYMELNSLTSEDSAVYYCGR
Peromyscus maniculatus bairdii V580 ighv AYHN01148525.1 4572 VHSQVQLQQSGPGLVKPGSSVKLSCKASGYTFTEYYIDWLRQSPGQGLEWIGAINPGNDNTNYNQKFKGKATLTADKSSSTAYMELNSLTSEDSAVYYCGR
Peromyscus maniculatus bairdii V581 ighv AYHN01148531.1 15975 VQCEVQLIESGGGLVQPGGSLKLSCATSGFTFSDFYMNWVRQFPGKGLEWVGFIRNKANGYTAEYSASVKGRFTISRDDSKNTLYLQMNSLKAEDTATYYCAR
Peromyscus maniculatus bairdii V582 ighv AYHN01148531.1 33491 VQSQVQLVQSGPELKQPGQSVKISCKASGYTFTYYGMHWVKQTPGQGLKWMGWINTYSGNPTYAEDFKSQFVFSLDTSISTAYLQIGNLKNEYTAMYYCAK
Peromyscus maniculatus bairdii V583 ighv AYHN01148533.1 10438 VQCEGQLVESGGGLKQPGGSLRLSCAASGFTFSNYWMNWIRQAPGKGLEWVGEISPSSGTINYSPSLKERFTISRDNAKNTLYLQMSSVRSEDTATYYCAR
Peromyscus maniculatus bairdii V584 ighv AYHN01148533.1 19664 VQCEVQLVESGGGLIQPGGSLRLSCAASGFTFSNSWMNWIRQAPGKGLEWIGEINKDSSSINYAPSLKDRFTISRDNAKNTLYLQMSSVRSEDTATYYCGR
Peromyscus maniculatus bairdii V585 ighv AYHN01148533.1 24798 VQCEVQLVESGGGLIQPGGSLRLSCAASGFTFSDYWMGWFRQAPGKGLEWVGVINQDSSTIRYAPSLKDRFTISRDNGKNTLYLQMSSVRSEDTATYYCAK
Peromyscus maniculatus bairdii V586 ighv AYHN01148534.1 21349 YGGGLVQPGGSLKLSCAASGFTSSNFHMNCVHQPPGKGLEWIAMSRSKNNGYTTDYSASVKSRYTISSYDSKNILFLQMNSLKVENTATYYCVRD
Peromyscus maniculatus bairdii V587 ighv AYHN01148535.1 9540 VQCEVQLVESGGGLIQPGGSLRLSCAASGFTFSDSWMSWFRQATGKKLEWLGDINKDSSTIRYGASLKDRFTISRDNAKNTLYLQISSVRSEDTATYHCAT
Peromyscus maniculatus bairdii V588 ighv AYHN01148535.1 17530 VQYEVQLVESGGGLIQPGGSLRLSCAASGFTFSDYWMNWIRQPPGKGLEWVGDINKDSSEINYAPSLKDRFTISRDNAKNTLYLQMSRVRSEDTATYYCAR
Peromyscus maniculatus bairdii V589 ighv AYHN01148535.1 30301 VQTQVQLVQSGPELKQPGQSVKISCKASGYTFTSYAMHWVNQAPGQGLKWVGWINTETGNPTYAEDFKGRFVFSLDTSVSTAYLQISSLKNEDTAMYYCLR
Peromyscus maniculatus bairdii V590 ighv AYHN01148535.1 41544 VQCEVQLVESGGGLIQPGGSLRLSCTASGFTFSDYWMNWIRQAPGKGLEWVGDINEGGGTTNYAPSLKDRFTISRDNAKNTLYLQMSSVRSEDTATYYCAR
Peromyscus maniculatus bairdii V591 ighv AYHN01148535.1 50039 VQCEVQLVESGGGLIQPGGSLRLSCAASGFTFSDYWMEWVRQAPRKGLEWVGEINPGSSTIRYASSLKDRFTISRDNAKNTVYLQMSSVRSEDTATYYCAR
Peromyscus maniculatus bairdii V592 ighv AYHN01148535.1 58350 VQCEVQLVESGGGLIQPGGSLRLSCAASGFTFSDYWMSWIRQAPEKGLEWVGEINPGSSTIRYAPSLKDRFTISRDNAKNTLYLQMSSVRSEDTATYYCAR
Peromyscus maniculatus bairdii V593 ighv AYHN01148535.1 73846 VQAQVQLVQSGSELKQPGQSVKISCKASGYTFTIYGINWVKQAPGQGLKWMGWINTNTGNPTYAEDFKGRFVFSLDTSVSTAYLQISSLKNEDTAMYYCARY
Peromyscus maniculatus bairdii V594 ighv AYHN01148535.1 89242 VQAQVQLVQSGSELKQPGQSVKISCKASGYTFTSYGMNWVKQEPGQGLKWMGWINTNTGNPTYAEDFKGRFVFSLDTSVSTAYLQISSLKNEDTAMYYCA
Peromyscus maniculatus bairdii V595 igkv AYHN01148600.1 8142 ACADIVMTQSPSSLAVSAGEKVTISCKSSQSLLDHKNNRLSWYQQKPGQSTKLLIYLASTWDTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCLQVYSTP
Peromyscus maniculatus bairdii V596 igkv AYHN01148600.1 11397 ACADTMMTQSPSSLAVSAGEKVTISCKSSQNLFYSENKKNYLAWYQQKPGQSPKLLIYWASTRKTGVPDRFTGSGSGTDFTLTISSVQAEDLGDYYCMQHYYH
Peromyscus maniculatus bairdii V597 igkv AYHN01148603.1 10515 ACADIVMTQSPSSLAVTAGEKVTISCKSSQSLLYSKDQKNYLSWYQQKPGQAPKLLIYWASTRYTGVPERFLGSGSETDFTLTISSVQAEDLADYYCLQHYYPI
Peromyscus maniculatus bairdii V604 igkv AYHN01151051.1 2366 VRCDIQMTQSPPTLSASLGDRITITCHASQNINSWLAWYQQKPGNAPKPLIYKTSNLHTGVPSRFSGSGSGTDYSLTINNMESEYIATYYCLQYDEFP
Peromyscus maniculatus bairdii V605 igkv AYHN01151054.1 10970 VRCNIQMTQSPTTLSAYLGDRVTITCRAGQNVNSWLAWYQQKPGNAPKLLIYKASSLQTGIPSRFSGSGSGTDFTLTISSLQPEDIATYYCLQHQSC
Peromyscus maniculatus bairdii V606 igkv AYHN01151275.1 1050 SRGDVVMTQTPLALPVSLGDQASISCRSSQSLVHSDGYTYLNWLLQKPGQSPQLLIYRISTRLSGVPDRFSGSGSSTDFTLKISRVEPEDLGVYYCVQA
Peromyscus maniculatus bairdii V607 igkv AYHN01151276.1 82 SRGDVVMTQTPLALPVSLGDQASISCRSSQSLVHSDGKIYLNWLLQKPGQSPQLLIYEISTRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCMQA
Peromyscus maniculatus bairdii V608 igkv AYHN01151392.1 1168 ARCDIQMTQSPSSLSASLGERVTITCRASQGIYNNLNWYQQKPGKSPKLLIYAASNREEGIPSRFSGSGSGTDYSLTIGSLESEDTATYYCQQGY
Peromyscus maniculatus bairdii V609 trav AYHN01151509.1 4648 KINADSVTQTEGRVTVTEGLPVMMNCTYQTAYSPFLFWYVQYLNKAPQLLLRSATDNQRTEHQGFQATLQKSSSSFPLQKSSVLLADSALYYCALS
Peromyscus maniculatus bairdii V610 igkv AYHN01151884.1 731 SAGDIVLTQTPPSLTVSLGQRATMSCSSSQSVTIRTFHFMHWYQQKPGQPPKLLIYGASNLESGVPARFSGSGSETDFTLTINPVEADDAATYYCQQSRELP
Peromyscus maniculatus bairdii V611 igkv AYHN01151885.1 561 ICGDIMMTQSPSSLAVSAGEKVTISCKSSQSLLGSNSKNYLNWYQHKPGQSPKLLIYLASTRYIGVPDRFTGSGSGTDYTLTISSVQPEDFADYFCQQ
Peromyscus maniculatus bairdii V612 igkv AYHN01151886.1 342 ICGDIVMTQSPSSLAVSAGEKVTISCKSSQSLFGKNSKNSLNWYQQKPGQAPKLLIYWASTRDTGVPDRFIGSGSETDYTLTISSVQAEDLADYYCMQQYSTP
Peromyscus maniculatus bairdii V615 iglv AYHN01152210.1 17866 SMASYILTQPPSVSVALGQKATITCSGEKLSDKYVHWYQQKPGQAPVLVIYDDNNRPSGIPDRFSGSNSGNTAILTISKAQAGDEADYYCQC
Peromyscus maniculatus bairdii V616 iglv AYHN01152210.1 45739 SLFSGSFSQLMVTQSPSASASPGASVKLTCTLSSQHSTYNIGWYQQHPDKAPKYVMYLRSDGSHSKGDGIPDRFSGSSSGAHRYLSISNIQPEDEAIYYCGVDD
Peromyscus maniculatus bairdii V617 iglv AYHN01152214.1 3933 SIASYILTQPPSVSVALDQKATITCSGEKLSGKYVNWYQQKPGQAPVLVIYGNNNRPSGIPDHFSGSKSGNTATLTISKAQAGDEADYYCQRWD
Peromyscus maniculatus bairdii V618 iglv AYHN01152215.1 35542 SVASYILTQPPSVSVALGQKATITCSGDKISGKSVHWYQQKPGQAPVLVIYNDNKRPSGIPDQFSGSNSGNTATLTISKAQAGDEADYYCQCWD
Peromyscus maniculatus bairdii V619 igkv AYHN01152628.1 1524 STGDIVLTQSPASWAVSLGQKATISCKSSESVNYYGTDVLQWYQQKPGQPPKLLIYAASNTESGVPARFSDSGSETDFTLTIHPVEADDAAIYHCQQGKEVP
Peromyscus maniculatus bairdii V620 igkv AYHN01152631.1 3411 TTGDIVLNQSPSSLAVSLGQRATISCKASQSVSNNFFTYMYWYQQKPGQPPKLLIYGASNTASGVPARFSGSGSGTDFTLTIHPVEADDAATYYCQQGKEFP
Peromyscus maniculatus bairdii V621 igkv AYHN01152639.1 5586 STGDIVLTQSPASLAVSLGQKATISCKSSESVNIFGTDLLHWYQQKPGQPPKLLIYAASNKASGVPARFSGSGSGTDFTLTIHPVEADDAAIYHCQQSQEFP
Peromyscus maniculatus bairdii V622 igkv AYHN01152641.1 6048 SMGDIVMTQSPASLAVSLGQRATISCKASQSVTLLGLTYMHWYQQKPGQPPKLLIHGASNLASGVPAGFSGSGSETDFTLTIHPVKADDAATYYCQQTRDVP
Peromyscus maniculatus bairdii V623 igkv AYHN01152735.1 47031 STGDIVLTQSPDSLAVSLGQKVTISCKSSESVNKFGINLMHWYQKKPSQPPKLLIYNEGHRESGVPDRFSGYEVALDFTLTIHPVEADDAATYFCQQGIELP
Peromyscus maniculatus bairdii V625 igkv AYHN01152738.1 1342 YTGEIVMTQSPASLAVSPGQIASISCRSSQGVITAGIHLMNWYQQKPGQSPKLFIYDASKVVSGVPARFSGSGSGTDFTFTIHHPVEADDVATYYCQQGLELP
Peromyscus maniculatus bairdii V626 igkv AYHN01152738.1 5285 ACADIVMTQSPSSLAVSAGEKVTISCKSSQSLLNNNKNGLAWYQQKSGQAPKLLIYLASTRGTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCQQHYSIP
Peromyscus maniculatus bairdii V627 igkv AYHN01153336.1 635 ARCDIQMTQYPSSLSASLGDRVTITCGASQSTTKYLNWYQQKPGKAPKCLIHYPNSLADGVPLRFSGSGSGTDFSLTISSLESEDIATYYCLQVSNDP
Peromyscus maniculatus bairdii V628 igkv AYHN01153345.1 433 ARCDIQVTQSPTFLSASLGERVTINCLASQGISNDLNWYQQKSGQAPKLLIDYATILQSGVSSRFSGQYSGKSFTLTISSVEPEDVATYYCLQHYNTP
Peromyscus maniculatus bairdii V629 igkv AYHN01153577.1 13870 SSGQMVLTQSPAFVVASQGDRVTLTCITSSSVSSSYFNWYQQKPGTSPKLLIYKASTLASGVLARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSSP
Peromyscus maniculatus bairdii V630 igkv AYHN01153579.1 6984 SNGQIVLTQSPASMAASQGERVSMTCSASSSVASSYLNWYQQKLGGSPKLLISGTSSLASGVPARFSGSGSGTTYSLIISSIEAEDAATYYCQQWGSVP
Peromyscus maniculatus bairdii V631 ighv AYHN01153689.1 16405 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTGYHVHWVRQPPGKGLQWMGIIAWNGNTYYNSALNSRVTISRDTSKSQVFLKLNNLQTEDTAMYYCAR
Peromyscus maniculatus bairdii V632 ighv AYHN01153691.1 5784 TLSQMQLKESGPGLVQPSQTLSLTCTVSGFSLTSYGVHWVRQPPGKGLQWLGVIRYTGNTDYNSSLNSRITISRDTSKGQLFLKLNNLQTEDTAMYYCTT
Peromyscus maniculatus bairdii V633 ighv AYHN01153692.1 3311 VQCEVQLVESGGGLVHPGRLLKLSCAASGFTFSDYDMHWVRQAPGKGLEWVAYISNGGGTIYYANAVKGRFTISRDNAKNTLYLEMSSLKSEDTATYYCAR
Peromyscus maniculatus bairdii V634 ighv AYHN01153692.1 13581 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDVNVYWVHQPTGKSLEWMGGIWYNGNTYYNSALNSRITISRDTYKSQVFLKLNNLQSEDTAMYYCVI
Peromyscus maniculatus bairdii V635 trav AYHN01153727.1 3306 DVQAQSVTQSDAHVTVFEGDSVELRCNYSYGGTPYLFWYMQHRGQGLQLLLRYFSGDPVVHGVNGFEAEFQKSKSSFHLKKTSVHLSDSAVYFCALD
Peromyscus maniculatus bairdii V636 trav AYHN01153727.1 4689 ESNGDSMTQTECQVTLSEGTSLTVNCSYETKQYPALFWYVQHHGEGPQLLFRVSKANKKGSSTGFETTYDKGSTSFHLQKALVQESDSAVYYCALG
Peromyscus maniculatus bairdii V637 trav AYHN01153728.1 4474 ESLGEQLEQQPSTLNVGEGDSTIINCTYTGSGSSYFPWYKQEAGKSPHLVIVIFENVDRKQNQRLTILLDKKAKKLSLHITATQPGDSAIYFCAA
