WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Myotis davidii ALWT00000000.1 (ALWT01) 227 110 38 1 36 31 6 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Myotis davidii V0 ighv ALWT01000694.1 384 VLSQVQLQESGSTVVQPSQTLSLTCAIIGDSVSSNSAAWHWVRQPPEKGFQWLGRIYFSSKWYREYVPSLQSRLVIDPDTSKNQFSLQLRSVTTEDTAVYYCV
Myotis davidii V1 trav ALWT01001285.1 1738 ESTQQLEQTPRFLSIQEGENCTVSCSSSSVFPTFQWYRQEPGEGPVLLMTLTKGGEKKEQKRLMAQFGKERKDSSLLITAAQPGDAGIYLCAG
Myotis davidii V2 trav ALWT01001288.1 1737 VRSQEVQQSPQSLIIQEGEEVTIECKSSQPSYSLHWYWQKQGEGPIFLMILRKTGEESHDKITATLDEKKQQSSLYITASQPSHSGTYFCAVA
Myotis davidii V3 trdv ALWT01001288.1 7651 FIMTEKVTQTQTTVTVQEGEAVTMDCTYETSWSFYTLYWYKQPPSGEMVYLTYQEYSDFNAKQDRYFVNFQREKNFISLTISSLQLADSAKYFCALEI
Myotis davidii V4 trav ALWT01001291.1 4406 IMSDAKSTQPGAMESTAGEAVHLPCDHSTISGNEYIHWYRQIPHQGPEYVIHGLKDNVTKGTYSLIIATDRKSSTLILPQVSLRDSGVYYCILRD
Myotis davidii V5 trav ALWT01001293.1 9800 VSGQQLNQSPRSMSISEGEAISMSCISSSTFSTLLWYKQDAGGGPVLLITLYKGGEFIRNGKLTAQFGGTRKDSFLNISAPELADAGTYFCAG
Myotis davidii V6 trav ALWT01001293.1 17409 VYSDDKVLQSPPSLDVHEGDNATLHCRYEVASFQGLYWYKQKEKATIFLCRLITSDFDSGKIKGTIDKTERLSTLHITATQMEDSATYLCALE
Myotis davidii V7 trav ALWT01001293.1 22758 PGGADWIKPQETEVSGTEGESVKLLCNYGTSSRGTFDLYWFRQYPNQALEFILYRGWGYTGKGDAEFAIGKFYSDSSADTTNLYFRKLEFADTARYHCALRK
Myotis davidii V8 ighv ALWT01002116.1 526 VLSQVQLQESGPGLVKPSQTLSLTCSVSGFSITTSGYCWHWIRQPPGKRLEWIAIICYDGSTNYSPSFKSRTSITRDTSKNQFSLQLSSVTTEDMAMYYCAR
Myotis davidii V9 ighv ALWT01002119.1 5473 VLSQVQLQESGQGLVTPSQTLSLTCSVSGFSITTTYSYCNWICQPPGKGLEWLGYIDYDGDTYYSPSLKSLTSISRDTSKNQFSLQLSSVTAKDTAVYYCA
Myotis davidii V14 iglv ALWT01004832.1 6856 SWAQSVLTQPSSVSGVPGERVSISCTGSSTNVGYGDYVQWYQQLPGKAPKRIIYNSSKRPSGIPDRFSGSRSGSSASLTITGLQAEDEADYYCSSYESSPAG
Myotis davidii V15 iglv ALWT01004834.1 330 IDLQVQEAQRTPNKRNPGQTVTISCTDSSSKIGSNYVYWYQQLPGKAPKCIIYDNSNRLSGVPDRFSGTRSGSSASLTITGLQAEDEADYYCSGWDSSLSG
Myotis davidii V16 iglv ALWT01004836.1 84 SWAQSVLTQPSSVSGSLGQRVTISCTGSSTNVGSGYGVSWHQQLPGKAPKCIIYGDSTRPSGVPDRFSGSSSGSSGTLTITGLQAEDEAYYYCSAWDNTLDG
Myotis davidii V29 trgv ALWT01014744.1 595 GLGQLKLEQPKLSISWAKGESAQIPCKVSSSTFSKDYIHWYRQKPDQSIEHLIHVSSTATVFGKNNKLMASKYSQTSTSTLIINFLEKEDEAVYFCACWTG
Myotis davidii V52 ighv ALWT01029864.1 525 VQCEVQLVESGGGLVPPGGSLRLSCATSGFTFSSYWISWARQAPGKKLEWVSDINGDGSTIYYAASVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCARET
Myotis davidii V54 ighv ALWT01031570.1 790 VLSQVQLQESGPGVVKPSQTLSLTCTVSGFSLTSYGVHWTRQAPGKGLEWVGVVWYDGSTAYNPTLKSRLSITRDTSKSQVCLTLNSLRAEDTAVYYCA
Myotis davidii V74 iglv ALWT01052180.1 3313 SRSQAVVTQKPSESVVPGVTVTLTCSTNTGEVTSGHYPYWIQQKPGQVPRTLIYDTSSKLSWTPARFSGSIQGGKAALTLSGAQPEDEAGYYCALAYSSH
Myotis davidii V84 ighv ALWT01057522.1 622 VQCEVELVESGGGLGKPEGSLRLSCAASGYVSSSYYMNWVHQTTGKGLEWICAITTNGDSIYYADSVKGRFTISRDNAKNMVYLQMNSLKSEDMAVYYCAT
Myotis davidii V85 ighv ALWT01057529.1 780 VLSQVQLQELGPRLVKPSQTRSLSCTVSGFSITTSGYDWNWIRQPPGKGLEWIGRINFDGNIYYSPSLKSRISISRDTSKNQFFMKLSSVIMEDTAMYYCVRE
Myotis davidii V108 ighv ALWT01066870.1 114 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSCHGMHWVRQAPGKGLEWVSRIGSDGSSYIHCADSVKDRFTISRDNAKNMVYLQMSSLRPEDIALYYCAR
Myotis davidii V109 ighv ALWT01066871.1 364 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSISSGYYWSWIRQPPGKGLEWIVSKHSSGSTYYSPSLKSRTSISIDTSKNQFSLQLSSVTVEDTAMYYCAR
Myotis davidii V123 iglv ALWT01081634.1 1262 LCADLVLTQPPSASAAPGASAKLTCTLSAEHSSYYIHWYQQKPGQAPRYLMKVNSDGSHTKGNGIPDRFSGSSSGVNRYLTISSLQSEDEADYYCGADYSSWSY
Myotis davidii V124 iglv ALWT01081635.1 50 SVASSELTQPPAVSVALGQTARITCQGDLVTKVYPRWLQQKPGQAPMLLIHGDENRTSTIPERFSGSDSGDTSTLTISGAQAQDEADYYCSAWDKNAK
Myotis davidii V125 iglv ALWT01081638.1 535 SVASSVVTQPPAVSVAPGQTARITCQGNPLTSYYPSWHQQKPGQAPVVVVYGNNNRPSGIPERFSSSDSGDTNTLTISGAQVQDEADYYCSVWDGSAD
Myotis davidii V127 trbv ALWT01082333.1 863 SLDTAVLQTPKYLITQVGNQKSLSCEQKLNHNAMYWYKQDSKQLLKIMFSYSNKALILNETVPSRFLPESPDKAHLKLHINSLETGDSAVYLCASSK
Myotis davidii V137 ighv ALWT01088795.1 200 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSVTSSYWWSWICQPLGKGLEWIGDIWHDGDTNYSPSLKTRTSMSIDTYKNQFSLKLSSMTTKDTAVYYCA
Myotis davidii V138 ighv ALWT01088801.1 1081 VLSQVQLQESGPGLMKPSQTLSLTCSVSGFSITTSGYGWSWIRQPPGKGLEWIVRIDYDGDTFYSPSLKRRTSISKDTSKNQFSLQLRSVTTEDTAVYYCA
Myotis davidii V139 ighv ALWT01088815.1 1965 VHSQVQLVQSGAELRKPGASVKISCRTSGYTFTSYWMHWVRQAPGQGLEWVGRVYPGDGDTNYAQKFQGRVSITGDKSMSTAYMELRSLRPEDTAVYYCA