Peromyscus maniculatus bairdii V638 trav AYHN01153729.1 13979 VSSQQKVQQNPESLSVPEGAMASLNCTFSDSTSDYFGWYRQHSGKSPELLVSIISNGAKEEGRFTVHLNKASQHVSLHIRDSQPSDLAVYLCAVR
Peromyscus maniculatus bairdii V639 trav AYHN01153730.1 2527 KINADSVTQTEGQVTITEGKPVMMNCTFQTMYSGPVVFWYVQYLNKAPRLLLRSATDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V640 trav AYHN01153730.1 12368 VKGQQVDQSPVSLVLQEGERAELQCNFSTVLTSVRWFHQSPGGHLKSLFYNPSGTKKSGRLMCTTFTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V641 trdv AYHN01153730.1 22929 SNLGQKVTQVQSTTSTQEGEKVTLDCSYETRSKFYHLFWYKQLLSGEMIFLIRQFSSSTYSEWSSRYSVVFQKSTKSIRLVISASQLEDSVKYYCALWE
Peromyscus maniculatus bairdii V642 trav AYHN01153734.1 779 GVRGMQVEQNPPALSLQEGAGSSLRCNFSITMTNVQWFRQNSGGSLLSLFFMTPGTKENGRLKSTFNSKERYSTLHIRDAQLEDSGTYLCAAD
Peromyscus maniculatus bairdii V644 trav AYHN01154960.1 506 ESRGEQLEQQPSTLSVGEGDSAIINCTYTGSAFSYFPWYKQEAGKSPHLVIDIFENVDRKQNQRLTILLNKKAKKLSLHITATQPGDSAIYFCAA
Peromyscus maniculatus bairdii V645 trav AYHN01154962.1 2709 RTHGDSVTQTGGQVTISEGEFLTINCTYSITTTASPTLFWYVRYPGETLQLLLKAITAGEKESSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V646 trav AYHN01154962.1 5269 VAGKTQVEQSPKLLAVLEGENCVLQCNYTVSPAGNLRWYRQDTGRGLVSLAVMTYIENKKSNGRYSASLDADAKHSTLHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V647 trav AYHN01154965.1 1866 VSSQQTVQQNPESLSVLEGSMASLNCTFSDSTSDYFWWYRQHSGKSPKALMSIFSNGEKEEGRFTVNLNKASRHVSLHIRGSQPSDSAVYLCAV
Peromyscus maniculatus bairdii V648 trav AYHN01154968.1 1009 RSNGDSVTQTEVLVTVTEGLSVMINCTYQTTYSDSFLFWYVQYPNKAPRLLLRRATDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V649 igkv AYHN01155796.1 567 ARCDIQMTQSPSSLSASLRDRVTLTCRASQGISSNLIWLQQKMGKPPKRLIYRASNLADGVPSRFSGSGSGTDYFLSINSLESEDMGIYYCLQDAQFP
Peromyscus maniculatus bairdii V650 igkv AYHN01155800.1 328 ARCDIQMTQSPSSPSASRGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYRASNLEDGVPSRFSGSGSGTDYSLTISSLKPEDFATYYCQQHVSTP
Peromyscus maniculatus bairdii V651 igkv AYHN01155802.1 1609 ARCDIQMTQSPSSLSASLGDRVTITCRASQNINKYLRWFQQKPGKAPKRLIYAASNLADGVPSRFHGSGSGTDYSLTISSLESEDIATYYCLQTDKLP
Peromyscus maniculatus bairdii V652 igkv AYHN01155827.1 12126 ARCDIQMTQSPASLSASLGESVTITCQATQDLYGNLAWYQQKPSRPHKFLIYKANTLVDGVSSRFSGSGSGTQYSLKISSLQSEDAATYYCQNHYTTP
Peromyscus maniculatus bairdii V653 igkv AYHN01155828.1 13089 ARCDIQVTQSPSSLSASLGDRVTMTCKASENIDKYMAWYQQKPGEVPKLLIYSASTLQSGVPSRFSGSGSGTDFSFTISSLEPEDVATYYCQQHYSL
Peromyscus maniculatus bairdii V654 igkv AYHN01155828.1 17918 ASGDTVITQAENSILVTSEESVSISCRSSKSLLHSNGVTFLNWYLQRPGQSPKTLIYWGSNPLTGVPDRFGGSGAGTDFTLKISREGAEDVGVYYCQQLLEFP
Peromyscus maniculatus bairdii V655 trdv AYHN01155907.1 1056 SNLSQKVTQVQSTASTQEGEEVTLDCSYETSQNLYHLFWYKQLLSGEMIFLIRQISSSTRTERSSRYSVVFQKSTKSISLVISASQLEDSVKYYCALWE
Peromyscus maniculatus bairdii V656 trav AYHN01155907.1 10869 VSRGEQLEQQPSLLSVQEGDSAVINCTYTDTNYYFYWYRQEPEAGLQLLINVPSSVDRKEEQGLIVLPKKKDKHLSLNFTAAHPEDSATYFCAAS
Peromyscus maniculatus bairdii V657 trav AYHN01155909.1 4160 WVRQGEQVEQHPSTLRVQEGASAVINCTYTDSASYYFPWYKQGPGEHPQLVIDIRSTVERKQEQRLIVLQDKKAKYFSLHITDTRPGDSDMYFCAAS
Peromyscus maniculatus bairdii V658 trav AYHN01155909.1 5862 RSHGDSVTQTESLVTVSEGLPVMMNCTYQTTYSNTFLWWYVQYPYKAPRLLLRSATDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALR
Peromyscus maniculatus bairdii V659 trav AYHN01155910.1 3173 VNGQQVEQSPVSLVLQEGERAELQCNFSTSTNQMQWFHQSPEGHLKSLFYNPSGTKQSGRLKSTTVTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V660 ighv AYHN01156372.1 698 VQCEVHLVESGGGLVQPGKSLKLSCAASGFTFSDAWMNWVRQAPGKGLEWVAQIRNKANNYETNYVESVKGRFTISRDDSKSSLYLQMSSLRAEDTAIYYCTA
Peromyscus maniculatus bairdii V661 ighv AYHN01156372.1 6222 VHCQVQLQQSGPELGKPGSSVKLSCKASGYTFAYYYVHWVKQRPGQGLEWVGSIFPGTGYTDYNQKFKDKAKMTADKSSSTAYMNLNSLTPEDSAVYYCA
Peromyscus maniculatus bairdii V662 ighv AYHN01156376.1 8656 VHCQVQLQQSGPGLGKPGDTVKLSCKASGYTFTDHYIDWVKQRLGQGLEFIGNIYPGNGGTDYNQKFKDKAKLTADTSSSTAYMELSSLTSEDSAVYYCGR
Peromyscus maniculatus bairdii V663 ighv AYHN01156377.1 5581 VHSQVQLQQSGPELKKPGSSVKLSCKASGYTFTNYLMHWVKQRLGQGLEFIGNIYPGNGGTDYNQKFKGKAKLTADTSSSTAYMELSSLTSEDSAVYYCGR
Peromyscus maniculatus bairdii V664 ighv AYHN01156378.1 9947 IQCEVQLVESGGGLVRPGQSLKLSCTASGFTFSNYWMNWVRQAPGEGLEWVAQIRNKAYNYATYYAESVKGRFTISRDDSKSSLYLQMSSLRAEDTAIYFCT
Peromyscus maniculatus bairdii V665 ighv AYHN01156378.1 27876 VQSEVQLVESGGGLVQPEKSLKLSCAASGFTFSNAWMNWVRQAPGKGLECVAEIRNKANNYATHYAESVKGRFTISRDDSKSSLYLQMNSLRAEDTAIYFCT
Peromyscus maniculatus bairdii V666 igkv AYHN01156703.1 23653 SGGRCDIQVTQSPAFLSSSLGDSISITCRASENIYSNLAWYQQKPGKPPKLLIYNANSLEDGVPSRFNGSGSGTQYSLKISSLQPEDFATYYCQQYQST
Peromyscus maniculatus bairdii V667 igkv AYHN01156703.1 29901 SRGDVVMTQTPTSLLVSLGEQASITCRSSQSLVHSSGNTYLNWYLQRPGQSIQSLIYRISNQFSGVSDRISGSGSVTDFTLKISRVESEDLGVYYCMQR
Peromyscus maniculatus bairdii V668 igkv AYHN01156704.1 3971 SRGDVVMTQTPTSLFVSLGEQASITCRSSQSLVHSSGNTYLNWYLQRPGQSIQSLIYKVSNHFTGVSDRISGSGSVTDFTLKISRVESEDLGVYYCMQR
Peromyscus maniculatus bairdii V669 igkv AYHN01156710.1 6029 VRSDIQMTQSPSSLSTSLGESVTMTCRASQDIGGWLAWYQQKPGNPPRLLIYSTSTLADGVPSRFSGSGSGTQFSLKINGLQHEDMATYYCQQVSSSP
Peromyscus maniculatus bairdii V670 igkv AYHN01156711.1 3164 VRSDIQMTQSPSSLSTSLGESVTMTCRASQDIGGWLAWYQQKPGNSPKLLIYATNSLAGGVPSRFSGSGSGTQYSLKINGLQHEDVATYYCQQGKSYP
Peromyscus maniculatus bairdii V671 igkv AYHN01156712.1 5129 VRCDIQMTQSPASLSVSLGESVTMTCQASQDIGTLLAWYQQKPGKPPQLLIYYANSLADGVPSRFSGSGSGTQYSLKINGLQPEDVATYYCQQGKSYP
Peromyscus maniculatus bairdii V673 trav AYHN01156986.1 1668 VKGQQVEQSPVSLVLQEGERAELQCNFSTVLTTVQWFHQSPGGHLKSLFSNPSGTKKSGRLMSTTLTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V674 igkv AYHN01156999.1 1682 ASGDIVMTQPTVTSPVSLGESTSISCRSSKSLLYSDGITYLYWYLQRPGQSPQLLIYQMSNLAPGVPNRFSGSGSGTDFTLKISRVEAEDVGVYYCQQWLELP
Peromyscus maniculatus bairdii V675 igkv AYHN01157003.1 593 TRCDIQMTQTPNFLSASLGDRVTITCRASQDIGYALNWYQQKPGKAPQLLIYDAGSLADGVSSRFSGSGSGSDYSLTISSLEPEDFATYYCQQDYDTP
Peromyscus maniculatus bairdii V677 igkv AYHN01157859.1 2442 SRVDIVLTQSPATLSVTPGERVTMTCKASQDIGNYLHWYQQKPSEAPRLLIKYASQSISGIPSRFSGSWSGTDFTLSINTVEPEDVATYYCQQGYNWP
Peromyscus maniculatus bairdii V678 igkv AYHN01157862.1 1061 AYGNIVMTQSPKSLPVSVEDKATMSCKSSQNVGTSIAWYQQKPGQAPTLLIYSASTQYTGVPDGFTGSGSGTDFTLTISSVQGEDLADYYCQQGYGKKR
Peromyscus maniculatus bairdii V679 igkv AYHN01157866.1 829 ACADILMTQSPSSLAVSAGEKVTISCRSSQSLYSSNTKKNYLNWYQQKPGQAPKLLIYLASTRNTGVPDRFTGSGSGTGFTLTISSVQAEDLADYYCQQHYGAP
Peromyscus maniculatus bairdii V680 igkv AYHN01157947.1 803 ACADIVMTQSPSSLAVSAGEKVTISCKSSQSLLYNNKNRLAWYQQKPGQAPKLLIYLASTRYTGVPDRFTGSGSGTDFTLTISSVQAEDLADYYCQQYRSNP
Peromyscus maniculatus bairdii V681 trav AYHN01158652.1 724 VSQGEQVEQHPSTLRVQEGASAVINCTYTDSTSYYFPWYKQGPGEHPQLIIDIRSTVERKQEQRLIVLQDKKAKHFSLHITDSRPGDSAMYFCAAS
Peromyscus maniculatus bairdii V682 trav AYHN01158652.1 2444 RSKGDSVTQTEGLVTVTEGLPVMMNCTYQTTYSNTFLFWYVQYSNKAPRLLLRSATDNQRTEHQGFQATLQKSSSSFPLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V683 trav AYHN01158655.1 216 VKGQQVEQSPVSLVLQEGEHAELQCNFSTTLYQMQWFYQSPGGHLISLFSNPSGTKQSGRLKSTTVTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V684 trdv AYHN01158657.1 6399 SNLGQKLTQVRSTTSTQEGEEVTLDCSYETRSKFYYLFWYKQLLSGEMIFLIRQISSSTRTEKSSRYSVVFQESSKSISLVISASQIEDSVKYYCALWEQ
Peromyscus maniculatus bairdii V685 trav AYHN01158657.1 22954 GVRQGEQVEQHPSTLRVQEGASADINCTYTDSTLSYFPWYKQGPGEHPQLIIDIRSTVERKQEQRLIVLQDKKAKHFSLHITDTRLEDSAMYFCAAS
Peromyscus maniculatus bairdii V686 trav AYHN01158657.1 24626 RSNGDSVTQTEGLVTVTEGLPVMMNCTYQTTYSPFLFWYVQYPNKAPRLLLKSATDNQRTEHQGFQATLQKSSSSFPLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V688 igkv AYHN01158917.1 5214 SRSDIVMTQSPATLSVTQEDRVTMTCKASQGISEYLHWYQQKPNELPRLFIKIASQSISGIPSRFSGSGSGTDFTLSINNVESEDAASYYCQQGQSFP
Peromyscus maniculatus bairdii V689 igkv AYHN01158920.1 2426 ARCDIQMTQSPASLSTSLGESVTITCLASEDIYSVLHWYQQKPREPPKLLIYNAKNLAEGIPLRFSGSESGTQYSLKVSSLQSEDIATYYCQQGRSF
Peromyscus maniculatus bairdii V690 igkv AYHN01158920.1 13659 SNGQVVLTQSPASMAASQGERVTMTCSASSSVNTNYLHWYQQKPGASPKLLIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAAIYHCQQWSNNQ
Peromyscus maniculatus bairdii V691 igkv AYHN01159023.1 378 ARCDIQVTQSPSSLSASLGDRVTINCLASQGISNELNWYQQKSGQAPTLLIYYATSLQSGVPSRFSGQYSGKSFTLTISNLEPEDVGTYFCLQHYSVP