Myotis davidii V140 ighv ALWT01088823.1 449 VQCEEQLVESGGGLVQPGGSLRLSCAASGFTFSEYEMKWVHQAPGKGLEWVSAIDGDGGGTYYANSVKGHFTISRDNAKDTLYLQMNSLRAEDTAVYYCAG
Myotis davidii V143 ighv ALWT01090243.1 1970 VLSQVQLQESGPGLVKPSQTLSLTCSVSAYSITSGYWSWIRQPPGKGLEWIAHINYDGETFYSPSLKSQTTISRDTSKNQFSLLLSSLTTKNTAVYYCAK
Myotis davidii V146 iglv ALWT01091565.1 2986 SWAQFVLTQPPSVSESPGQKAVISCTRSSGSIGSNYVHWYQQRPGRAPTMVIYNDNQRPSGVPDRFSGSIDSSSNAAHLTISGLQPEDEADYYCLSYGYDSY
Myotis davidii V147 iglv ALWT01091568.1 4061 SWAEVVFTQPPSVSGSPGQKAIISCTRSSGNIGNNYVSWFQQRPGRAPTLMIYEDDKRPSGVPDRFSGSIDSSSNAAHLTISGLQPEDEADYYCLSGYDSY
Myotis davidii V176 ighv ALWT01108989.1 10938 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYRMNWVRQAPGKGLEWVSYINEDGSSTYYANSVKGRFTISRDNDKNTLYLQMNSLRSQDTAAYYCLR
Myotis davidii V177 ighv ALWT01108990.1 22346 VQCDVQLVESGGGLVQTGGSLRLSCAASGFTFNSYWMNWVRQAPGKGLEWVSTITHTADSTYYPDSVKGRFTISRDNAKNMLYLQMNSLRAEDTAVYYCA
Myotis davidii V178 ighv ALWT01108990.1 26022 VLSQVQLQESGPGLVKPSQTLSLICTVSGYSITSGYCWTWIRQPQGKGLEWMGCIGYDGNTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDMAVYYCAT
Myotis davidii V179 ighv ALWT01108990.1 30293 AAGGVWGKLGAAWGSLRLFCAASRFTFSSYGMNWVHQVPGKGLEWVAGVSSIGGTTYYADSVKGRFTVSRDNTKNTLYLQMNSLRTEDVAVYFCAS
Myotis davidii V180 ighv ALWT01108993.1 3885 VQCEVQLVASGGSLVKPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLQWLSHINPDGSGSYYADSVKGRFTTSRDNAKNMLYLQMNSLRAEEMAMYYCARE
Myotis davidii V181 ighv ALWT01108994.1 2683 VRCEVQLVESGGGLVLPGGSQRLSCAASGFTFSSSWMHWVRQAPGKGLEWLCQINPDGSSTYYANSVKGRFTISRDNAKNMLHLQMNSLRAEESALYYCA
Myotis davidii V182 ighv ALWT01108994.1 5664 VLSQVQLREWGPGLVKHSQTLSVTCADHGVSITTSGYCWNWIRQPPGKGLEWMGCIDYDGNTYYSPSLKTRTSISRDTSKNQVSLQLSSVTMDDTAVYYCVR
Myotis davidii V183 ighv ALWT01109000.1 9633 GLCQVQLVQSGGGVVPPGGSLSLSCRASGFNFTNYEMNWVRQAPGKGLQWVAKVSKPTGKNQWYAPAVQGKFTISRDNPTSTVSLKMTKLTSEDTAMYYCTR
Myotis davidii V184 ighv ALWT01109000.1 13076 RTPGESLRISCRTSGCSFTCCWFHWERQTLGKSLEWMGRIWPGDGDTRYSQSFRGHITISTDNSTSTGYLQWSSLKASDKAMYYCARDTMRK
Myotis davidii V185 ighv ALWT01109002.1 3491 VLSQVQLQESGPGLVKPSQTLTLTCTVSVFSLMSYQVHWIRKPLWKGLEWMGRINNNGDTYYSPSLKSRTSISRDTSKNQVSMQLSSVITEDTAVYYCAR
Myotis davidii V186 ighv ALWT01109004.1 269 VHSQVQLVQSGAEVRKAGASVKVSCKVSGYIFTSYYVSWVRQAPGKDLQYMGWINTETGKPKYAQGISERGVFSMDTSISIAYLQINGLKSEDTAVYYCA
Myotis davidii V187 ighv ALWT01109008.1 7373 ILSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYHVHWIRQAPGKGLEWVGVIWNGGGTNYNPTLKSRLSITRDTSKSQVYLTLNSLRTEDTAMYYCARE
Myotis davidii V188 ighv ALWT01109011.1 5447 VVSQVQLLESGPGLVKPSQTLSLTCTVSGFSITTSSYDWTWIRQTPGKRLEWMGCINNNGDTYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCSR
Myotis davidii V194 ighv ALWT01113074.1 572 GLCQVQLVESGGDVVLPRASLSLSCKASGFTFTNYSMHWVRQAPGKGLQWVARVSKPTGKDQWYAPAVQGRFTISRDNPTNTVSLKMTKLTSEDTAVYYCT
Myotis davidii V195 ighv ALWT01113623.1 94 QVLEWMGRVEEMRKSGTSVKVSCKASGYTFTSNYIHWVRQAPGQVLEWMGRVDPEDGETNYAQKFQDRVSMTGDRSTSTAYMELRSLRAEDTAVYYCAR
Myotis davidii V209 ighv ALWT01123517.1 863 VHSQVQLVQSGAELRKPGASVKVSCKASAYTFTSYFMHWVRQAPGQGLEWMGRVYPGDGNTVYAQKFQGRVSITRDMSRSTVYMELSSLRAEDTAVYYCA
Myotis davidii V217 ighv ALWT01127301.1 1543 CLCQVQLVESGGGVVPPVGLPLSLSCKASGFNFTDYQMHWVRQAPGKGLQWVAGVSYPTGKKQWYAPAVQGRFTISRDNPTSTVSLKMTKLTSEDTAIYYCTR
Myotis davidii V218 ighv ALWT01127305.1 2164 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSSYHMTWVRQAPGKGLEWVAVIWNDESQKNYADSVKGRFTISRDNAKNMLYLQMNSLRAQDSAMYYCAR
Myotis davidii V222 ighv ALWT01128930.1 15 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFNNAGMNWVRQAPGKRLEWVAIIWFDGSQKYYADSVKGHFTISRDNSKNMLYLQMNSLRAEDTALYYCAA
Myotis davidii V233 ighv ALWT01137152.1 983 AAGGVGGGLVQPGGSLRLSCAASGFTFSSYEMHWVHKAPRKGLEWVTYTGSGDGNPIYYAASVKGRFTISRDNAKNTLYLQMSSLKAEDTAVYYCAR
Myotis davidii V234 iglv ALWT01137427.1 35 SVASSGVTQPPAVSVAPGQMAKITCQGELIEKAYPVWLQQKPGQAPVVVMYGDNERPSGIPERFSASDSGDTNTLTISGAQAQDEADYYCSAWDDSAK
Myotis davidii V242 ighv ALWT01138883.1 1081 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNLVSQAPGKGLEWFSYINGGGGSIYYANCMKGCFTKSRDNAKNLLYLQMSSLRAEDKALYYCAR
Myotis davidii V243 trav ALWT01139157.1 1623 GVTGMNVEQSPSILILQEGTSSTLRCNFSTSVRNVQWFLQNPGGGLINLFYLASGTKHSGRLSSTLNSKDLYSTLSITASQLEDSATYLCAAE
Myotis davidii V244 trav ALWT01139158.1 1956 VSHGEKVDQHPSTLNVQEGNTAVINCSYSDSASNYFPWYKQELGKGPQLSIHILSNKDKIQAGRLTVFMNKAAKHLSLHIAATQPGDSAVYFCAAS