Peromyscus maniculatus bairdii V692 igkv AYHN01159029.1 113 ARCDIQMTQSPSSLSASLGDRVTLTCQASQGISNYLNWYQQKPGKSPKLLIYGASNREEGIPSRFSGSGSGTDYSLTIDSLESEDIATYYCQQGYDTP
Peromyscus maniculatus bairdii V693 trav AYHN01159072.1 1005 VNRQVGEENTWVLSIQEGENVTMNCSYKTSITVLQWYRQESGRGPAMLILIRSNEREKYSGRLRVTLGTSTQSSSLSITAAQAADTAVYFCARD
Peromyscus maniculatus bairdii V694 trav AYHN01159077.1 6268 DVQAQSVTQPDAHVTVFEGDSVELRCNYSYSGALYLFWYMQHHGQGLQLLLRYFSGDPVVHGVNGFEAEFQKSKSSFHLKKTSVHLSDSAVYFCALS
Peromyscus maniculatus bairdii V695 trav AYHN01159077.1 14509 KINADSVTQTEGQVTITEGMPVMMKCTYQTTYSIPTLFWYVQYPNEAPQLLLKSFTDNQRTEHQLFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V696 trav AYHN01159228.1 2606 GVIGMQVEQNPPALSLEEGAGSSLKCNFSTTMTTVQWFRQNPGGSLLSLFFMTPGTKENGRLKSTFNSKERYSTLHIRDAQLEDSGTYLCAAE
Peromyscus maniculatus bairdii V697 trav AYHN01159228.1 7929 ESRGERVEQHPSTLRVQEGDSAVINCTYTESLSVYFPWYKQEPGKYPQFIIDIRSNSERKQNQRLILLLDKKAKHLSLHITATQLADSAIYFCAAD
Peromyscus maniculatus bairdii V698 trav AYHN01159228.1 10490 RTQGDSVTQKQGQVTLSEDDVLFINCTYSATGYPTLFWYVQYPGEGPELLLKVTTANNKGSSQGFEATYDKGSTSFHLQKAMVKESDSAVYYCALG
Peromyscus maniculatus bairdii V699 trav AYHN01159229.1 700 DVQAQSVTQPDAHVTVFEGDSVELRCNYSYGGALYLFWYMQHRGQGLQLLLKYISGDPVVHGVNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCVLS
Peromyscus maniculatus bairdii V700 trav AYHN01159229.1 6668 ESNRDSVTQTEGRVTLSEGTSLTVNCSYETKQYPVLFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDKGSTSFHLQKASIQESDSAVYYCALSDIV
Peromyscus maniculatus bairdii V701 trav AYHN01159230.1 8227 RTHGNSVTQRGGQVTISEGGFLTINCTYSITTLASPALFWYVRYPGETLQLLLKVLTAGEKGSSRGFEATHDKGSTSFHLQKASVQESDSAVYYCALH
Peromyscus maniculatus bairdii V702 trav AYHN01159230.1 10785 VAGKTQLAQIPKLLAVLEGENYILHCNYTVSPAGNLRWYRQDTGRGLVPLAVMTYTENKKSNGRYSASLDADAKHSTLHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V703 trav AYHN01159233.1 527 VIHGEQVEQHPSTLRVQEGASAVINCTYTDSTLSYFPWYKQGPGEHPQLVIDIRSTVERKQEQRLIVLQDKKAKHLSLHITDTRPGDSAMYFCAAS
Peromyscus maniculatus bairdii V704 trav AYHN01159233.1 2445 KINADSVTQTEDLVTVTEGMPVMMNCTYQTTYSNTFLFWYVHYLNKGPRLLLRSATDNQRTEHQGFQATLQKSSSSFPLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V705 trav AYHN01159233.1 12502 VKGQQVKQSPVSLVLQEGERAEMQCNFSTVLSSVQWFHQSPGGHLKSLFYNPSGTKKSGRLMSTTVTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V706 trdv AYHN01159235.1 4708 SNLGQKVTQVQSTASTQEGEEVTLDCSYETSQNLYHLFWYKQLLSGEMIFLIRQISSSTRTERSSRYSVVFQKSTKSIRLVISASQLEDSVKYFCVLWEQ
Peromyscus maniculatus bairdii V707 trav AYHN01159235.1 16007 VSRGEQLEQHPSLLSVQEGDSAVINCTYTDTNYYFYWYKQEPGAGLQLLINVPSSVDRKEEQGLIVILKKKDKQLSLNFTAAHPEDSATYFCAAS
Peromyscus maniculatus bairdii V708 ighv AYHN01159701.1 13824 VLSQVQLQESGPGLLKPSQSLSLTCTVTGDSISSGSWWTWIRQHPEKGLEWMGEIYSDGDTNYNPSLKSRVTMTVDTSKNQFSLRLSSVTTVDTAVYYCAR
Peromyscus maniculatus bairdii V709 ighv AYHN01159702.1 8592 IQCEVQLVESGGGLVQPGDSLKLSCAASGFTFSDYYMYWLRQAPGKELEWIAVSRSKANSYTTEYSASVKGRFTISRDDSKNTLYLQMNSLKAEDTATYYCAR
Peromyscus maniculatus bairdii V710 ighv AYHN01159704.1 2230 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYTVHWVRQPPGKGLEWIGRIWSDGDTDYNSALKSRLTISRDTSKSQVFLKLNNLQTEDTAMYYCAR
Peromyscus maniculatus bairdii V711 ighv AYHN01159704.1 23623 FSVCRCPVCGGVWRRLSAARKVPETLLCSLWIHLRNYGMHWVRQAPGKGLEWFTYTNGDSSYIQYADAMKGRFTISRENPKNTLYLEMSSLSSEDTAMYYCTR
Peromyscus maniculatus bairdii V712 ighv AYHN01159704.1 37959 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTGYHVHWVRQPPGKGLQWMGAMWNHGGTEYNSALKSRLTISRDTSKSQVFLKLNNLQTEDTATYYCAR
Peromyscus maniculatus bairdii V713 igkv AYHN01159983.1 1768 IFGDILMAQSPSSLTVSAGEKVTISCKSSQSLFGSNSKKNHLAWYQHKPGQAPKRLISWASTLDTGVPDRFTGSGSGTDFTLTISSVQVEDLADYYCMQ
Peromyscus maniculatus bairdii V714 igkv AYHN01159985.1 437 ICGDILMTQSPSSLAVSAGEKVTISCKSSQSLFGSTSKKNRLIWLQQKPGQAPKLLIYYASTQDTGVPDRFIGSGSGTEYTLTISSVQAEDVADYYCMQEHTTP
Peromyscus maniculatus bairdii V715 trav AYHN01161623.1 640 ESRGEQVEQHPSTLSVQEGDSAAINCTYTDSASAYFPWYKQEPGKHPQVIIDIRSNAERKQEQRLILLLDKKAKHLSLHITATQPADSAMYFCAAD
Peromyscus maniculatus bairdii V716 trav AYHN01161626.1 4570 DVQAQSVTQPDAHVTVFEGDSVELRCNYSYGGALYLFWYMQHRGQGLQLLLKYISGDPVVHGVNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCALS
Peromyscus maniculatus bairdii V717 igkv AYHN01162523.1 2877 ARCDIQMTQSPSSLSASLGDRVTITCRASQDISYALNWFQQKPGKAPQLLIYGAGGLAEGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCLQVYRNP
Peromyscus maniculatus bairdii V718 igkv AYHN01162659.1 1329 ACADIVMTQSPSSLAVSAGEKVTISCKSSHSLIFSSNHYLAWYQQKPGQAPKLLIYLASTRYTGVPDRFTGSGSGTYYTLTISSVQAEDLADYYCQQYRSDP
Peromyscus maniculatus bairdii V720 trav AYHN01168990.1 6099 VSSQQKVQQNQESLSVPEGAIVSLNCTYSDQNSQYFWWYRQQPGKSPKALMSIFSNGEKEEGRFTVHLNKASRHVSLHIRDSQPSDSAVYFCAV
Peromyscus maniculatus bairdii V721 trav AYHN01168993.1 836 GVRGMQVEQNPPALTLQEGAGSAMRCNFSTTTRSVQWFRQNPGGSLLSLFFMTPGTKENGRLKSTFDSKESYSTLHIRDAQLEDSGTYLCAAD
Peromyscus maniculatus bairdii V722 trav AYHN01168993.1 6051 ESRGEQVEQHPSTLSVQEGASAVINCTYSGSASVYFPWYKQEPGKHPQFIIDIRPSAERKQNQRLTLLLDKKAKHLSLHITATQPADSAIYICAAD
Peromyscus maniculatus bairdii V723 igkv AYHN01175453.1 1254 ARCDIQMTQSPTSLSASLGDRVTITCRASQDINKYLRWFQQKPGKAPKLLISRASNLADGVPSRFSGSGSGTDYSLTISSLESEDIATYYCLQYDKLP
Peromyscus maniculatus bairdii V724 trav AYHN01175883.1 5261 VSSQQKVQQNPESLSVPEGAMASLNCTFSDSTSDYFGWYRQHSGKSPELLVSIISNGAKEEGRFTVHLNKASQHVSLHIRDSQPSDLAVYLCAVR
Peromyscus maniculatus bairdii V725 iglv AYHN01176371.1 3341 SYAQYVLTQPNSVSGNLGSTVTITCLRSSGSIGNYYVYWYQQHFGSSPTAVIYEDDKRPSGVPDRFLGSIDSSSNSASLTITDLQIEDEADYYCQSS
Peromyscus maniculatus bairdii V726 iglv AYHN01176372.1 13111 SLSQLMVTQSPSASASLGASVKITCTLSSQHSGYTIGWYQQHPDKAPKYVMQLKSDGSYSKGDGIPDSFSGSSSGADRYLSISNTQPEDEADYICGVCD
Peromyscus maniculatus bairdii V727 igkv AYHN01176653.1 1655 ACADIVMTQSPSSLAVSIGEKVTISCRSSESLYLSSNLKNHLVWYQQKPGQAPKLLIYLASTQDTGVPDRFIASGSETDFTLTISSVQAEDLADYYCQQ
Peromyscus maniculatus bairdii V728 igkv AYHN01176653.1 9166 TSGDVVLTQTPLSLPVTIGQSASISCRSSQSLLYSDGITYLYWFLQRPGQSPKRLIYWVYNRGTGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQT
Peromyscus maniculatus bairdii V730 trav AYHN01177159.1 1557 VKGEQVKQSPVSLVLQEGERAELQCNFSTVLSSVQWFHQSPGGHLKSLFYNPSGTKKSGRLMSTTVAQERHSSLYISSSQTTDSGTYFCARSAQCS
Peromyscus maniculatus bairdii V731 igkv AYHN01185074.1 127 SNGQIVLTQSPAFIAASQGERVTLPCIASSSVRTSYLHWYQQKPGASPKPLIYETSNLASGVPAHFSGSGSGTSYSLTISSMEAEDAATYYCQQYSNYQ
Peromyscus maniculatus bairdii V732 igkv AYHN01185925.1 3388 STGDIVMTQSPASLAVSPGQIATISCRSSQGVITAGIHLMNWYQQKPGQSPKLFIYDASKVASGVPARFSGSGSGTDFTFTIHLVEADDVATYYCQQGLELP
Peromyscus maniculatus bairdii V733 igkv AYHN01188121.1 3468 MICDIQMTQSPSLAASLGDRVTINCRASEGIGNLLAWYQQKPGSSPRLLTYHTANTESVVFAKYSGSGSGTDFTLIISTMEPEDVATYYCQQYKSTP
Peromyscus maniculatus bairdii V736 ighv AYHN01189890.1 8700 ILSQVQLQESGPGLVKPSQSLSLTCSVTGDSITSNSWNWIRQSPGKKLEWMGYINNAGNTGYNPSLKSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V739 igkv AYHN01194575.1 2686 ARCDIQMTQSPASLSVSLKESVTMTCQASQNIGNALAWYQQKPGGPPKLLIYNANSLENGVPSRFSGSRSGTQFSLKISSLQPEDVAIYYCQQYYDYP
Peromyscus maniculatus bairdii V740 igkv AYHN01194740.1 850 SAGDIVLTQTPPSLTVSLGQRATMSCRSSQSVTIRTFHFMHWYQQKPGQPPKLLIYGASNLESGVPARFSGSRSGTDFTLTINPVEADDAATYYCQQSRELP
Peromyscus maniculatus bairdii V743 iglv AYHN01196843.1 7884 AISQTVVTQESSLTTSPGGTVTLTCGSSTGTVTTSNYATWVQEKSYQIHTGLIGGTNYRGPGVPARFTGSVLGDKAALTIAGAQPEDEAVYYCALLYSSQF
Peromyscus maniculatus bairdii V745 trdv AYHN01197640.1 1573 SNFGQKVTQVLSSTSTRDGESVTLDCSYETSWKYYYLFWYKQLLSGEMIFLIRQFSSSTQTEKSSGYSVVFQESAKSIRLVISASQLEDSVKYFCALWE
Peromyscus maniculatus bairdii V746 trdv AYHN01197822.1 1851 SNLGQKVTQVQPTASTQEGEEVTLDCSYETRSDIYFLFWYKQLLNGEMIVLNRQLSSSTQTEKSSRYSVVFQESTNSIRLVISASQLEDSVKYYCALW
Peromyscus maniculatus bairdii V747 trav AYHN01197939.1 871 ESNGNSVTQTEGRVTLSEGTSLTVNCSYETKQYPVLFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V749 igkv AYHN01202264.1 792 ARCDIQVTQSPSSLSASIGDRVTITCLASQGISNNLNWYQQKSGQAPTLLIYYATSLQSGVPSRFSGQYSGKSFTLTISNLEPEDVATYYCLQHYNAP
Peromyscus maniculatus bairdii V819 ighv AYHN01016996.1 61089 FLSQMQLQESGPGLVKPSQSLFLTCSVTGFSITSGYYWIWMRQSPGKNLDWMGYITHSGETVYNPSLKSSVSITRETSKNQFFLQLNSVTTEDTATYYCAG
Peromyscus maniculatus bairdii V1077 trdv AYHN01092081.1 4282 KDVLCITLIQSSPNRTVASGSAVTLLCTYDGYNRNPDLFWYRKRQDLTLQFILYRDDTRFYDSDFAQGRFSVKHSKVYRTFHLVISPVTLEDSATYFCASG
Peromyscus maniculatus bairdii V1086 igkv AYHN01093142.1 23718 TTVTQSLEFLSTATGEKVTITCRTSTDTDDDMNWYQQKSGEAPKLLFSEGNTRISGVPPRFTSSGYGTDFTMTIDGVQSEDAGIYFCQQNGNTP
Peromyscus maniculatus bairdii V1087 igkv AYHN01093142.1 9327 ARCDIQMTQSPSSLSASLGDRVTITCKASQGISNYLSWFQQKPGKAPKRLIYGASTLADGVPSRFSGSGSGTDYSLSISNLESEDIATYYCLQYAQYP
Peromyscus maniculatus bairdii V1088 trgv AYHN01093391.1 31113 GLGQLEPIEISVTRAVSQSAQISCKVSLEGFDKVDIHWYRQKTNQPFEYLIYVRNDNTHRPLEGISKKIEAKKDLRTSTATLIINSLKKEDEAIYYCALWV
Peromyscus maniculatus bairdii V1089 trgv AYHN01093392.1 21842 GQTSSNLEERIMSITRPMGSSVIITCDIQKTNNYIHWYQFQEGKAPRYLLYYNFVSSKTVVDAELSSEKYHVYEGTDKTYKFVLRNVEESDSGVYYCASWV
Peromyscus maniculatus bairdii V1090 trgv AYHN01093392.1 13512 GLGKLEQPEISISRTTDKSVQISCKASINSFKSVAIHWYRQKPNQGLEFLLYVIATPTHILLDEKHKKMEASKNSSASTSTLTIYSLEEDDEAIYYCSYG
Peromyscus maniculatus bairdii V1091 trgv AYHN01093392.1 7766 TGGSIPTSHLMSYIIKKKGNTALLECQIKTSILIPNTYIHWYQQKPGQPLKRMLYISSEENVVYDKGFSAGRYEAKRWQSELSSILRIYQVTEEDTGTYYCACWD
Peromyscus maniculatus bairdii V1092 trgv AYHN01093392.1 5448 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYQLKEGEPLKRIFYGSAKAYKQDKPNSRLETDEKNDGTFYLIINNVITADEATYYCACWD
Peromyscus maniculatus bairdii V1115 trav AYHN01105227.1 32893 AFAGLQGSKFFQMSPPHVVVERGENVKLICKVLLSTSQGCSWLFQKRGDVLAPTFLIYLSSTRKKSNDNLNSNQISGEKNGDEYTLTLSKFSEENQGYYFCS
Peromyscus maniculatus bairdii V1147 igkv AYHN01118834.1 29364 SSGQIVLTQSPASMATSQGERVTMTCSASSSISSSYLNWYQQKPGASPALLVYGTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSYP
Peromyscus maniculatus bairdii V1148 igkv AYHN01118858.1 2333 SNGQIVLTQSPAFMAASQGERVIMTCSASSSVSTSYLHWYQQKPGASPKLLFYGTSNLASGVPTRFIGSGSGTSYSLTISSMEAEDAATYYCQLYNTNQ
Peromyscus maniculatus bairdii V1149 igkv AYHN01118865.1 4101 SNGQIVLTQSPASMAASQGERVTMTCSASSSVSTSYLHWYQQKPGASPKLLIYSTSTLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQVHNSP
Peromyscus maniculatus bairdii V1151 trav AYHN01119570.1 648 GVRGMQVEQNPPALTLQEGAGSALRCNFSTTMRSVQWFRQNPRGSLVNLFSLTPGTKENGRLKSTFNSKERYSTLHIRDAQLEDSGTYLCAAE
Peromyscus maniculatus bairdii V1152 trav AYHN01119573.1 34655 TWSLAKTTQPLSMDSYEGQEVNVSCSHTNIATNEYISWYRQVPHQGPQFIIQGYKVHVANEVASLFISADRKFSTLSLPQVSLRDTAVYYCIMA
Peromyscus maniculatus bairdii V1153 trav AYHN01119573.1 28484 VSRGEQLEQQPSLLSVQEGDSAVINCTYTASSPSYFSWYKQEPGAGLQLLINVFSNVDRKEEQGLIVLLKKKDKQLSLNFTAAHPEDSATYYCAAS
Peromyscus maniculatus bairdii V1154 trav AYHN01119573.1 18605 GVRGMQVEQNPPALSLQEGAGSALKCNFSTTMMRVQWFRQNPRGSLVNLFSLTSGTKENGRLKSTFDSMERYSTLHIRDAQLEDSGTYLCAVQ
Peromyscus maniculatus bairdii V1155 trav AYHN01119573.1 1658 RTCGDSVTQKQGQVTLSEDDFLFINCTYSTTSYPTLFWYVQYPGEGPELLLKVEAANNKESSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALS
Peromyscus maniculatus bairdii V1156 trav AYHN01119586.1 13740 ASGQGVEQPAEWMSLEGTSAQVNCTYSTSGFNGLSWYRQHEGQAPEFLSYDVLDGLKDSGRFSTFLSRSERYSYLLLTELQIKDSASYLCAVR
Peromyscus maniculatus bairdii V1181 igkv AYHN01129984.1 3709 MICDIQMTQSPSLSASLGDRVTITCRASESIRNGLAWYQQKPDNSPKLLIYLATNLQSGIPSRFSGSGSGTDFTLTISTLQSEDVATYYCQQYWSTP
Peromyscus maniculatus bairdii V1182 igkv AYHN01129988.1 12328 ARCDIQMTQSPASLSVSLKESVTMTCQASQNIGNALAWYQQKPGGPPKLLIYNANSLENGVPSRFSGSRSGTQFSLKISSLQPEDVAIYYCQQYYDYP
Peromyscus maniculatus bairdii V1183 igkv AYHN01129993.1 3596 MICDIQMTQSPSLAASLGDRVTINCRASEGIGNLLAWYQQKPGSSPRLLTYHTANTESVVFAKYSGSGSGTDFTLIISTMEPEDVATYYCQQYKSTP
Peromyscus maniculatus bairdii V1184 igkv AYHN01129999.1 3663 ARCDIQMTQSPSSLSASLGESVTMTCQASQNIYSNLAWYQQKPGGPPKLLIYDANNLQDGVPSRFSGSRSGTQFSLKISSLQSEDVANYYCQQYNNLP
Peromyscus maniculatus bairdii V1185 igkv AYHN01130006.1 12746 ARCDIQMTQSPASLSASLGESVTMTCQASQNIYNALAWYQQKPGGPPKLLIYSANSLENGVPSRFSGSGTGTQYSLKISSLQPEDVAIYYCQQYSNLP
Peromyscus maniculatus bairdii V1186 igkv AYHN01130006.1 3108 VRCDIQMTQSPSSLSASLGETVTMTCQASQNIYSSLAWYQQKPGNPPKLLIYEANSLEDGVPSRFSGSGTGTQYSLKISSLQPEDVAIYYCQQYIDIP
Peromyscus maniculatus bairdii V1187 igkv AYHN01130010.1 2547 SRSDVVMTQTPVSLSVSLGDQVSISCRSSQSLVGSYGDTYLYWCLHKPGQPPKALIYEVSNRYSGVPDRFSGSGSGTDFTLKISRVEPEDLGIYYCMQY
Peromyscus maniculatus bairdii V1188 igkv AYHN01130012.1 1112 ARCDIQMTQSPATLSASLGESVTMTCQASQNIYSNLAWYQQKPGERPQVLTSSLADGVPSRFSGSGSGTQFSLKISSLQSEDVATYYCQQHSNLP
Peromyscus maniculatus bairdii V1189 igkv AYHN01130020.1 1624 SRGDVVVTQTPTSLPVSLGDQAFISCRSSQSLVHGDGNTYLYWCLQRPGQSPKPLIYRASYRYSGVPDRFSGSGSGTDFTLKISRVEPEDLGIYYCMEY
Peromyscus maniculatus bairdii V1190 igkv AYHN01130023.1 5672 SSGQIFLTQSPLSLAASQGETVTITCSASSSISSNYLHWYQQKPGASPKLMVYRTSYLTPGVPTRFSGSESGTSYYLKISNMKLEDVATYYCAQGSSRP
Peromyscus maniculatus bairdii V1191 igkv AYHN01130032.1 8089 ARCNIQMTQSPSTLSVSLGERITITCRASQDVSKYMAWYQQKPGEVPKLLIDDASTLQSGVPTRFSGSGSGTDYSFTISSLEPEDVATYYCQQGANL
Peromyscus maniculatus bairdii V1210 igkv AYHN01135775.1 4886 ACADIVMTQSPSSLAVSGGEKVTISCKSSQSLLYNNKNYLAWYQQKPGQSPKLLIYLASTRYTGVPDRFTGSGSGTDFTLTISSVQPEDLEDYYCQQ
Peromyscus maniculatus bairdii V1211 igkv AYHN01135777.1 1272 ACADIVMTQSPSSLAGEKVTISCKSSQSLLYNNKNYLAWYQQKPGHAPKLLIYWASTQYTGVPDRFTGSGSGTDFTLTISSVQPEDLADYYCQQYDSTP
Peromyscus maniculatus bairdii V1212 igkv AYHN01135781.1 2206 ICGDIVMTQSPSSLAVSAGEKVTITCKSSQSLLGSSSKKNHLIWLQQKPGQAPKCLIYWGSTQNPGVPDRFTGSGSGTDYTLTISSVQAEDLADYYCVQDYDFP
Peromyscus maniculatus bairdii V1222 igkv AYHN01139297.1 1259 SKCDIQMTQSPSQTVSLGDTITINCQASQSIGASLAWYQQKPGNSPKLLIYDASSLHAGVPSRFSGSGYGKDFTLTISSLKPEDIGTYYCQHYSSY
Peromyscus maniculatus bairdii V1223 igkv AYHN01139316.1 430 SRGDVVMTQTPSSLPVSLGDEASISCKSSQSLEDSDGDTYLEWYLQKPGKSPQLLIYEISNRFSGVPDRFSGRGSDTEFTLKISRVEPEDLGVYYCFQS
Peromyscus maniculatus bairdii V1224 igkv AYHN01139325.1 1760 ARCDIQMTQSPSSLSASLGDRVTITCRASQNINSYLHWYQQKPGKAPQLLIYKASNLADGVPSRFSGSGSGTDYSLTIGSLESEDIATYYCQQGYNP
Peromyscus maniculatus bairdii V1225 trdv AYHN01139532.1 16815 SNFGQKVTQVQSTASTREGESVTLDCSYETSWKYYYLFWYKQLLSGEMIFLIHQISSSTHTEKSSRYSVVFQESAKSISLVISASQLEDSVKYFCVLWEW
Peromyscus maniculatus bairdii V1226 trav AYHN01139534.1 15838 EVQAQSVTQPDAHVTVFEGDSVELRCNYSYSGTPYLFWYKQNHGQGLQLLLRYFSGDPVVHGVNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCVVS
Peromyscus maniculatus bairdii V1227 trav AYHN01139543.1 2851 GVRGMQVEENPPALSLQEGAGSALRCNFSTTMMRVQWFRQNPRGSLVNLFFLNSGTKENGRLKSTFDSKERYSTLHIRDAQLEDSGTYLCAAE
Peromyscus maniculatus bairdii V1228 trav AYHN01139546.1 1692 GVRGMQVEQNPPALSFQEGAGSSLTCNFSTTMTTVQWFRQNPGSSLLRLFFMTPGTKENGRLKSTFNSKERYSTLHIKDAHLEDSGTYLCAAE
Peromyscus maniculatus bairdii V1229 trav AYHN01139549.1 14784 RTHGNSVTQTGGQVTISEGGFLTINCMYSITTIASPALFWYVQYPGESLQLLLKVLTAGSKGSSRGFEATHDKGSTSFHLEKASVQESDSAVYYCALS
Peromyscus maniculatus bairdii V1230 trav AYHN01139549.1 12221 VAGKTQLAQIPKLLAVLEGENCVLHCNYTVSPAGNLRWYRQDTGRGLVSLAVMTYIENKKSNGRYSASLDADGKHSTLHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V1231 trdv AYHN01139549.1 3697 SNFGQKVTQVQSTASTQEGVSVTLDCSYETSWKYYSLFWYKQILSGEMIFLIHQISSTHTEKSSRYSVVFQESAKSISLVISASQPEDSVKYYCALWE
Peromyscus maniculatus bairdii V1232 trav AYHN01139550.1 1204 ESRGEQLEQQPSTLSVGEGDSDIINCTYTGSGSSYFPWYKQEAGKSPHLVIDIFENVDRKQNQRLTILLDKKAKKLSLHITATQPGDSAIYFCAA
Peromyscus maniculatus bairdii V1233 trav AYHN01139554.1 299 ESNGDSVTQTEGRVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEAPQLLFRVSKANEKGSSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V1234 trav AYHN01139556.1 12439 GVRGMQVEQSPPALSLHEGAGSSLRCDFSTTMTTVQWFRQNPGGSLLRLFFMASGTKENENGRFKSTFDSKERYSTLHIRDAQLDDSGTYLCAAD
Peromyscus maniculatus bairdii V1235 trav AYHN01139556.1 9476 RTQGDSVTQKQGQVTLSEDDVLFINCTYSATGYPTLFWYVQYPGEGPELLLKVTTANNKGSSQGFEATYDKGSTSFHLQKAMVKESDSAVYYCALS
Peromyscus maniculatus bairdii V1236 trav AYHN01139556.1 2464 VNSQVGEENAWVLSIQEGENVTMNCSYKTTITVLQWYRQESGRGPAMLILIRSNEREKRSGRLRATLDTSTQSSSLSITAAQAADTAVYFCATD
Peromyscus maniculatus bairdii V1239 trav AYHN01140377.1 19085 VIHGEQVEQHPSALRVQEGASAVINCTYTDSTLSYFPWYKQGPGEHPQLIIDIRSTVERKQEQRLIILQDKKAKHFSLHITDTQPGDSVMYFCAAS
Peromyscus maniculatus bairdii V1249 trbv AYHN01144356.1 21746 SVFSVLVNQKPKQDICQSGTSLKIQCVVDSQLAAMFWYQQFQGQSLVLMATANQGSEATYEKGFTKDKFPISRPNLTFSTLTVSNVRPEDSSFYFCSSG
Peromyscus maniculatus bairdii V1250 trbv AYHN01144358.1 18869 SVEAQVTQTPRYLITETGKKLIINCSQNRNHDSMFWYRQDLGLGLKLIYYSVNVGIIDKGEVSDGYIVSRKEKATFPLTLESTTTSQTSLYFCASS