Myotis davidii V245 trav ALWT01139158.1 11199 QTHGDSVTQMEGQVTLLEGAPLTVNCTYSATGYPTLFWYVQYPGESPQFLLKAATVNGKGRNKGFEATYQKQPNAFHLEKASAHQADSAMYYCVLG
Myotis davidii V258 trbv ALWT01146213.1 3236 VGAQTIHQWPSTKVKLKGSPLSLECTVKGTSSPNLYWYRQAEGGGPQMLFYSITAGQVDSQAPENFEASRPEDGYFILRSKKLLLIDSGFYLCAWS
Myotis davidii V261 iglv ALWT01148546.1 284 SVASYELTQPPSVSVSPGQTARLTCGGNNIGGKSAYWYQQKPGQAPVLVIYSDNERPSGIPDRFSGTNSGNTATLTISGAQAQDEADYYCAVWDSSAK
Myotis davidii V265 ighv ALWT01149964.1 6692 GLCQVQLVESGGGVVPPGGTLSLSCKASGFTFTNYSMYWVRQAPEKGLQWVATVSQPNGKNQWYAPAVQGRFTISRDNPTSTVSLKMTKLTSEDTAIYYCTR
Myotis davidii V266 ighv ALWT01149964.1 10317 VHSQVQLVQSGSEVRKPGASVKVSCKASGYTFTSYAMNWVRQAPGKALQYMGWINTETGKPTYAQGFSERFVFSMDTSVSTAYLQINGLKSEDTAMYYCA
Myotis davidii V267 ighv ALWT01149965.1 2488 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYAIHWVRQAPGERLKYMGWINTNTGKPTYAQGFSERFVFSMDTSVSTAYLQINGLKSEDTAMYYCAR
Myotis davidii V268 ighv ALWT01149966.1 4096 AAGGVGRKLGSAWGSLRLSCAASGFTFSGNWMSWVHGAPGKKLEWVSDINGDSSTAYYVASVNGRFTISRDNTKNTLFLQMNSLRAEDTALYYCVRE
Myotis davidii V269 ighv ALWT01149971.1 1569 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYSMRWVRQAPGKGLQYMGWINTETGKPTYAQGFSERFVFSMDTSVSTAYLQINGLKSEDTAMYYCA
Myotis davidii V273 iglv ALWT01153407.1 2351 CGPQPMLDQPPSVSSPLGTTIRLACTLSKDHDVSIYSIYWYQQRPGHPPRFLLRYFSHSDKRQGPKVPPRFSGSKDVAENTGYLSISGLQPEDEAMYYCAV
Myotis davidii V303 ighv ALWT01172422.1 1152 VQCEVQLMESGRGLVQPGGSLRLSCAASGFTFSSNGMNWVRQAPGKGLEWVAVIWNDGSQKYYADSVKGRFTISRDNAKNTLYLQMSNLRAEDMAIYYCAR
Myotis davidii V307 ighv ALWT01175490.1 695 VHCEEQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVHQAPGKGLEWVSYISTGGSTYYANSVKGRFTISRDNTNNMLSLQMNSLRAEDTAVYYCAR
Myotis davidii V333 ighv ALWT01189084.1 1650 HVVSLCLQVSSVRCSWWPLWSRRLSCAASGFTFDNHAMHWVRQAPGKGLEWVSYISWNGGSTYYAASVKGRFTISRDNAKNTLFLQMNSLRAEDTAVYYCAR
Myotis davidii V337 iglv ALWT01191315.1 450 VDSQTVVTQEPSMSISAGGTVTLTCGLSSGSVSGNYPSWYQQTPGKPPRMLIYSTNSRPSGVPDRFSGFISGNKAALTISGAQPEDEADYYCALDMGSYV
Myotis davidii V338 iglv ALWT01191316.1 2369 TGLPTAAQEPSNVSSAGGTVTLTCGLSSGAVSSGNYPSWLQQTPGKPPRQLIYYTNTRPSGVPDRFSGSISGNKAALTISGAQPEDEADYHCALYLGSG
Myotis davidii V339 iglv ALWT01191317.1 1924 SRSQAVVTQEPSMTVSPGGTVTLTCGSSTGAVTDGLYPYWIQQKPGQVPRTLIYNTDKKHSWTPARFSGAIQGGKAALTLSAAQPEDEAEYYCWLYFSG
Myotis davidii V340 iglv ALWT01191317.1 5554 SRSQAVVTQEPSATVSSGGTVTLTCGSSTGAVTDGHYPYWFQQKPGQAPRTLIYNTNNRLSWTPARFSGSIRGGKAALTLAGAQPEDEAVYHCWLVYSGA
Myotis davidii V341 iglv ALWT01191317.1 7571 ATSQSVIQQSSLITNPGGTVILTCGASTGAAITTGNYASWIQQKPYQVPKGIIGGTTNRVPGVPVRFSGALAGGKATLTITGAQPEDEAEYYCALWFSNH
Myotis davidii V342 iglv ALWT01191321.1 4058 SWAQAPLTQPPSVSGTPGTTVTISCAGSSSDIGSTSYVSWFQQRPGTTPKVLIYRVSSRPSSIPERFSGSKSGNTATLTIAGLQAEDEADYYCCSYTTS
Myotis davidii V343 iglv ALWT01191325.1 1315 SWAQAALTQLPSVSGNMGQSVTLSCVGSSNDIGRYNYISWYQQRPGTAPKLLISYVNARHSGVPERFSGFKSSNTAFLLISGLQAEDEADYHCFSYVGS
Myotis davidii V344 iglv ALWT01191325.1 4892 SWAQAPLTQPPSLSGNPGTSVTISCAGSSNDIGRYNDVSWYQQRPGAAPKLLIYRVSNRPSGIPERFSGSKSGNTATLTIAGLQAEDEADYYCCSYAGS
Myotis davidii V345 iglv ALWT01191326.1 341 SLAQAPLTQPPSVTGTPGTTVTISCAGSSNDVGGYNLVSWFQQRPGTAPKLLIYSVSSRPSGIPERFSGSKSGNTATLTIAGLQAEDEADYHCCSYRYTDS
Myotis davidii V346 ighv ALWT01192632.1 5343 VHSQVQLVQSGAEVRKPGDSVKISCKTSGYTFTSFIISWVRQASGESMKYMGWIKTETGAPTYAQGFSERFVFSMDTSISTAYLQINGLKSEDTAMYYCARE
Myotis davidii V347 ighv ALWT01192638.1 1380 VHSQVQLVQSGAEVRKPGASVKISCKASGYTFTSYYMQWVQQAPGQGLEWIGRVNPNNGDTNYAQKFQGRVSITRDTSINTAYMELSSLRVEDTAVYYCAT
Myotis davidii V348 ighv ALWT01192640.1 1605 VLSEVQLQESGPGLVKPSQTLSLICTVSGFSLTSYSVQWTRQVPGKELEWVGGIWGNGGTHYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAMYYCSG
Myotis davidii V349 igkv ALWT01192826.1 1719 ATGSTVLSQSPALLSVSLRESVSMTCKANQSISDYLTWYQQKPGQAPKLLIYDADDPYTDVPARFTGIQSGTEFILKISEVEADDAATYYCQQDYLVP
Myotis davidii V351 ighv ALWT01194039.1 592 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEWVSRIGSDGSSYIYYADSVKGRFTISRDNAKNTLYLQMSSLRSEDTALYYCAR
Myotis davidii V355 trav ALWT01196984.1 392 GVRGMNVEQSPSVLSLQEGTSSTLRCNFSTTVTKLQWFRQNPGGGLINLFYLASGTKHSGRLSSTLNSKDLYSTLSITASQLEDSATYLCAAD
Myotis davidii V356 ighv ALWT01198670.1 2862 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSNWMSWVRQAPGKGKEWLCRMNPDGSTTDYASSVKGRFTISRDNAKNMLYLQMNSLRVEEMAMYYCA