Peromyscus maniculatus bairdii V1251 trbv AYHN01144358.1 15564 LVNMEVTQTPRYLVKRTGEEALLECVQDMDHERMYWYRQDPGLGLRLIYLSYDANSNSEGDIPAGYKVSRKKRESFSLILESAKTNQTSVYFCASSI
Peromyscus maniculatus bairdii V1252 trbv AYHN01144358.1 9994 SVLSVLVNQKPKQDICQSGTSLKIQCVVDSPVAAMFWYQQFQGQSLVLMATANQGSEATYEKGFTKDKFPISFPNLTFSTLTVSNVRPEDSSFYFCSSG
Peromyscus maniculatus bairdii V1253 trbv AYHN01144359.1 12600 SFNAKVIQTPRFLVKEKERKAKMSCYPEKGHAVVFWYQQNKNNAFTFLISFQNQEVLQQTDMVKKRFLAECPSNSPCSLEIQSSEAGDSALYLCASSL
Peromyscus maniculatus bairdii V1254 trbv AYHN01144360.1 15377 SADTEVIQNPRYLVKGKEQKAKMDCIPIKGHSYVYWYYKKLGEELKFLVYFQNADIIDKTDMIDKHISARCPTGSPCTIEIQSSEPTDSAVYFCASSQ
Peromyscus maniculatus bairdii V1255 trbv AYHN01144360.1 10270 SLDGQVIQTPQHLFKGKGQKAKMSCSPESGHTFVYWYQQKQNKELKFLISFQRQEVREKTDLVKERFLAECPSNLPCNLEIQSSEAGDSALYLCASSL
Peromyscus maniculatus bairdii V1256 trbv AYHN01144360.1 7046 FFDAAVTQTPRHLIKMKRQRAKMTCIPEKGHTAVYWYQQRQNKELQFLIYFQNQQPLDQIDMVKERFSAECHSNSSCNLEIKTSDVGDSALYFCASSQ
Peromyscus maniculatus bairdii V1257 trbv AYHN01144360.1 5048 SFDAKVTQTPGYLIKEKGQKANMSCTPEKGHTAFYWYQQNEKRELKFLINFRNEEIIDQTDMVKKRFLAECRSNSRCSLEIQSSEAGDSALYLCASSE
Peromyscus maniculatus bairdii V1258 trbv AYHN01144361.1 58282 SANPGVIQSPRHIIKAKGGRSILKCIPISGHDTVNWYQQTLGQELRFLIQYYKKLEGVKGNMPNRFSVQQFGDYRSEMNMSALQLEDSAVYFCAS
Peromyscus maniculatus bairdii V1259 trbv AYHN01144361.1 55617 HMEAAVIQDPRSKVTVTGGKVTLNCQQNDNHDYMYWYRQDLGHGLKLIHYSYGVNNTEKGDVTDGYKVTRPNQENFSLILEMTFPSQTAVYFCASSD
Peromyscus maniculatus bairdii V1260 trbv AYHN01144361.1 47694 LSEAGVTQSPRYVIIQERQDASFWCDPISGHATLYWYQQPRDQGPQLLVYFQNEAVMDDSQLPKGRFSAARPEGVNSTLKIQSAKLEDTATYLCASSV
Peromyscus maniculatus bairdii V1262 trbv AYHN01144361.1 33468 PTNAGVTQTPRHKVTEKGQEAALSCEPISGHTTIFWYRQTPVRGLEFLIYFNNQDPIDETGMPKERFSAQMPNAKLSTLKIQPTLPQDSAVYLCASSL
Peromyscus maniculatus bairdii V1263 trbv AYHN01144361.1 26237 CVDAMVMQSPKYKVARVGKPVNLSCSQYLNHNAMYWYQQKPNKALKFLLYYYDKTLNRETDTSDNFQSSRPNTSFCALDIRSADLGDSAMYLCASSR
Peromyscus maniculatus bairdii V1264 trbv AYHN01144361.1 15093 ITHGRITQTPKFLIGQQGKRLTLECEQDFNHDTMYWYRQDPGKGLRLIYYSITEKDIQKGDLSEGYDVSRNKKPFFPLTVTSAQKNQMAFYICASSI
Peromyscus maniculatus bairdii V1266 trbv AYHN01144362.1 3562 SANPGVIQSPRHIIKAKGGSSILKCIPISGHDTVSWYQQTLGQELRFFIQHYEKMEGEKGNMPNRFSVQQFSDYHSEMNMSALQLEDSAVYFCAS
Peromyscus maniculatus bairdii V1267 trbv AYHN01144362.1 928 HMEAAVIQDPRSKVTVTGGKVTLSCRQTYNHNRMYWYRQDLGHGLRLIHYSYGVDSTEKGDVPDGYEVTRPSQENFSLVLEMASPSQTAVYFCASSD
Peromyscus maniculatus bairdii V1268 trbv AYHN01144363.1 22489 SANLGVIQSPRHIIKAKGGSYILKCIPISGHDTVSWYQQTLGQELRFFIQYYEKMERGKGNMPNRFSVQQFGDYRSEMNMSALQLEDSAVYFCAS
Peromyscus maniculatus bairdii V1269 trbv AYHN01144363.1 21124 HMEAAVTQDPRSKVTVTGGKVTLSCRQTYNHNYMYWYRQDQGHGLRLIHYSYGADNVEKGDVPDGYKVTRPNQENFSLILEMASPSQTAVYFCASSD
Peromyscus maniculatus bairdii V1270 trbv AYHN01144363.1 13243 HMEAAVTQDPRSKVTVTGGKVTLSCRQTYNHNYMYWYRQDQGHGLRLIHYSYGANNIEKGDVPDGYKVTRPNQENFSLILEMASPSQTAVYFCASSD
Peromyscus maniculatus bairdii V1271 trbv AYHN01144363.1 7280 SANPGVIQSPRHIIKVKGGRSILKCSPISGHDTVSWYQQTLGQELRFLIQHYERTEQAKRNMPNRFSVQQFSDYRSEMNMSTLQLEDSAVYFCAS
Peromyscus maniculatus bairdii V1272 trbv AYHN01144363.1 3349 HMEAAVTQDPRSKVTVTGGKVTLSCRQTYNHNNMYWYRQDLGHGLRLIHYSYGADNVEKGDVPDGYTVTRPNQENFSLILEMASPSQTAVYFCASSD
Peromyscus maniculatus bairdii V1273 trbv AYHN01144364.1 78501 PVDPRIIQTPQHLVTVTGNERTLKCEQHLSHNAMYWYRQSAKKSLQLLFSYYHQKLVENQTISTRFQPHNPRKTYLDLQISALEPDDSATYFCASSQ
Peromyscus maniculatus bairdii V1274 trbv AYHN01144364.1 77062 LTGPKVTQIPSHEVVHVGQMVTLSCDPVSNHIFFYWYKLILGQQMEFLVSFSSGKTVDKSDLFKEDQFSVERKKDSYFTLKIQPTMLEDSAMYFCASSL
Peromyscus maniculatus bairdii V1275 trbv AYHN01144364.1 61911 PVDPRIIQTPKHLVTVMGNERTLKCEQHLSHNAMYWYRQSAKKSLQLMFFYRLQKLIENQTISTRFQPHNPGKSYLDLQISALEPDDSATYFCASSQ
Peromyscus maniculatus bairdii V1276 trbv AYHN01144364.1 53620 PLETAVFQTPKHLVTQVGNNAFLQCEQKLGHDVMYWYKQDSKQLLKIMFIYNNKQLILNESVLSRFSPQSPDKALLNLHVKSLELDDTAVYFCASSY
Peromyscus maniculatus bairdii V1277 trbv AYHN01144364.1 49905 LMNTKISQTPRYLVMGRANNKSLKCEQYMGNNAMYWYKQNAEKPPELMFFYNLKQLIQNETVPSRFLPECPDTSKLFLHLSALEPEDSALYFCASSK
Peromyscus maniculatus bairdii V1278 trbv AYHN01144364.1 29447 PMSAAINQTPKSMLLRTGQHVTMNCTQNMKHDAMFWYRQDPGLGLRLIYYSYDVGITDKGDVPEGYSVSRTNTEFFPLTLESASPSQTSVYFCASSY
Peromyscus maniculatus bairdii V1279 trbv AYHN01144364.1 26389 LTSAGVSQSPMYRVIKRGQDVDLVCDPVSGHSGLYWYRQNPGQGPVFMVYFQNTFLFDKSGMPSDRFSAVRPKGSFSILNIQSTDQEDSGIYLCASSL
Peromyscus maniculatus bairdii V1280 trbv AYHN01144364.1 21543 LTDAGITQTPRYWITQTGRKMTLECSQDMNHYWMFWYRQDAGQGLKLLHYSGSVGSTDKGDVPEGYSVSRNKSEDFPLTLELTRPSQTSVYFCASS
Peromyscus maniculatus bairdii V1281 trbv AYHN01144364.1 5998 HTKAGVSQSPTHRITKKGQNVSFRCDPISGHTRLYWYRQSLGQGPEFLIYFQNEVAPDKSGLPGDHFSVERPNGSYSVLKIQPVKQKDSAVYLCASSL
Peromyscus maniculatus bairdii V1282 trbv AYHN01144366.1 5363 PVDPRIIQTPKHLVAVKGNERTLKCEQHLSHNAMYWYRQSAKKSLQLMFSYNYQKLVENQTISTRFQPHNPGKSYLDLQISALEPDDSATYFCASSQ
Peromyscus maniculatus bairdii V1283 trbv AYHN01144366.1 3922 LTGPKVAQTPSHEVVHVGQMVTLSCDPVSNHISFYWYKLILGQQMEFLVSFYSGKILDKSKLFKEDRFSVERKKDSHFTLKIQPIMLEDSAMYFCASSL
Peromyscus maniculatus bairdii V1284 trbv AYHN01144613.1 42639 VSTQRIHQWPAVRVQPVGSSLSLECTITGKSNPNLYWYWQATGGTLQQLFYSINVGEVQSVVSRNLSASRPKDGQFTLSSKKLLLSHSGFYFCAWS
Peromyscus maniculatus bairdii V1285 igkv AYHN01145226.1 12292 TSGDAVLTQTPLSLSVSTGQSASISCQSSQSLLDSDGKTYLNWLLQGLGQSPQRLIYQVSKHYLGVPDRFSGSGSGMDFTLKISRVEAEDGGVYYCLQG
Peromyscus maniculatus bairdii V1286 igkv AYHN01145226.1 3073 ARCDIQMTQSPSSLSASLGDRVTITCRASEGISSALNWYQQKPGKAPRLLIYGADSLADGVPSRFSGSGYRTDFSLTISSLEPEDFATYYCQQGYNP
Peromyscus maniculatus bairdii V1287 igkv AYHN01145227.1 4716 TTCDIQMTQSPTFLSASLGDRVTISCRASHDISSALNWYQQKPGKAPKLLIYGADSLEDGVPSRFSGSGYGTDFSLTISSLEPEDFATYYCQQGYNP
Peromyscus maniculatus bairdii V1289 igkv AYHN01145234.1 6470 TSGDVVLTQTPLSLSVSTGQSASISCQSTQSLLDSDGKTYFNWLLQRPGKSPQRLIYQVSKLDPGVPDRFSGSGSGADFTLKISRVEAEDVGVYYCLQG
Peromyscus maniculatus bairdii V1290 igkv AYHN01145237.1 2378 ARCDIQMTQSPSSLSASLGDRVTITCRASQGIGFALTWYQQKPGKAPQLLIYGADSLEDGVPSRFSGSGFGTDYSLTISSLESEDFATYYCQQYDELP
Peromyscus maniculatus bairdii V1291 igkv AYHN01145243.1 6692 TSGDAVLTQTPLSLSVTIGQSAFMSCRSSQSLIYSSDGKTYLNWLLQKPGQSPQHLIYQVSNLDSGVRDRFSGSGSGTDFTLKISRVEPEDLGVYYCYQVTYYP
Peromyscus maniculatus bairdii V1292 igkv AYHN01145464.1 11930 VICDIQMTESPSFLSASLGDQVTINCRATKNINKHLAWVQQKPGKSPRILIHYAANLLTGVPAKFSGSGSGTDYSLTINNLESEDIATYYCLQYSEHP
Peromyscus maniculatus bairdii V1293 igkv AYHN01145464.1 3762 ASGDTVITQAENSILVTSEESVSISCRSSKSLLHSNGVTFLNWYLQRPGQSPKTLIYWGSNPLTGVPDRFGGSGAGTDFTLKISREGAEDVGVYYCQQLLEFP
Peromyscus maniculatus bairdii V1294 igkv AYHN01145465.1 10600 SGARCDIQMTQSPASLSASLGDSVTITCQASQDLNGNLVWYQQKPSKPLRFLFYRTGVSSRFSGSGSGTQYSLKISSLQSEDAATYYCQNHYTTP
Peromyscus maniculatus bairdii V1295 igkv AYHN01145466.1 7319 EIVLNQYPSTMAASRGEKVTITCSASSSISSNYFHWYQQKPGASPKLLVYRTSFLAAGVLGNFIGSGSGTSYSLTISCMQDDDAATYYCQQGSSS
Peromyscus maniculatus bairdii V1296 igkv AYHN01145469.1 7562 ARCDIQMTQSPTSLSASLGDSVTITCLASEDFGWGLAWHQQKPGKHPKQLIYAGNRLANGVPSRFSGSKSGTQFSLKINSLQPEDMADYFCLQGYSTP
Peromyscus maniculatus bairdii V1297 igkv AYHN01145470.1 18571 ARCDIQMTQSPTSLSASLGDSVTITCLASEDFGWGLAWHQQKPGKPPKQLVYAGNRLANGVPSRFSGSKSGTQFSLNINSLEPEDVADYFCQQGYSTP
Peromyscus maniculatus bairdii V1298 igkv AYHN01145470.1 7821 SDGEIILTQSPISMTTSPGEKVTITCRASSSASSNYFHWYQQKPGASPTLLVHGTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQKSSEP
Peromyscus maniculatus bairdii V1299 igkv AYHN01145477.1 2219 AKCDVQMTQSPAFLSASVGESVTMTCRASQDIYSNLAWYQKKPGKSPKLLIYVAKYLANGVPSRFSGSGSGTQYSLKINGLQSEDMATYYCQQGNNYP
Peromyscus maniculatus bairdii V1307 trav AYHN01146965.1 8601 VSRGEQLEQQPSLLSVQEGHSAVINCTYTDTNYYFYWYKQEPEAGLQLLINILSSVDRKEEQGLIVLLKKKDKQLSLNFTAAHPEDSATYFCAAS
Peromyscus maniculatus bairdii V1308 trdv AYHN01146968.1 6043 SNLGQKVTQVQPTASTQEGEEVTLDCSYETSQNLYHIFWYKQLLSGEMIFLIRQISSSTRTEKSSRYSVVFQKSTKSIRLVISGSQLEDSVKYFCVLWEH
Peromyscus maniculatus bairdii V1309 trav AYHN01146970.1 20737 MIHGEQVEQHPSTLRVQEGASAVINCTYTDSTLSYFPWYKQGPGEHPQLVIDIRSTVERKQEQRLIVLQDKKAKHLSLHITDTRPGDSAMYFCAAS
Peromyscus maniculatus bairdii V1310 trav AYHN01146970.1 18834 KINADSVTQTEDLVTVTEGLPVMMNCTYQTTSSIPTLFWYVQYLNKAPRLLLKSATDNQRTEHQLFQATLQKSSSSFPLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V1311 trav AYHN01146970.1 9166 VKGQQVEQSPVSLVLQEGERAELQCNFSTVLTSVQWFHQSPGGHLKSLFYNPSGTKQSGRLMSTTLTQERRSSLYISSSQTTDSGTYFCAMSAQC
Peromyscus maniculatus bairdii V1312 trav AYHN01146971.1 5771 VSSQQKVQQNPEFLSVPEGAMASLNCTFSDSASDYFWWYRQHSGKSPKALMSIFSNGAKEEGRFTVHLNKASRHVSLHIRDSQPSDSAVYLCAVR
Peromyscus maniculatus bairdii V1313 trav AYHN01146972.1 3644 RTHGNSVTQRGGQVTIAEGRFLTINCTYSITTIASPALFWYVRYPGESLQLLLNVLTAGAKGSSRGFEATHDKGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V1314 trav AYHN01146972.1 1116 VAGKTQVEQIPKLLAILEGENCVLQCNYTVSPAGNLRWYRQDTGRGLVSLAVMTYTENKKSNGRYSASLDADAKHSTLHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V1315 trav AYHN01146975.1 26981 ESRGEQVEQHPSTLSVQEGDSAAINCTYTDSASVYFPWYKQEPGKHPQVIIDIRSNAERKQSQRLTLLLDKKAKHLSLHITATQPADSAIYFCAAD
Peromyscus maniculatus bairdii V1316 trav AYHN01146975.1 24457 RTHGDSVTQKQAQVTLSEDDVLFINCTYSATGYPTLFWYVQYPGEGPELLLKVTTANNKGSSQGFEATYDKGSTSFHLQKAMVKESDSAVYYCALS
Peromyscus maniculatus bairdii V1317 trav AYHN01146975.1 17553 VNSQVGEENAWALSIQEGENVTVNCSYKTTITVLQWYRQESGRGPAMLILIRSNEREKRSGRLRATLDTSTQSSSLSITAAQAADTAVYFCATD
Peromyscus maniculatus bairdii V1318 trav AYHN01146975.1 5740 DVQAQSVTQPDAHVTVFEGDSVELRCNYSYSGTPYLFWYKQNHDQGLQLLLRYFSGDPVVHGVNGFEAEFQKSKSSFHLKKTSVHLSDSAVYFCALR
Peromyscus maniculatus bairdii V1319 trav AYHN01146975.1 4362 ESNGDSVTQTEGRVTISEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCAL
Peromyscus maniculatus bairdii V1320 trdv AYHN01146977.1 3213 SNLGQKVTQVRLTASTQEGESVTLDCSYETRSKFYYLFWYKQLLSGEMIFLIRQFSSSTQTEKSSGYSVVFQELSKSISLVISASQLEDSVKYYCALWEQ
Peromyscus maniculatus bairdii V1321 trav AYHN01147132.1 6682 VKGQQVEQSPVSLVLQEGERAELQCNFSISAAQVQWFHQSPGGHLKSLFYNPSGTKQSGRLMSTTVTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V1322 trav AYHN01147137.1 2020 VSQGEQVEQHPSTLRVQEGASAVINCTYTDSTSYYFPWYKQGPGEHPQLIIDIRSTVERKQEQRLIVLQDKKAKHFSLHITDTRSGDSALYFCAAS
Peromyscus maniculatus bairdii V1323 trav AYHN01147139.1 19723 VSRGEQLEQQPSLLSVQEGDSAVINCTYTDTNYYFYWYRQEPGAGLQLLIYVPSSVDRKEEQGLVVLLNKKSKQLSLNFTAAHPEDSATYFCAAS
Peromyscus maniculatus bairdii V1324 trav AYHN01147139.1 2718 GVSQGEQVEQHPSTLRVQEGASAVINCTYTDSASSYFLWYKQGPGDYPQLVIDICSTVERKQEQRLIVLQDKKGKHFSLHIIDTWPGDSAMYFCAAS
Peromyscus maniculatus bairdii V1325 trav AYHN01147139.1 1028 RSKGDSVTQTEGLITVTEGLPVMMNCTYQTTYSAPFLFWYVQYPNKAPRLLLKSATDNQRTEYQGFQATLQKSSSSFPLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V1329 igkv AYHN01148925.1 12786 TSGDAVLTQTPLSLSVSTGQSASISCQSSQSLLYSDGKTYLNWLLQRPGQSPQRLIIQVSKLDTGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQG
Peromyscus maniculatus bairdii V1330 igkv AYHN01148931.1 2919 ARCDIQMTQSPSSLSASLGDRVTITCRASQGISNYLNWYQQKPGKAPKLLIYYTNSLADGVPSRFSGSGSGADYSLTISSLEAEDIATYYCQQSSNLP
Peromyscus maniculatus bairdii V1336 igkv AYHN01151289.1 1490 VRCNIQMTQSPTTLSAYLGDRVTITCHAGQNVNSWLSWYQQKPGNAPKLLIYKASSLQTGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCLQYQSC
Peromyscus maniculatus bairdii V1337 iglv AYHN01151322.1 6660 SFSQPVPTQSPSDSASLGDSAKLTCTLSSQNSTNNIVWYQQHPDKAPKHLMRLQSDGSYSKGDGIPDRFSGSSSGPHHYLSISNTHPEDEAKYYCGVGDSNG
Peromyscus maniculatus bairdii V1338 trav AYHN01151465.1 4809 RTHGDSVTQTGGQVTISESGFLTINCTYSITNIVFPALFWYVQYPGESLQLLLKAITAGEKGSGRGFETTYDKGSTSFHLQKASVQESDSAVYYCALR
Peromyscus maniculatus bairdii V1339 trav AYHN01151465.1 2266 VAGKTQVEQSPKLLAVLEGENFVLQCNYTVSPMNNLRWYRQDTGGGLVSLAVMTYIDNKKSNGRYSASLDADAKHSTLHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V1340 trav AYHN01151475.1 8396 DVQAQSVTQPDAHVTVFEGDSVELRCNYSYGGALYLFWYMQHRGQGLQLLLKYISGDPVVHGVNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCVLS
Peromyscus maniculatus bairdii V1341 trav AYHN01151475.1 2641 ESNGDSVMQTEGQVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLLRVSKANEKGSSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V1342 trav AYHN01151478.1 7633 ESRGEQVEQHPSTLSVQEGDSAAINCTYTDSTSVYFPWYKQEPGKHPQFIIDIRSNAERKQNQRLTLLLDKKAKHLSLHITATQPADSAIYFCAAD
Peromyscus maniculatus bairdii V1343 trav AYHN01151478.1 5069 RTQGDSVTQKQGQVTLSEDEFLFINCTYSATGYPTLFWYVQYPGEGPQLLFRVTKANEKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V1344 trav AYHN01151496.1 5318 ESHGEQLEQQPSTLSIGEGDSTIINCTYTGSAFSYFPWYKQEAGKSPHLVIDILENVDRKQNQRLTILLNKKAKKLSLHITATQPGDSAIYFCAA
Peromyscus maniculatus bairdii V1345 trav AYHN01151498.1 20457 VNSQVGEENAWALSIQEGENVTVNCSYKTTITALQWYRQESGRGPATLILIRSNEREKHSGRLRATLDTSTQSSSLSITAAQAADTAVYFCATD
Peromyscus maniculatus bairdii V1346 trav AYHN01151498.1 6914 DVQAQSVTQPDAHVTVFEGDSVELRCNYSFSGAPYLFWYKQNHEQGLQLLLKYFSGDPVVHGVNGFEAEFQKSKSSFHLKKTSVHLSDSAVYFCVLS
Peromyscus maniculatus bairdii V1347 trav AYHN01151498.1 5540 ESNGDSVMQTEGQVILSEGMSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRVSKAKENGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCALS
Peromyscus maniculatus bairdii V1348 trav AYHN01151500.1 5844 GVRGMQVEQSPPALSLQEGAGSALRCNFSTTTTTVQWFRQNPGRSLLRLFFMTPGTKENGRLKSTFDSKERYSTLHIRDAQLEDSGTYLCAAD
Peromyscus maniculatus bairdii V1349 trdv AYHN01151504.1 14312 SSLGQKVTQVQPTASTQEGEEVTLDCSYETRSNIYFLFWYKQLLNGEMIVLNCQFSSSTQTEKSSGYSVVFQESTKSISLIISASQLEDSVKYFCALWEQ
Peromyscus maniculatus bairdii V1350 trav AYHN01151506.1 1407 QQQDRRDQQQVRQSPQSLTVSAGGTSVLNCTYEDSTFDYFPWYRQFPGEGPTLLIAIRSVSNKKEDRRFTVFFRKSDKQLSLHITDSQPGDSATYFCAAS
Peromyscus maniculatus bairdii V1351 trav AYHN01151509.1 13460 VSSQQKVQQNRESLSVPEGAMASLNCTFSDSALDYFSWYRQRSGKGLELLLFVFSSGKKEGRFAVHLNKASRHVSLHIRDSQPSDSAVYLCAVR
Peromyscus maniculatus bairdii V1352 trav AYHN01151859.1 4705 RSKGDSVTQTEGLVTVTEGLPVIMNCTYQTIDSAPFLFWYVQYLNEAPRLLLRSFTDNQRTEHQGFQATLQKSSSSFHLQKSSVLLADSALYYCALS
Peromyscus maniculatus bairdii V1353 trav AYHN01151860.1 444 EQVKQHPSILRVQEGASAVINCIYVDSATSHFPWYKQEPGEHPQLVIDIRSTVERKQEQRLIVLQDKRVTHFSWHTTDTRPGDSALYFCAAS
Peromyscus maniculatus bairdii V1354 trdv AYHN01151864.1 9745 SNLGQKVTQVQPTASTQEGEEVTLDCSYETSQNLYHLFWYKQLLSGEMIFLIRQISSSTRTEKSSGYSVVFQKSSKSIRLVISASQLEDSVKYYCALWE
Peromyscus maniculatus bairdii V1355 trav AYHN01151868.1 890 VKGEQVEQSPVSLVLQEGERAELQCNFSTVLTSVQWFHQSPGGHLKSLFYNPSGTKKSGRLISTTVTQERRSSLYISSSQTTDSGTYFCAMS
Peromyscus maniculatus bairdii V1356 trav AYHN01151869.1 14010 VSSQQKVQQTPESLSVPEGAMASLNCTFSDSTSDYFWWYRQHSGKSPKLLVSTISNGAKEEGRFTVHLNKASRHVSLYIRDSQPSDSAVYLCAVR
Peromyscus maniculatus bairdii V1357 trav AYHN01151869.1 8826 VIHGEQVEQHPSTLRVQEGDRAVINCTYTDSASYYFSWYKQGPGEHPQLIIDIRSPVERKQEQRLIVLQDKKTKHFSLHITDTRPGDSALYFCAAS
Peromyscus maniculatus bairdii V1358 trav AYHN01151869.1 6929 KINADSVTQTEDLVTITEGMPVMMNCTYQTMYSAPFLCWYVQYPNKAPRLLLRSATDNQRTEHQGFQATLQKSSSSFPLQKSSVQLADSALYYCALR
Peromyscus maniculatus bairdii V1359 trav AYHN01151870.1 3800 VAGKSQVEQIPKLLSVLEGENFVLHCNYTVSPAGNLRWYRQDTGRGLVSLAVMTYTENKKSNGRYSASLDADAKHSTLHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V1360 trav AYHN01151872.1 5030 DAQAQSVTQPDAHVTVFEGDSVELRCNYSYSGTPYLFWYKQHHDQGLQLLLRYFSGDPVVHGVNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCVVS
Peromyscus maniculatus bairdii V1361 trav AYHN01151872.1 3641 ESNGDSVTQTEGRVTISEGTSLTVNCSYETKQYPALFWYVQYPREGPQLLFRVSKANLKGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCAL
Peromyscus maniculatus bairdii V1362 trav AYHN01151874.1 13127 ESRGEQVEQHPSTLSVQEGSSAVINCTYIDSASAYFPWYKQEPGKHPQVIIDIRSNAERKQNQRLTLLLDKKAKHLSLHITATQPADSATYFCAAN
Peromyscus maniculatus bairdii V1363 trav AYHN01151874.1 10529 STHGYSVTQKQGQVTLSEDDFLFINCTYSATGYPTLFWYVQYPGEGPELLLKVTTANNKGSSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V1364 trav AYHN01151874.1 8334 VNSQVGEDNAWVLSIQEGENVTVNCSYKTTIIALQWYRQESGRGPTMLILIRSNEREKHSGRLRATLDTSTQSSSLSITAAQAADTAVYFCATD
Peromyscus maniculatus bairdii V1365 ighv AYHN01151996.1 10031 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITTSGYGWNWIRQSPGKKLEWMGYINSAGGTYYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V1366 ighv AYHN01151996.1 2618 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYDWNWIRQSPGKKLEWMGYIGSGGGTNYNPSLQSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V1367 ighv AYHN01151997.1 22993 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLSSNDVHWVRQPPGKGLEWMGRIWSDGSTNYNSALKSRLTISRDTSKSQVFLKLNTLETEDTATYYCAR