Myotis davidii V357 ighv ALWT01198670.1 6443 VLCQVQLLEWGPGLVKLSQTLSVTCADHKISITTSGYCWSWIRQPPGKGLEWMGCICHDGNTYYSPSLKSRTSISRDTSKNQVSLQLRSVTTDDTAVYYCAR
Myotis davidii V358 ighv ALWT01198671.1 3177 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFSSYDIHWIRQAPGKGLEWVAHIWTDGSQKYYAESVKGRFTISRDNAKNMSYLQMNSLRVEDMAVYYCA
Myotis davidii V359 ighv ALWT01198672.1 2007 VQCEVQLVESGGGLVQPGGSLSLSCAASGFTFSSYGMSWIHQAPGKGLEWVAVIWNDGSQKYYADSVKGRFTISRDNAKNTLYLQINSLGAQDMAIYYCVR
Myotis davidii V360 ighv ALWT01198672.1 7553 VLSQVPLQESGPGLVEPSQTLSLTCTVTGFSLTSIGVHWTRQAPGKGLEWVGVIWNTGNTAYNPTLKSRISITRDRSKSQVYLTLNSLRTEDTALYYCAK
Myotis davidii V362 ighv ALWT01198741.1 2591 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMYWVRQAPGQGLEWVGCVYPGNGNTYYAQKFQGRVSMTRDTSTSNAYMELSSLRAEDTAVYYCAR
Myotis davidii V363 ighv ALWT01198744.1 946 SGPGLVTPSHTLSLTCSVSGFSITTSGYCWNWIRQPPGKRLEWMGSICYELRGSVWGVANTRNNYYSPSLKSRTSISIDTSKNQFSLQMSSVTTEDTAVYYCA
Myotis davidii V367 ighv ALWT01199561.1 785 VQCEVQLVESGGGLVQPEGSLRLICTASGFTFSSYHMTWVGQAPGKGLEWVAIIWNDGSQKYYADSVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYYCAR
Myotis davidii V368 ighv ALWT01199564.1 5636 VQCEVQLVESGGGLVQPGGSLTLSCAASGFTFSSYWMGWVRQAPLQILEWVSFITDYGGSIYYANTAKGRLSISRDNAKNMLYLQMNSQTSEDTAMYYCA
Myotis davidii V369 ighv ALWT01199567.1 10289 VQCEVQLVESGGGLVQPGASLRLSCAASGFTFSDYEMDWVRQAPGKGLEWVSYINPDGSSTFYANSVKGRFTISRDNAKNTLYLQMNSLRDEDMALYYCAR
Myotis davidii V370 ighv ALWT01199571.1 10010 VQCDVQLAESGGDLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGEGLEWVSLINPDGSSTYYANSVKGRFTTSRDNAKNMVYLQMNSLKAQDTALYYCSR
Myotis davidii V371 ighv ALWT01199572.1 4110 VQCEVQLVESGGGLGKPEGSLRLSCAASGYSSSSYYMNWVRQTPGKRLEWICAITGNGDSTYYADSVKGRFTISRDNAKNTVYLQMNSLKSEDTAVYYCAT
Myotis davidii V372 ighv ALWT01199576.1 6179 AQCEVQLMESGGDLVQPGGSLRLSCVGSGFTFSSNNMNWVRQAPGKGLEWVSYINPDGSSTYYANSVKGRFTISRDNTRNMLYLQMNSLKAEDMALYYCTT
Myotis davidii V373 ighv ALWT01199578.1 1532 VLSQVQLQGWGPGLVKPSQTLTLTCAVYEFSITTSSYDWSWIRQPPGKGLEWMGCINHNGDTKYSSSLKSRISISRDTSKNQFSLQLSSVTTEDTALYYCV
Myotis davidii V374 ighv ALWT01199578.1 7719 VQCEVQLVESGGDLVRTGGSLRLSCAASGFTFSSSWMNWVRQAPGKGLEWVSYIRGDGSTTSYADSVKGRFTISRDNAKNTLYLQMNSVRAEDTAVYYCAR
Myotis davidii V376 ighv ALWT01199579.1 5926 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSSWMHWIRQVPEKRLEWLCRINPDGSTTNYADSVKGRFTISRDNAKNMLFLQMNSLRAEDTAMYYCTA
Myotis davidii V377 ighv ALWT01199580.1 4669 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLSSNGVHWNRQAPGKRLEWIGVIWADVSRIYNPTLKSRVSITKDTSNSQVYLTLNSLVAEDTARYYCA
Myotis davidii V378 ighv ALWT01199586.1 7971 IQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSNWMSWVRQAPGKGLEWIGIISTDGGTTNYADSVKGRFTISRDNAKNTLYLQMNSLTAKDTAVYYCA
Myotis davidii V379 ighv ALWT01199586.1 11871 VQCEVQLVESGEGLVKPGGSLSLSCKGSGFTFSDYYISWIRHTPGKGWEWIGYIRNKANGHTTEYSPSVKGRVTISRDDSQSTADLQMSSLREEDTAVYYCTTE
Myotis davidii V380 ighv ALWT01199598.1 4815 VQCEVQLVESWGGLVPPEGSHRLSCAASAFILSDHWRGWVRRAPGKVLEWLDEITPDGSTTHYAKSVKGQFTISRDNAKNMLYVQMNSLRATDTAVYYCA
Myotis davidii V383 ighv ALWT01201474.1 21 VQCAEQLVESGGGLVQPGGSLRLSCAASGFTFSRDDMSWVRQAPGKGLEWVAYISNGAVSTYYADAVKGRFTVSRDNAKNSLSLQMSNLRAEDTAVYYCAR
Myotis davidii V391 ighv ALWT01208783.1 621 VLSQVQLQESGPGLVKPSQTLSLTCSVSGYSITSGYDWSWIRQPPGKGLEWIGYISSGGSTYYSSSLKSRTSISRDTSKNQFSLQLSSVTTQDTAVYYCAG
Myotis davidii V392 ighv ALWT01208785.1 552 VQSEEQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMYWVRQAPGKGLEWVSLINWNGGSKYYAASVKGRFTISRDNTKNTLYLQMSSLRAEDTAVYYCAR
Myotis davidii V402 trav ALWT01213029.1 2452 GIRAQTVTQPEDIISVLEGASVEVKCNYVYSGSPVLFWYVQYPRQSPQLLLKHFSGESVKGFTAVLDKSEASFHLKKPSAQEEDSAVYYCAVS
Myotis davidii V403 trav ALWT01213030.1 2182 SSMTQKVIQAQSAISVVEKEAVTLNCAYEVSSYNYYLFWYKQPPSGKMTFLIHQESYNEQNTTEGRYSLNFQKSASSISLTITDSQLGDSAVYFCALRD
Myotis davidii V404 trav ALWT01213030.1 11921 VTNGDSVTQTEGPVTLTEGASVILNCNYQTTYSAPYLFWYVQYRNKAPSLLLKSSTEHQTAEHQGFQAKLVKSDSSFHLEKSSLHMSDSAVYYCALR
Myotis davidii V405 trav ALWT01213033.1 122 LSGEDQVEQSPQTLRVQEGDNVSLTCSYTVSTFRGLQWYRQDPGKGPEHLFLLYSVGKGQQKGRLSVSLSQKESSLHITTPKAEDSATYLCAVE
Myotis davidii V406 trav ALWT01213035.1 1613 VSSEQAVNQSPGALTVHEGDSLFLNCSYTDSAIYFLQWFRQDPGKGLTSLFLIQSSQREITSGRIKVLLDKMSRHSALYIATSQLGDSATYLCVV
Myotis davidii V407 trav ALWT01213035.1 12375 VRGVQVEQSPPALILQEGASSTLWCNFSTSVNNVQWFRQNPGGRLVNLFYIPSGTKWNGNLKATTDLKERRSSLHVSSSQATDSAIYFCAVEPQCFP
Myotis davidii V416 iglv ALWT01218186.1 261 SWAQSVVTQPPSVSGSPGERVTISCTGSSTNVGSHVVSWYQQLPGKTPKYIICKDSSRFSGVPDRFSGSKSGTSAFLTVAGLQAEDEADYYCLAWDKTLDG
Myotis davidii V430 iglv ALWT01224560.1 249 PVASSVVTQPPAVSVAPGQTARITCQGELVKESYASWYQQKPGQAPVLVVYSDENRTSKIPERFSGSDSGDTDTLTISRAQAQDYYCAVLDNIAE
Myotis davidii V432 trav ALWT01226173.1 2983 SSVAQKVTQPQQEMSVQEAETATLACTYDTSQSEYYLFWYKQPPSGEMIFIIRQEAFKQQNATDNRFSVNFQKATKNFSLRISDCQLEDAAVYFCALR
Myotis davidii V433 trav ALWT01226178.1 723 VNGKNEVEQSPQHLGAQEGDVITINCSYSIGMTTLHWMRQNPGGGIVSLFTLSLEMKKKGRISATINTKERHSALHISAAQPRDSAVYLCAVE
Myotis davidii V434 trdv ALWT01226186.1 1515 VSLDIILESDTQTLTVLVGEAATFHCRVTGADLKNYQMSWYKKHEDNSLTLVYRLSNNSNDHLRSNIKGKIDILNNQYILDIQKATTKDVGTYYCGSD
Myotis davidii V435 trdv ALWT01226188.1 11284 VMSAIVLVSQDQVVTMSLGMSATLRCSLKGETISNYYISWYRQTQGNTMTFIHREGGMYGRGFFSKFRANINDSNNEAELEILKASERDEGIYYCASD
Myotis davidii V446 trav ALWT01271809.1 115 DARAQSVSQPDYHVSVSERASLELRCTYVYAATPYLFWYVQYPSQGLQLLLKNFSGKTLVQGIKGFEAEFKKNESSFILRKSSAHWSDSAVYFCALS
Myotis davidii V453 trav ALWT01292255.1 38 LSSQKMEQNPQSLSIQESEKAILTCSYANYSPVFFQWYRQDPGRGPVFLLLIHENERTKLLGRLRATFDTTIKQSSFYITASQPADSATYLCATGTQ
Myotis davidii V455 trgv ALWT01299542.1 411 GLGLSTLEQSQLSVTTEVGGIIDIGCKITSTNFEQDIIHWYRQKPNQALEHLISVSSTEGPARSHVDGKRNKVEAGKNSQLLTSTLRIYFIGKEDTGTYYCAGW
Myotis davidii V475 ighv ALWT01000176.1 3331 VQCEGQLVESEGGLVQPGGSLRLSCAASGFTFSSYNMNWVRQAPGKGLEWVARITNSGDSSYYADYVKGRFTISRDNAKNTLYLQMNSLRVVDTAVYYCTT
Myotis davidii V476 ighv ALWT01000207.1 1994 VQCDTQLVESGGGFVQPGESLRLSCAASGFTFSSSWMDWVRQAPGKGLEWLCRINPDGSTTYYANSVKGQFTTSRDNAKNLLYLQMNSLRAQDRAVYYCVT
Myotis davidii V477 ighv ALWT01000813.1 2331 VQCEVQLVESGGGLVQPGGSLRLSCAASGFNFGSYGMHWIRQAPGKGLEWVAVIWYDGSQKYYADSVKDRFTISRDNAKNMLYLQMNSLRAQDTAVYYCAR
Myotis davidii V481 ighv ALWT01005496.1 2613 VLSQVQLWEWGPGLVKPSQTLSVTCADHGVSITTSGYSWSWIRQPQGKGLEWMGCIYHNGNTYYSPSLKSRTSISRDTSKNQVSLQLRSVTTDETVVYYCAR
Myotis davidii V483 ighv ALWT01007902.1 4838 VQCVKHLVESGGGLVQPGGRVSLRLSCAASGFTFSSYWMHWVRQPTGKGLEWVSVISYSSNTIYYTDSVKGRLTISRDNAKNSLYLQMSSLRAKDTTVYYCA
Myotis davidii V484 ighv ALWT01007904.1 4784 VLSQVQLQELGPGLVKPSQTLSLTCTVSGGSVTTSDYWSWIRQSPGERLQWMGHWRGGTIYNPAFQGRISITADTARNQFSLQLSSLTTEDTAMYYCAR
Myotis davidii V485 ighv ALWT01007912.1 5832 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYPVHWVRQAPGQGLEWVGIVFPLLEITNYAQKFQGRVSITGDTSTNTFYMELSNLRAEDTAMYYCA
Myotis davidii V488 ighv ALWT01010967.1 4485 VHSQVQLVQSGAEVRKPGASMKVSCKASGYTFTSYYMHWVEQAPGQGLKRMGIVFPLLGITNYTQKFQGRVSITEDTSTSTACMELSSLRAKETSLYYCER
Myotis davidii V490 iglv ALWT01012916.1 431 LCADPVLTQPPSASAALGASVKLTCTLSAEHSSYNYVSWYQQKAGQAPRYIMYINSDGSHSKGDGIPDRFSGSSSGADRYLTISSLQSEDEAKYYCGVYGSSY
Myotis davidii V493 ighv ALWT01015792.1 1754 VQCEEQLVESGGGLVQPGGSLRVSCAASGFTFSSYWMSWARQAPGKGLEWLGEINPDGSTTNHDNAVKGRFTISRDNARNTLYLQMNSLRAQDMALYYCTT
Myotis davidii V509 ighv ALWT01027137.1 2075 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTSGYYWSWIRQPPGKGLEWIMSIYSSGSTYYNPSLKSRTSISRDTSKNQFSLQLSSMTTEDTAVYYCA
Myotis davidii V513 ighv ALWT01031566.1 663 VYSQVQLVQSGAEVRKPGASVKVSCKVSGYTFTSYWMHWVRQAPGQGHEWVGWFYPNSGDTQYSQKFQGRVSMTRDISTNTAYMEISSLRAEDSAMYYCAR
Myotis davidii V514 ighv ALWT01031566.1 339 SVSPDINFPARESGAEVRKPGASVKVSCKVSGYTFTSYWMHWVRQAPGQGHEWVGWFYPNSGDTQYSQKFQGRVSMTRDISTNTAYMEISSLRAEDLAMYYCAR
Myotis davidii V538 iglv ALWT01044869.1 3403 VDSQTVVTQEPSVSVSPGGTVTLTCGTSSGAVSSGNHPSWYQQTPGRATRRLIYETNKRPSGVPDRFSGSISGNKAALTISGAQPEDEANYYCALYNAGAL
Myotis davidii V539 iglv ALWT01044870.1 4566 VDSQTVVTQEPLVSISPGGTVTLTCGLSSGAVSSSNYPSWYQQTPGKPPRTLIYNTNSRPSGVPDRFSGSISGNKAALTISGAQPEDEDNYYCA
Myotis davidii V540 iglv ALWT01044870.1 1976 SGVRAGLTQEASLSGSLGQKVTLSCTGNSNNVGARTVGWYQQVTGATPKPVMLGTSRPSGIPDRFSGSKSGNTASLVITGRQPEDEADYYCSTW
Myotis davidii V541 iglv ALWT01044871.1 1425 SGVRAGLTQEASLSGSLGQKVTLTCTGNSNNVGSYGVGWYQQVTGSAPKTVMLGTSRPSGIPDRFSGSKSGNTASLVITGRQPEDEADYYCSTWDYGIS
Myotis davidii V542 iglv ALWT01044872.1 1639 SLSQPVLTQPPSLSASPGASARLPCTLSSGAVVAGYHISWYQQKPGSPPRFLLRYKSDSDKGQGSGVPSYFSGTKDASANAGLLLISGLQPEDEAEYYCAT
Myotis davidii V543 iglv ALWT01044874.1 1092 SLSQPVVTQPPSLSASPGASARLPCTLSSGAVVAGYHISWYQQKPGRPPRYLLRYKSDSDKHQGSGVPSRFSGTKDASANAGLLPISGLQPEDEAEYYCAT
Myotis davidii V544 iglv ALWT01044884.1 1614 VDSQTVVTQEPSVSISAGGTVTLTCGLSSGAVSSGNHPSWFQQTPGKPPRMLIYSTNTRPSGVPDRFSGSISGNKAALTISGAQPEDEADYHCL