Peromyscus maniculatus bairdii V1368 ighv AYHN01151997.1 13401 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSNGVLWARQPPGKGLQWMGAMWNHGGTSYNSDLKSRLSISRDTSKSQVFLKLNNLQTEDTATYYCAR
Peromyscus maniculatus bairdii V1369 ighv AYHN01152001.1 2748 IQCEVQLVESGGGLVQPGSFLKLSCSASGFTVSAAWMNWVRQAPGKGMEWVGTIKHRPDNYAASYADSVKGRFTISRDDSKSSIYLQMNSLKPEDTAIYYCTRH
Peromyscus maniculatus bairdii V1370 ighv AYHN01152002.1 3686 VHSQVQLQQSGAELVRPGVSVRLSCKASGYTFTNEYMHWVKQRPGQSLEWIGWIYPGSGNTKYNQKFQGKATLTVDKSSSTAYMELSSLTSEDSANYYCAR
Peromyscus maniculatus bairdii V1371 ighv AYHN01152005.1 16909 ILSQVQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYAWHWIRQSPGKKLEWMGYINSAGSTGYNPSLKSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V1372 ighv AYHN01152005.1 3795 VQCEVQLIVSQGGLAQTGGSITLSCAASGFTFSDHWMHWFRQAPGKGLEWVATIKYDGSARYYAESVNGRFTISRDNYKNSLYLQMSSLRNEDTAMYYCI
Peromyscus maniculatus bairdii V1373 ighv AYHN01152009.1 14678 ILSQIQLQESGPGLVKPSQSLSLTCSVTGYSITTSGYGWTWIRQSPGKKLEWMGYINSAGGTGYNPSLKSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V1374 ighv AYHN01152009.1 7970 ILSQVQLQESGPGLVKPSQPLSLTCSVTGSFVTSDYWWSWIRQSPGKKLEWMGYINSAGGTNYNPSLKSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V1377 trav AYHN01152405.1 21022 VKGQQVKQSPVSLVLQEGERAELQCNFSTVLTSVQWFHQSPGGHLKSLFYNPSGTKQSGRLTSTTVAKEYRSSLYISASQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V1378 trdv AYHN01152405.1 7961 SNLGQKVTQVQSTASTREGESVILDCSYETSWKYYSLFWYKQLLSGEMIFLIRQISSSTHTEKSSRYSVVFQESSKSISLIISASQLEDSVKYFCVLWE
Peromyscus maniculatus bairdii V1379 trav AYHN01152410.1 3146 VSQGEQVEQHPSTLRVQEGASAVINCTYTDSTSYYFPWYKQGPGEHPQLIIDIRSTVERKQEQRLIVLQDKKAKHFSLHITDTRSGDSALYFCAAS
Peromyscus maniculatus bairdii V1380 trav AYHN01152410.1 1434 RSKGDSVTQTEGLVTVTEGLPVMMNCTYQTTYSAPFLFWYVQYSNKAPRLLLKSATDNRRTEHQGFQATLQKSSSSFNLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V1382 igkv AYHN01152731.1 3395 STGDIVLTQSPASWAVSLGQKATISCKSSESVNIFGNSYMHWYQQKPGQPTKLLIDAASNKASGVPARFSGSGSGTDFTLTIHPVEADDAAIYHCQQGKQLP
Peromyscus maniculatus bairdii V1383 igkv AYHN01152735.1 34673 SKGQIMVTQPAESLHVSPGEKASITCRASQSLLYTDGKHYLSWYQQRQGQTIKVLIYHASVRIDGVSTRFIGSGSGTEFTLTIEDLQPEDFAVYYCLQ
Peromyscus maniculatus bairdii V1384 igkv AYHN01152735.1 10782 STGDIVLTQSPASLAVSLGQKATISCKSSESVNEYGIDFMDWYQQKPGQPPKLLIYAASNLASGVSARFSGSGSETDFTLTIHPVQADDAAIYHCQQGKEDP
Peromyscus maniculatus bairdii V1385 igkv AYHN01152735.1 3347 TTGDIVLTQSPSSLAVSLGQRATISCKASQSVSNNFFTYMYWYQQKPGQPPKRLIYGASNLDSGVPARFSGSGSETDFTLTIHPVEADDAATYYCQQAIVFP
Peromyscus maniculatus bairdii V1387 igkv AYHN01153010.1 4476 VSGDIVMTQDALSTPVTLGESSSISCRSSKSLLHSNGITYLHWNMQRPGQSPQLLIHRMSNLASGVSDRFSGSGSGTDFTLKISRVEPEDIGIYYCQQTLELP
Peromyscus maniculatus bairdii V1388 ighv AYHN01153270.1 4051 ILSQIQLQESGPGLVKPSQSLSLTCSVTGYSITTSGYYWNWIRQSPGKKLEWMGYINYVGGTYYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V1389 ighv AYHN01153278.1 1507 VQTEVQLVESGGGLVQPGGSLKLSCATSGFTFTDYWMHWVRQAPGKGLEWVGVIKHKPDNYATTYAESVKGRFTISRDDSKSSIYLQMNRLKVEDTAIYYCTS
Peromyscus maniculatus bairdii V1390 ighv AYHN01153280.1 7990 ILSQIQLQESGHGLVKPSQTLSLTCSVTGYSITSGYGWNWIRLSLGKKLEWMGYIDYGGSTSYNPSFKSHISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V1391 ighv AYHN01153283.1 7717 ILSQVQLQESGPGLVKPSQSLSLTCSVTGFSITSNAWSWIRQSPGQKLDWMGYISSGGSTSYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V1392 igkv AYHN01153463.1 7287 ICGDIVMTQSPSSLAVSAGEKVTISCKSSQSLFGSTSKKNRLIWLQQKPGQAPKLLIYYASTLDTGVPDRFIGSGSGTDYTLTISSVQAEDLADYYCMQDHTFP
Peromyscus maniculatus bairdii V1393 igkv AYHN01153577.1 824 ARCDIQMTQSPASLSTPLGDSVTITCRASGGIYSALAWYQQKPGKPPKLLIYSANILEDGVPSRFSGSGSGTQYSLKISSLQAEDVATYYCQQG
Peromyscus maniculatus bairdii V1394 igkv AYHN01153581.1 2639 SRGDVVLTQTPLSLPVSLGDKASLSCRSSQSLVHSNGNTYLHWYLQKPGQSLQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCMQG
Peromyscus maniculatus bairdii V1395 igkv AYHN01153583.1 12800 ARCDIQMTQSPASLSTSLGDSVTITCRASEDIYSALAWYQQKPGKTPKLLIYDANNLADGVPSRFSGSGSGTQYSLKISSLQPEDVATYYCQQGYTP
Peromyscus maniculatus bairdii V1397 iglv AYHN01153877.1 1827 SWAEVVFTQPKSVSGSLGQKITISCTRSSGNIGSNYAHWYQQRSANSPRLLIYEYDQRPSGIPDRFSGSKDSSSNSGILTISGLQPEDEADYYCLSSYDSY
Peromyscus maniculatus bairdii V1398 iglv AYHN01153879.1 571 SWAEVVFTQPKSVSGSLGQKITISCTRSSGNIGSNYVSWYQQRSVNSPHLLIYEYDRRPSGVPDRFSGSKDSSSNSGILTISGLQPEDEVDYYCLSGYDSY
Peromyscus maniculatus bairdii V1399 iglv AYHN01153884.1 10503 AISQTVVTQESSLTTSPGGTVKLTCGSSTGAVTTSNYANWVQEKSYQVHTGLIGGTNYRGPGVPAHFTGSVLGDKAALTITGAQPEDEAVYYCALLYSSQ
Peromyscus maniculatus bairdii V1400 trav AYHN01154017.1 5443 VSGKTQVEQSPQSLTVLEGENCLFQCNYTVSSTGNLRWYRQDTGRGLVSLAVMTYTENRKSNGRYSASLDADAKHSALHITASQLEDTASYICVVG
Peromyscus maniculatus bairdii V1401 trav AYHN01154022.1 3816 DVQAQSVTQPDAHVTVFEGDSVELRCNYSYSGTLYLFWYMQHHGQGLQFLLRYFSGDPVVHGVNGFEAEFQKSKSSFHLKKTSVHLSDSAVYFCVVS
Peromyscus maniculatus bairdii V1402 trav AYHN01154022.1 2437 ESNGDSVTQTEGRIIISEGTSLTVKCSYETKQYPALFWYVQHPGEGPQLLLRVSKANEKGSSRGFEATYDKGSTSFHLQKASVQASDSAVYYCALG
Peromyscus maniculatus bairdii V1403 trav AYHN01154023.1 7343 VNSQLGEENAWALSIQEGENVTVNCSYKTSITALQWYRQESGRGPAMLILIRSNEREKRSGRLRVTLDTSTQRSSLSITAAQAADTAVYFCATD
Peromyscus maniculatus bairdii V1404 trav AYHN01154024.1 4290 ESRGEQVEQHPSTLSVQEGASAVINCTYTDSASVYFPWYKQEPGKHPQFIIDIRSNAERKQSQRLTLLLDKKAKHLSLYITATQPADSAIYFCAAD
Peromyscus maniculatus bairdii V1405 trav AYHN01154024.1 1739 RTHGDSVTQKQAQVTLSEDDVLLINCTYSATGYPTLFWYVQYPGEGPELLLKVTTANNKGTSQGFEATYDKGSTSFHLQKAMVKESDSAVYYCALSE
Peromyscus maniculatus bairdii V1406 trdv AYHN01154026.1 4434 SNLGQKVTQVRSTASTQEGEEVTLDCSYETRSKFYYLFWYKQLLSGEMIFLIRQFSSSTQTEKSSGYSVVFQESSKSISLVISASQLEDSVKYYCALWE
Peromyscus maniculatus bairdii V1408 igkv AYHN01155828.1 9060 VICDIQMTESPSFLSVSLGDQVTINCRATKNINKHLAWVQQKPGKSPRILIHFASNLLTGVPAKFSGSGSGTDYSLTINNLESEDIATYYCLQYSEHP
Peromyscus maniculatus bairdii V1409 igkv AYHN01156703.1 1891 VRCDIQMTQSPPTLSASLGDRINITCHASQNINSWLAWYQQKQGTAPKTLIYKTSNLHTGVPSRFSGSGSGTDYSLTISNLQPEDIATYYCQQYQSYP
Peromyscus maniculatus bairdii V1410 igkv AYHN01156704.1 11056 VRCDIQMTQSPPTLSASLGDRVTITCHASQNINSWLAWHQQKPGNAPKPLIYKTSNLHTGVPSRFSGSGSGTDYSLTISNLQPEDIATYYCQQGQSNP
Peromyscus maniculatus bairdii V1412 trav AYHN01157237.1 7906 VKGQQVEQSPVSLVLQEGERAELQCNFSTVLGSVQWFYQSPGGHLKSLFYNPSGTKQSGRLTSTTVAQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V1413 trav AYHN01157238.1 8518 RSNGDSVTQTEVLVTVTEGLPVMINCTYQTTYSDSFLFWYVQYTNKAPRLLLRSATDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V1414 trav AYHN01157242.1 1493 VSSQQTVQQNPESLRVPEGAMASLNCTFSDSASDYFWWYRQHSGKGPELLVSIISNGAKEEGRFTVHLNKASRHVSLHIRDSQPSDSAVYLCAVR
Peromyscus maniculatus bairdii V1416 igkv AYHN01158914.1 649 SNGQIVLTQSPASMAASQAERVTLTCSASSSVSTSDLHWYQQKPGASPKLLIYNTSNLASGVPAHFSGSGSGMSYSLTISSVEAEDAATYYCQQVHNSP
Peromyscus maniculatus bairdii V1417 igkv AYHN01158915.1 2027 SNGQIVLTQSPASMAASLGERVTMTCSASSSVNTNYLLWYQQKPGASPKLLIYKTSTLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQKDSQ
Peromyscus maniculatus bairdii V1418 trdv AYHN01159980.1 2284 SNLGQKVTQVQPTASTQEGEEVTLDCSYETSQNLYHLFWYKQLLSGEMIFLIRQISSSTRTEKSSRYSVVFQKSTKSISLVISASQLEDSVKYFCALWE
Peromyscus maniculatus bairdii V1419 igkv AYHN01160116.1 3030 MICDIQMTQSPSLSASLGDRVTITCRASESISNGLAWYQQKPDSSPKLLIYHATNLQSGIPSRFSGSGSGTDFTLTISSLQSEDVATYYCQQYLEYP
Peromyscus maniculatus bairdii V1420 igkv AYHN01160373.1 4226 SNGEIVLTQSPASMAASQGERVTMTCSASSSISTSYLHWYQQKPGGSPKLLIYSTSNLASGVPSRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSTS
Peromyscus maniculatus bairdii V1421 igkv AYHN01162579.1 869 ARCDIQMTQSPSSLSASLGDKVTITCRANQGISNYLNWYQQKPGKAPKLLIYRASNLDNGVPSRFSGSGSGTDYSLTINSLKPEDFATYYCQQRVSTP
Peromyscus maniculatus bairdii V1423 ighv AYHN01163494.1 4883 VQCEVHLVESGGGLVQPGNSLKLSCAASGFTFSDAWMNWVRQAPGKGLEWVAQIRNKANNYETNYVESVKGRFTISRDDSESSVYLQMNSVRAEDTAIYYCTA
Peromyscus maniculatus bairdii V1424 ighv AYHN01163494.1 523 VHSQVQLQQSGPELGKPGSSVKLSCKASGYTFAYYYVHWVKQRPGQGLEWVGSIFPGTGYTDYNQKFKDKAKMTADKSSSTAYMNLSSLTSEDSAVYYCA
Peromyscus maniculatus bairdii V1425 trav AYHN01164544.1 4926 EIQAQSVTQPDAHVTVFEGDSVELRCNYSYSGAPYLFWYMQNHDQGLQLLLRYFSGDPVVHGVNGFEAEFQKSKSSFHLKKTSVHLSDSAVYFCIVS
Peromyscus maniculatus bairdii V1426 trav AYHN01164544.1 3527 ESNGDSVTQTEGRVTLSEGTSLTVNCSYETQQYPALFWYVQYPRQGPQLLFRVSKANLKGSSRGFEATYDEGSTSFHLQKASVQESDSAVYYCALG