Myotis davidii V545 iglv ALWT01044885.1 931 VDSQTVVTQEPSMSVSAGGTVTLTCGLSSGSVSGNYPGWFQQTPGKPPRTLIYNTNNRPSGVPDHFSGSISGNKAALTISGAQPEDEADYYCSLHLDGATY
Myotis davidii V554 ighv ALWT01052203.1 1206 VQCEEQLVESGGGLVQPGWSMRLSCAASGFTFDDYAMLWVRHVSYINWNGGSTYYTASVKGHFTISRDSAKNTLFLQMNSLRAEDRAVYYCAR
Myotis davidii V555 iglv ALWT01052817.1 1485 SVASYELTQPPSVSVSPGQMAKLTCGGNNIGSKYTHWYQQKPGQAPVLVIYRNNNRPSGIPDRYSGTNSGNTATLTISGVQAQDEADYYCQVWDSSAD
Myotis davidii V561 ighv ALWT01057128.1 14109 VGVGPRTGEALTDTLPQLHCLFLLHQQWLLLELNPLAPRKGLEWMVYICYDGNTYYSPSLKSQTSISRDTPKNQFSLQLSFMTTEDMAMYFCVR
Myotis davidii V562 ighv ALWT01057137.1 1265 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYYIHWVQQAPGQGLQWVGWVYPNNGNTKYAQKFQGRVSMTRDISTSTAYMELSSLRAEDTAMYYCAR
Myotis davidii V563 ighv ALWT01057138.1 5094 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMDWVRQAPGKGLEWLCRMNPDGSTTHYANSVKGRFTISRDNAKNMLYLQMNSLRADETAMYYCAR
Myotis davidii V564 ighv ALWT01057139.1 9573 AAGGVRGRLGAASGWGGVTLRLSCVTSGFTFSSYWMNWVHQASWKRLEWLYQMNPDESTTNYANSVKGQFTISRDNTKNMLYLQMNSLRATDMDLYHCV
Myotis davidii V565 ighv ALWT01057139.1 4773 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVQWTRQVPGKGLEWVGGIWANGGTYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTALYYCAR
Myotis davidii V568 ighv ALWT01057360.1 9004 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMQWVRQAPGKGLEWMGEVNPNNGNTNYAQKFQGRVSMTRDTSMSTAYMELSSLRAEDTAIYYCTT
Myotis davidii V569 ighv ALWT01057361.1 26068 VHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYWMNWVRQAPGQGLEWMGRVNPSNGDTNYAQKFQGRVSITRDTSINTAYMELSSLRVEDTAVYYCTT
Myotis davidii V570 ighv ALWT01057361.1 21727 VLSQVQLQESGSGLVKPSQTLSLICTVSGFCLRSYTVQWTRHAPGKGLEWVGGIWGNGDTYYNPTLKSRLSITRDTSKSQVYLTLNSLRAEDTAVYYCAR
Myotis davidii V571 ighv ALWT01057361.1 4846 GLCQVQLVESGGGVVPPGGSLSLSCKASGFTFTNYSMHWVRQAPGKGLQWVARVSKPTGKDQWYAPAVQGRFTISRDNPTNTVSLKMTKLTSEDTAVYYCT
Myotis davidii V573 trgv ALWT01057843.1 2899 GDTKMRISQDQLSFIRRPNRTVHISCKLSGVPLENAIVHWYQQKNGEPLRRILYGSTKNSKDNKLNPRLEAYRKDGTFNLIINNVVKSDEAIYYCACWD
Myotis davidii V574 trgv ALWT01057845.1 1473 GLGQLKLKQPEISISRAVYKSAQIPCKVSSGTFSSDYIHWYRQKPDQGIKHLINVVSTTIVGGKNNKLEASKDSQTSTSTLRINFLEKEDEAVYFCACWTG
Myotis davidii V616 iglv ALWT01090016.1 697 SVASYELTQSGPLSVAPGGTASITCTGDLLDKKYTDWYQQKPSQAPVAVIYDDSKRPSGIPDRFSGTSSGKTNTLTISGVLAEDEADYYCQSSTSDDN
Myotis davidii V633 ighv ALWT01099424.1 1089 VQCDAQLVESGEGFVQPGGSLRLSCAASGFTFSSSWLDWVRQAPGKGLESLCRINPDGSTTYYANSVKEQFTTSRDNARNLLYLQMNSLRAQDMSVYYCIT
Myotis davidii V637 ighv ALWT01101177.1 990 VQCEVQLVESGGGLVQPEGSLRLSCAASGFTFNNAGMNWVRQAPGKRLEWVAIIWFDGSQKYYADSVKGRFTISRDNSKNMLYLQMNNLRAEDTAMYYCAA
Myotis davidii V642 trav ALWT01104179.1 5209 AVIDAKITQPNSMDYAEGKDVNLPCNHSTIGGTDYIHWYRQNPNQRPQYIIHGLRNNVTNNMASLIITEDRKSSTLILPQVTLRDSAVYYCAVS
Myotis davidii V643 trav ALWT01104180.1 598 VNGQQIKQIPQFLLLQEGENFTMYCNFSSTSNNLQWYKQSPGGNPVFLVMLVRGGEVKTQERLTARFGETRKDSSLHITATQTADVGVYFCAE
Myotis davidii V644 trav ALWT01104181.1 2108 VSSELNVEQSPPSLHVQEGESTNFTCRFPTSSFYALHWYSWEPAKSPTALFVISLNGDVKKEGRVTATLDTAKGYSYLYIKGSQPEDSATYLCAF
Myotis davidii V645 trdv ALWT01104182.1 7314 SSMAQKVIQDQAETVKQEGALVTTLNCRYETSDSVYYILWYKQLTSGKLVFLIRQASSGQNAEDGRYSINFQKAAKSISLTISTLQLEDSAKYFCALWE
Myotis davidii V651 ighv ALWT01107154.1 678 VQCELQLVESVGGLVQPGGSLRLSCSASGFTFSSYAMNWVRQAPGKGLEWVSADSGGGSTYYANSVKGRFTISRDKAKNSLYLQMNRLKAEDTVVYYCER
Myotis davidii V664 ighv ALWT01116716.1 6589 VQCEVQLVESGGGLGKPEGSLRLSCAASGYSSSSYYMNWVRLTTGKGLEWICAITANGDSTYYADSVKGRFTISRDNTKHTIYLQMNSLKSEDTAVYYCAT
Myotis davidii V665 ighv ALWT01116723.1 12332 VLCEVQLVETGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYINPDGSTTSYAQSVKDRFTISRDNAKNTLYLQMNSLSAKDMALYYCA
Myotis davidii V666 ighv ALWT01116724.1 343 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYINPDGSTTSYAQSVKDRFTISRDNAKNTLYLQMNSLSAKDMALYYCA
Myotis davidii V675 ighv ALWT01122061.1 468 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYINGDGSTTSYADSVKGRFTISRDNAKNMLYLQMNSLRAQDTAVYYCTR
Myotis davidii V700 ighv ALWT01142405.1 2524 VLSQLQLQESGPGLVTPSQTLSLTCSVSGFSITTGGYLWNWIRQPPGKGLEWIGGIWYDGYTNYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTALYYCAR
Myotis davidii V707 trbv ALWT01146218.1 29084 HQDAVVTQFPRHRILGTKKKLTLECSQNMNHISMYWYRQDPGYGLQLIYYSNGIRTIATGDVPEGYHVSRSELKYFPLTLESASTNQTSVYFCASSD
Myotis davidii V708 trbv ALWT01146218.1 20638 PTEAEVTQTPRHLITETKKKLTVTCSQNMDHELMYWYRQDPGLGLKLIYYSINVDHFEKGEVSDGYTVSRTEKRNFPLTLESANISQTSLYLCASR
Myotis davidii V709 trbv ALWT01146218.1 14860 LMDAEVTQVPRYLIKRKGEKVFMECLQDMDHERMFWYRQDPALGLQLLHFSYGVNIYEKGDFPDGYSVSRKKKEGFSLILGSASTNQTSVYLCASSI
Myotis davidii V710 trbv ALWT01146218.1 10866 SVFGALLSQKPLRDICQRGTSVTIQCQVDSQVALMFWYRQLLGQSLTLIATANQGSKATYESGFTKDKFPIHRPNLTFSILTVNSVNPEDSSFYFCSAG
Myotis davidii V711 trbv ALWT01146219.1 39386 YMGAMVTQNPRYQVTRMGKPVTLSCSQGLNHDLMYWYQQKLSQAPKLLFYYYDKDFNNETDTSDNFQPSRPNTSFCSLRIRSPGLGDSAVYLCASSK
Myotis davidii V712 trbv ALWT01146219.1 30043 PTSASSVIQNPRRLVLGRGQEANLSCNPVKGHIYIYWYRQLLQEGLKFMIYLRREEILDDSGMPTKRFSAVFPKEGPSLFNIQLAELGDSAVYFCASSL
Myotis davidii V713 trbv ALWT01146219.1 27074 TVRSGITQTPKYLLREEGRDVTLDCEQNFDHDSMYWYRQDPGQGLRLIYFSTVVKDIQQGDLAEGYRASREKKPFFPLTVTSTRKSQTAVYLCASSI
Myotis davidii V714 trbv ALWT01146219.1 24570 GFGLSALVFQHPRRAIRISGASVKIQCRPVDLQATTMFWYRQSPRQGLVLMATSNMGSPVTYEQGFTEVKFPIIHPNLTFSTLTVTSTHPADSSFYLCSAS
Myotis davidii V715 trbv ALWT01146219.1 22523 SVDTEVTQSPGHLVKGKGQKAKMGCVPIKGHSYVYWYRQKLGEELKFLFYLQNEEIIEKTDMIDERYSPKCPKNSQCSLEIESTEPGDAALYLCASSQ
Myotis davidii V716 trbv ALWT01146219.1 19691 PTRAEIYQVPAFRLTRAGRDVTLECEQSLRYNAMYWYRQDPGEGLKLIYYSTVEKDVQRGDIPEGYNVSREQKGLFPLTVRLAHTNQTAVYLCSGS
Myotis davidii V717 trbv ALWT01146219.1 14562 SSDVQVTQTPGHLVKGKGQRARMDCIPPKEHPVVYWYQQSQNKEFKFLISFQNENVLDQIELVKERFLAQCPKNVGCSLEIQASEPGDSALYFCASS
Myotis davidii V718 trbv ALWT01146219.1 8027 YIDAGVFQTPRNKIAKTGNSIILECSQNEDHDYMYWYRQDTGLGLRLIYYSYSEKIYKGDVHNGYSASRKEHAKFPLFLKAASPNQTAVYFCTSS
Myotis davidii V719 trbv ALWT01146220.1 23634 NLDARITQSPRYKVVGTEKNLTLSCHQTDNHNYMYWYRQDLSHELTLIYYSVGAGITAKGDGADGYSVSRSNTENFSLTLESATPSQTSVYFCASS
Myotis davidii V720 trbv ALWT01146220.1 22832 HLDARITQSPRYKVTQTEKKVTLRCNQTDNHGYMYWYRQDLGHGLSLIQYSYGVGSIEKGDVPDGYNVTRSNTENFALTLESATPSQTSVYFCASSD
Myotis davidii V721 trbv ALWT01146220.1 15412 PTDAGVTQTPRHKVTKMGQPVTLNCEPISGHTYLYWYRQTLEQGPKFLIYFSNQQPIDDSGMPKERFSAKMPNESFSTLTIQPTEPGDSSMYLCASSL
Myotis davidii V722 trbv ALWT01146220.1 12570 PTDAGVTQTPRHKVTKMGQSVTLSCEPISGHPHLYWYRQTLEQGPKFLIYFNNQMPVDESGMPKERFSAKMPNGSFSALKIQPTESRDSAVYLCASSL
Myotis davidii V723 trbv ALWT01146220.1 3925 HADAGVAQTPRHKVTKMGQAVRLNCEPISGHNDLYWYRQTSLQELKFLIYFSNGAPIDNSGMPKDRFSAKMPNGSFSILEIQPTEPGDSALYLCASSL
Myotis davidii V724 trbv ALWT01146220.1 995 LLDAGVTQTPRHKVTKIGQELILSCKPISGHDGLYWYRQTSLQGLKFLTYFRNQAPIDDTGMPKDRFSAKMPNGSFSTLKIQPTEAGDSAVYLCASSL
Myotis davidii V725 trbv ALWT01146221.1 381 SVAAGVTQSPRHLIKSREGKAVLKCHPISGHDTVYWYQQALGQGPQFLISFYEKDEREKGNIPDRFSGKQFSNYSSELAMNALQLGDSAVYLCASSL
Myotis davidii V726 trbv ALWT01146223.1 1768 HLDARITQSPTYKVTGKEKKVTLRCHQTDNHNNMYWYRQDLGHGLRLIHYSVGAGITDKGDVADGYSVSRSNTENFALTLDSATPSQTSVYFCARSE
Myotis davidii V727 trbv ALWT01146225.1 3518 SVAAGVTQSPRHVIKGQGGMAILKCNPISGHRSVYWYQQALGHGPQFLIEYFEKEEREKGREREKGSIPDRFSGNQSSDYSSELAMSALQLGDSAVYLCASSL
Myotis davidii V728 trbv ALWT01146225.1 958 SVAAGVTQSPRHVIKGQGGMAILKCNPISGHRSVYWYQQALGHGPQFLIEYFEKEEREKGSIPDRFSGNQSSDYSSELAMSALQLGDSAVYLCASSL
Myotis davidii V729 trbv ALWT01146227.1 11398 NMDAEVTQSPRYKVAGTDKNVTLSCHQTNNHNVMYWYRQDLNHELTLIYYSVGAGITAKGDGADGYSASRSNTENFALTLESATPSQTSVYFCASSE
Myotis davidii V730 trbv ALWT01146227.1 5260 SVAAGVTQSPRHLIKGRGGKAILKCQPISGHRSVYWYQQALRQGPQFLISFYEKDEREKGNIPDRFSGKQFSNYSSELAMSALQLGDSAVYLCASSL
Myotis davidii V731 trbv ALWT01146228.1 3882 SVAAGVAQSPRHIIKVQEGKAVLKCHPISGHRYVYWYQQALGHGPEFLISFYEKQEGQKGNIPDRFSGNQFSDYSSELVLSTLQLGDSAVYLCASSL
Myotis davidii V732 trbv ALWT01146229.1 2720 NLDAEVTQSPRYKVAGTDKNVTLSCHQTNNHNVMYWFRQDIGHELTMIYYSLSAGINGKGDGADGYSVLRQNKENFVLTLKSATPSQTSVYFCASSGV
Myotis davidii V733 trbv ALWT01146230.1 3765 SVAAGVTQFPRHLIKVQGGQAVLKCHPISGHNTVYWYQQALSQNPEFLISFYEKQEGQKGIIPDRFSAKQFSDYSSELAMSTLQLGDSAVYLCASSL
Myotis davidii V738 iglv ALWT01148567.1 4533 SWAQSVLTQPSSVSGSPGERVTISCTGSSSNIGGGSLVYWYQQLPGKAPKLLIYDSSNRPSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCQSYSRSFD
Myotis davidii V739 iglv ALWT01148567.1 1782 SLSQPVLTQPPSLSASPGDTARLTCTLSSDVSVGGKYIYWFQQKPGSPPRYLLYYNTDSDKGQGSGVPSRFSGSKDASANAGLLTISGLQPEDEAEYYCMI
Myotis davidii V740 ighv ALWT01148612.1 1461 VQCEVQLVESGGGLVPPGGSLRLSCAASGFTFSSSLMSWVRQAPEKGLEWVSYINPDGSSTNYAASVKGRFTISRDNAKNMLYLQMNSLRAEDTALYYCA