Peromyscus maniculatus bairdii V1427 trdv AYHN01164707.1 2624 SSLGQKVTQVQSTTSTQEGEEVTLDCSYETRSNFYFLFWYKQLLNGEMIFLIRQFSSSTQTEKISGYSVVFQESTKSISLIISASQLEDSVKYFCALWEQ
Peromyscus maniculatus bairdii V1428 trav AYHN01164710.1 2807 VKGQQVEQSPVSLVLQEGERAELQCNFSTTATQMQWFHQSPGGHLKSLFYNPSGTKQSGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V1430 igkv AYHN01165429.1 2142 ARCDIQMTQSPSSLSASLGDRVTITCRASQNINSYLNWYQQKPGKAPKLLIYYTNRLAEGVPSRFSGSGSGTDFSLTISNLESEDIAAYYCQQYRQFP
Peromyscus maniculatus bairdii V1432 trav AYHN01165926.1 4138 VKGQQVEQSPVSLVLQEGERAELQCNFSTVLTSVQWFHQSPGGHLKSLFYNPSGTKKSGRLMSTTVTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V1433 igkv AYHN01166629.1 426 ARCDIQMTQSPSSLSASLGDRVSITCRASQNINSYLNWYQQKPGKAPQLLIYYTNRLVEGVPSKFSGSGSGTDYSLTISSLESEDIATYYCQQYAQYP
Peromyscus maniculatus bairdii V1434 igkv AYHN01166986.1 5295 ARCDIQMTQSPSSLSASLGDRVTLTCQASQGISNYLSWYQQKPGKSPKLLIYGASNREEGIPSRFSGSGSGTDYSLTIDSLESEDIATYYCQQYYDTP
Peromyscus maniculatus bairdii V1435 igkv AYHN01166990.1 863 ARCDIQVTQSPNFLSASLGERVTINCLASQGISNELNWFQQKSGQAPKLLIYYATNLQSGVSSRFSGQYSGKSFTLTISSVEPEDVGTYYCLQHNSAP
Peromyscus maniculatus bairdii V1436 igkv AYHN01167773.1 1226 ICGDIVMTQSPSFLAVSVGEKVTISCKSSQSLFGSNSKKNRLIWLQQKPGQAPKRLIYYASTLDTGVPDRFIGSGSGTDYTLTISSVQAEDLADYYCVHDLKYP
Peromyscus maniculatus bairdii V1437 igkv AYHN01168010.1 953 ARCDIQMTQSPSSLSASLGDRVTITCRASQGISSYLIWLQQKPGKAPKRLIYRASNLDNGVPSRFSGSGSGTDYSLTISSLESEDFATYYCLQYDKLP
Peromyscus maniculatus bairdii V1438 trav AYHN01168072.1 2223 SFPGDSRAQSVTQPDAQVTVTEEASLQLRCNYSSRVAPYLHWYVQSPQQGLQRLLGYYSGDTLVRGLSGFEAEFVKQDSSFHLEKASVHLSDSAVYFCVLG
Peromyscus maniculatus bairdii V1439 trav AYHN01168073.1 12157 VKGQQVEQSPVSLVLQEGERAELQCNFSTTANKMQWFHQSPGGHLNSLFYNPSGTKQSGRLKSTTVTQERRSSLYISSSQTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V1440 trdv AYHN01168073.1 1369 SSLSQKVTQFQSTASTKEGKTVTLDCSYETSQNLYHLFWYKQLLSGEMIFLIGQFSSFTQTEKSSHYSVVFRKSAKSISLVISASQLEDSVKYFCALWEH
Peromyscus maniculatus bairdii V1441 trav AYHN01168075.1 2614 GVSHGEQVEQHPSILRVQEGASAVINCTYTDSASSYFSWYKQGPGEHPQLVIDIRSTVERKQEQRLIVLQDKKAKHFSLHITDTRPGDSAMYFCAAS
Peromyscus maniculatus bairdii V1442 trav AYHN01168075.1 883 RSKVDSVTQTEGLVTVTEGLPVIMNCTYQTIDLAPFLFWYAQYLNKAPRLLLKSATDNQRTKHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALR
Peromyscus maniculatus bairdii V1443 igkv AYHN01169524.1 901 ARCDIQMTQSPASLSVSLGESVTITCQASQSISPWLAWYQQKPGNPPKLLIYHVKNLANGVPSRFSGTGSGTQFSLKISSLQPEDVADYYCQQYNNYP
Peromyscus maniculatus bairdii V1444 igkv AYHN01169525.1 3980 TRCEIQMTQSPASLSVSLGESVTITCLASQNIGSWLAWYQQKPGNPPKLLIYYAKNLANGVPSRFSGTGSGTQFSLKISSLQPEDVADYYCQQYDNTP
Peromyscus maniculatus bairdii V1445 igkv AYHN01169852.1 634 SRGDVVMTQTPTSLPVSLGDQTSISCGSSQSLLLSSGHTYLHWYLQKPGQFPQILVYKVSNRFSGVSDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQT
Peromyscus maniculatus bairdii V1446 igkv AYHN01170344.1 7329 EIVLNQYPSTMAASRGEKVTITCSASSSISSNYFHWYQQKPGASPKLLVYRTSFLAAGVLGNFIGSGSGTSYSLTISCMQDDAAATYYCQQGSSS
Peromyscus maniculatus bairdii V1447 igkv AYHN01170871.1 702 SRCDIQMTQAPSSLSASLGDRVSLTCQASQGIGFALNWYQQKTGKAPKLLIYGADSLADEVPSRFSGSGYGTDFSLTISSLEPEDIATYYCLQINNTP
Peromyscus maniculatus bairdii V1448 igkv AYHN01171588.1 14404 ASGDIVMTQPELSSPVTLGESASISCRSSKSLLHSNGNTYLYWYLQRPGQSPQLLIYLMSKLASGVPNRFSGSGSQTDFTLKISRVEAEDVGVYYCKQWLEYP
Peromyscus maniculatus bairdii V1450 igkv AYHN01173164.1 3373 MICDIQMTQSPSLSASLGDRVTITCRASESIRNGLAWYQQKPDSSPKLLIYHATNLQSGIPSRFSGSGSGTDFTLTISTLQSEDVATYYCQQYWSTP
Peromyscus maniculatus bairdii V1451 igkv AYHN01173748.1 3705 ICGDIVMTQSPSSLAVSAREKVTISCKSSQSLFGSSSKKNHLIWLQQKPGQAPKRLIYWASTRDSGVPDRFIGSGSGTDYTLTISSVQAEDLADYYCVQDYDFP
Peromyscus maniculatus bairdii V1452 trav AYHN01174193.1 6502 RVSQGEQVEQHPSTLRVQEGDSTVINCTYTDSASSYFSWYKQGPGEHPQLVIDIRSTVERKQEQRQIILQDKKAKLFSLHITDTRPGDSALYFCAAS
Peromyscus maniculatus bairdii V1453 trav AYHN01174193.1 4756 RSKGDSVTQTEGLVTVTEGLPVIMNCTYQTIDSAPFLFWYVQYPNKAPRLLLRSATDNQRTEHQGFQATLQKSSSSFHLQKSSVQLADSALYYCALS
Peromyscus maniculatus bairdii V1454 trdv AYHN01174195.1 10783 SNLGQKVSQVQPTASTQEGEEVTLDCSYETSQNLYHLFWYKQLLSGEMIFLIRQISSSTRTEKNSRYSVVFQKSTKSIRLVISASQLEDSVKYFCVLW
Peromyscus maniculatus bairdii V1455 igkv AYHN01174407.1 469 ARCDIQMTQSPSSLSASLGDRVTITCRASQSITKYLTWYQQKPGKAPQFLIYYPNRLVDGVPSRFSGSGSGTDYSLTISSLESEDIATYYCLQVSNDP
Peromyscus maniculatus bairdii V1456 trdv AYHN01178679.1 8304 SNLGQKVTQVQSTASTQEGEKVTLECSYETRSDFYYLFWYKQLLSGEMIFLIRQFSSSTQTEKSSRYSVVFQESSKFISLIISASQLEDSVKYYCALSE
Peromyscus maniculatus bairdii V1457 ighv AYHN01179040.1 1490 VQTEVQLVESGGGLVQPGGSLKLSCATSGFTFTDYWMHWVRQAPGKGLEWVGVIKHKPDNYATIYAESVKGRFTISRDDSKSSLYLQMNRLKVEDTAIYYCTS
Peromyscus maniculatus bairdii V1458 ighv AYHN01179041.1 22920 ILSQVQLQESGPGLVKPSQSLSLTCSVTGFSITSNAWSWIRQSPGQKLDWMGYISSGGSTSYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V1459 ighv AYHN01179041.1 10486 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITTSGYYWHWIRQSPGKKLEWMGYIGSGGDTYYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCA
Peromyscus maniculatus bairdii V1461 ighv AYHN01181081.1 1652 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWAWIRQSPGKKLEWMGYIRYSGETYYNPSLQSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V1462 igkv AYHN01181630.1 604 ARCDIQMTQSPSFLSASLGDRVTITCRASQGISSYLIWLQQKPGRAPKRLIYYASNLDNGVPSRFSGSGSGTDFSLTISSLESEDFATYYCLQYDKYP
Peromyscus maniculatus bairdii V1463 ighv AYHN01182706.1 11345 VHSQVQLQHSGAELVSPGVSVRLSCKASGYTFTNEYMHWVKQRPGQSLEWIGWIYPGSGNTKYNQKFQGKATLTVDKSSSTAYMELSSLTSEDSADYYCA
Peromyscus maniculatus bairdii V1464 ighv AYHN01182707.1 12746 VQCEVQLIVSQGGLAQTGGSITLSCAASGFTFSDHWMHWFRQAPGKGLEWVATIKYDGSARYYAESVNGRFTISRDNYKNSLYLQMSSLRNEDTAMYYCI
Peromyscus maniculatus bairdii V1465 ighv AYHN01182707.1 2974 ILSQVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYWWTWIRQSPGKKLEWMGYIHYGGSTYYNPSLQSRISITRETSKNQFFLQLNSVTTEDTATYYCAR
Peromyscus maniculatus bairdii V1466 trav AYHN01182958.1 1292 VNSQVGDENAWVLSIQEGENVTVNCSYKTAITALQWYRQESGRGPTMLILMRSNEREKRSGRLRATLDTSTQSSSLSITAAQAADTAVYFCARD
Peromyscus maniculatus bairdii V1468 iglv AYHN01184115.1 4072 SFSQPVPTQSPSDSASLGDSAKLTCTLSSQNSTNNIVWYQQHPDKAPKHLMRLQSDGSYSKGDGIPDRFSGSSSGPHHYLSISNTHPEDEAKYYCGVGDSNG
Peromyscus maniculatus bairdii V1469 igkv AYHN01185360.1 1337 SSGEIVLTQSPASMAASQGDRVTMTCITSSSISNSRLHWYQQKPGASPKLLIYGTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWNTS
Peromyscus maniculatus bairdii V1470 igkv AYHN01188123.1 1254 SGVRCDIQMTQSPASLSVSLGESVTMTCQASQGIGTLLAWYQQKPGKRPQLLMHYANRLADGVPSRFSGSGSGTQFSLKINGLQPEDVAAYYCQQG
Peromyscus maniculatus bairdii V1471 trdv AYHN01190740.1 1423 SNLGQKVTQVRSTTSTQEGEEITLDCSYETRSKFYYLFWYKQLLSGEMIFLIRQFSSSTQTEKSSGYSVVFQESSKSISLVISASQLEDSVKYFCVLWEQ
Peromyscus maniculatus bairdii V1474 trav AYHN01194888.1 3111 VKGQQVEQSPVSLVLQEGEHAELQCNFSTTATQMQWFYQSPGGHLKSLFYNPSGTKKSGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAMNAQCS
Peromyscus maniculatus bairdii V1476 igkv AYHN01196187.1 750 SRGDVVLTQTPLSLPVSLGDKASITCRSIQSLVLSDGYTYLDWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCMQGSYAP
Peromyscus maniculatus bairdii V1477 igkv AYHN01196719.1 5760 VQCDIHMTQSPVSLSAFIGDTVTITCRVSQDIGRYLGWYQQKVGESPRFLIYYASNLLSGVPKRFSGSGFGAEYTLTINSMEPEDAGTYYCQQCFSYP
Peromyscus maniculatus bairdii V1478 igkv AYHN01196719.1 3548 VTGETTTQSPPSLSFSPGETATLTCISSQSVGIYLAWYQQKPGQVPRLLIHSASTRASDVPVRFSGSGSGTDFTLTISTLEPEDVATYYCQPMIGWS
Peromyscus maniculatus bairdii V1479 igkv AYHN01197469.1 5029 ARCEIQMTQSPASLSVSLGESVTITCVASQSISSWLAWYQQKPGNPPKLLIYYATSLVDGVSSRFSGTGSGTQFSLKISSLKPEDVANYFCQQYNNYP
Peromyscus maniculatus bairdii V1481 igkv AYHN01197703.1 4629 VRCDIQMTQSPASLSASLGESVSMTCQASQDIYINLAWYQQKPGGPPKLLIYNANSLGDGVPSRFSGSGSGTQFSLKISSLEPEDVAIYYCQQYNNLP
Peromyscus maniculatus bairdii V1482 trav AYHN01198180.1 1490 VKGQQVKQSPVSLVLQEGERAELQCNFSTSATQVQWFHQSPGGHLVSLFYNPSGTKQSGRLMSTTVAKEYQSSLYISSSKTTDSGTYFCAMSAQCS
Peromyscus maniculatus bairdii V1483 igkv AYHN01201026.1 3736 ARCDIQVTQSPPSLSASIGDRVTITCLASQDINNNLNWYQQKSGQAPTLLIYYTTGLQSGVPSRFSGQNSGKSFTLTISSVEPEDVGTYFCLQ
Peromyscus maniculatus bairdii V1484 igkv AYHN01201026.1 1203 ARCDIQMTQSPSSLSASLGDRVTITCRASQGIGNYLNWYQQKPGKSLKCLINITNNLADGVPSRFSGSGSGTDFSLTISSLESEDTATYYCQQDYTP