Myotis davidii V741 ighv ALWT01148617.1 8543 VHSQVQLVQSGAEVRKPGASIKVSCKGSRYTFTSYWMQWVRQVPGERLKYMGWINTNTGKLTYAQGFSERFGFSINTSVSSADRQINSLKSEDTAMYYCA
Myotis davidii V742 ighv ALWT01148617.1 1676 VQCERQLVESGGGLVQPGGSLKLSCAASGFTFSSYYMNWVRQAPGKGLEWVARITNSGGSSYHAEYVKGRFTISRDNAKNTLYLQMNSLRLEDTAMYYCAT
Myotis davidii V746 ighv ALWT01151356.1 2203 VYSQVQLVQSGAEVRTPGASVKVSCKASGYTFTSYPVHWVQQAPGQGLEWVGMVFPVLGITNYAQKFQGKVSITGDTSTSTAYMELSSLRAEDTAVYYCA
Myotis davidii V748 iglv ALWT01152241.1 349 SWAQSVLTQPSSVSGAPGERVTISCTGSSSNIGGGYDVYWYQQLPGKAPKLIIYGSSNRPSGIPDRFSGSKSGSSGILTITGLQAEDEADYYCA
Myotis davidii V760 ighv ALWT01160024.1 5269 VLSQVQLQESGPELVKPSQTLSLTCSVSGFSITTSGYTWHWIRQPPGKEMEWIGYITYSGSTNYSPSIKSRTAVSRDTSKNQFSLQLSSVTTEETALYYCAR
Myotis davidii V761 ighv ALWT01160025.1 1482 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYYWSWIRQPPGKGLEWIRYIHSGGSTYYSPSLKSRISISRDVSKNQFSVQLSSVTTEDTAVYYCAR
Myotis davidii V764 ighv ALWT01163839.1 7056 VQCEEHSWWSLGEACAAWGSLRLSCAAAGFTFSSYQMSWVHQAPGKGLEWVAYTGSGNGYPIYYADTGKGHFTISRDNAKNTPYLQMTSLRAQDSAVYYCAR
Myotis davidii V765 ighv ALWT01163839.1 3064 AAAGVGPRTGEALADPLPHLHCLWILSNELWCTLDLPGSRKGAEWVGVVWGGGGTDYNPTLKSRLSITRDTSKSQVYLTLNSRRAEDTAVYYCA
Myotis davidii V766 ighv ALWT01163840.1 923 VVKPSQTLSLTCTVSRGSVTSSYWGNWICQPPGKVLQWMGLWTESTSYNPAFQGHISITADTARNQFSLQLSSVTTEDTAMYYCARHSEGKSV
Myotis davidii V790 iglv ALWT01181381.1 585 SVASSGVTQPPAVSVAPGQMAKITCQGELIEKAYPVWLQQKPGQAPVVVMYGDNERPSGIPERFSASDSGDTNTLTISGAQAQDEADYYCSAWDDSAK
Myotis davidii V794 trav ALWT01183563.1 1524 VSHGAKVDQHPSTLNVQEGNTAVINCSYSDSVSNYFPWYKQEPGRGPQFIIDIRSNKDKNEVERLTVFMNKAAKHLSLHITATQPGDSAVYFCAAS
Myotis davidii V795 trav ALWT01183568.1 2871 SSIAQKVTQGQQAILVQEKEAVSLECTYDTSVTSYSLFWYKQLSGGAMILLIRQDSYNQQNATGGRYSLNFQKAKSSANLIISASQLEDSAVYFCALSE
Myotis davidii V796 trav ALWT01183569.1 6521 VSHGEKVDQHPSTLSVQEGNTAVINCSYSDSASSYFPWYKQEPGKGPQFIIDIRSTKDKNQAGRLTVFMNKAAKHLSLHIAATQTGDSAVYFCAAS
Myotis davidii V797 trav ALWT01183569.1 380 SSIAQKVTQGQQAILVQEKEAVSLECTYDTSATSYSLFWYKQLTGGAMILLIRQDSYNQQNATGGRYSLNFQKAKSSANLIISASQLEDSAVYFCALSE
Myotis davidii V798 trav ALWT01183572.1 5289 GVRGMKVEQSPSALSLQEGTSFTLRCNFSITVIYIQWFRQNPGGSLINLFYLTSRTKYNGRLSTTLNSNDLYSTLSITASQLEDSATYLCAES
Myotis davidii V799 trav ALWT01183577.1 1755 RSNGDSVTQTKGQVTLSEGASLTVNCSQETTGYPTLFWYVQYPGEGPQLLLKAAKANEKGSGKGFEATYQKQPNAFHLEKASVHQSDSAMYYCAQS
Myotis davidii V800 trav ALWT01183580.1 1617 DARAQSVDQPDNHISVSEGTSLELRCKYSYTGVVYLYWYVQDPRQGLQLLLKYLSGDTLVKGIKNFEAELRKNESTFNLRKHFAHWSDSAEYFCAAS
Myotis davidii V801 trav ALWT01183583.1 4987 RSNGDSVTQTKGQVTLSEGASLTVNCSYETTGYPTLFWYVQYPGEGPQLLLKAAKANEKGSNKGFEATYQKQPNAFHLEKASVHQSDSAMYYCVLG
Myotis davidii V802 trav ALWT01183586.1 2626 DARAQSVDQPDSHISLSEGASLELRCKYSYTGTVYLYWYVQDPSQGLQLLLKYLSGDTLVKGIKNFEAELRKNESTFNLRKHFAHWSDSAEYFCAVS
Myotis davidii V803 trav ALWT01183592.1 14010 AESKDQVFQHSTVVSSEGAVVEISCNHSISNAYDFFWYLYSPGCAPRLLVKGSRPSQKGRYNMTYERFSSSLLILQVQVADAATYYCALGDTEAEN
Myotis davidii V804 trav ALWT01183592.1 2459 TLSLAKTTQPIFMLSDEGQEVNIPCNHTNIATNEYIFWYQQFHNQGPQFVIQGYKTDTANEVASLFIAADRKSSVLRLPWVSLKDTAVYYCIVSD
Myotis davidii V805 trav ALWT01183598.1 1021 TTGQGVQQPPELTAMEGASVQVNCTYQTPGFNGLFWYQQHDGGAPIFLFYNVLDGLNKRGRFSSFLSHSDTYSYLLLRELQMKDTASYLCAVI
Myotis davidii V808 trgv ALWT01185168.1 853 GLGQLKLEQPEISISRAVYKSAQIPCKVSSGTFSSDYIHWYRQKPDQSMEHLMYVSSTATVCGKNSKFKASKYTQTSTSTLTINFLEKEDEAVYFCACWTG
Myotis davidii V819 ighv ALWT01196342.1 4583 VQCEEQLVESEGGLVKPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLQWVSRISSGGSTYYADSVKSRFTISRDNAKDMLYLQMSSLRAEYTAVYYCAR
Myotis davidii V855 trbv ALWT01219906.1 1458 LMDTGITQMPRHLVMGMRSKKSLKCKQHLGHNSMYWYKQSAQKPPELMFLYNFKKLIENNTVPSRFSPECPDSSQLYLHVDALEPEDSAVYLCASSK
Myotis davidii V861 trdv ALWT01226195.1 14184 KGMLCNTVTQDSLDQTVAIGSEVTLFCTYDTQYLNPDLYWYRKRPDHSLQFILYRDNSLARDADFTQGRFSVQHSHTHRTFHLVISSVRIEDSATYYCAMS
Myotis davidii V875 trgv ALWT01294256.1 606 TSGDIQITQALTSITKKKGSTAFLECQIRDILKKDSYIHWYRQKRDQALKRILSISSDDNVIHEQGVSGERYEARKHHGNLLVSLRIHRVEEADAGLYYCACWV
Myotis davidii V878 trav ALWT01301371.1 328 ETRAQSVTQPDGHITVSEGAPLELRCSYSYGGAIYLFWYVQYPNQGLQNILKYVTGPTQVTGIKGFKAEFRKNETSFHLRKLSAHWSDSAVYFCAMS
Myotis davidii V879 trbv ALWT01308029.1 450 GFGLSALVFQHPRRAIRISGASVKIQCRPVDLQATTMFWYRQSPRQGLVLMATSNMGSPITYEQGFTEVKFPIIHPNLTFSTLTVTSTHPADSSFYLCSAS