WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pantholops hodgsonii AGTT00000000.1 (AGTT01) 89 2 7 5 23 36 6 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pantholops hodgsonii V23 trgv AGTT01014279.1 18086 IQQEIKLSQRSVMVGSAGGAMTMPCHVSRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLGGDKVSAARGGDGKSCTMSLRKLAKSDEGLYYCAAWGS
Pantholops hodgsonii V322 trdv AGTT01175312.1 4959 SGVAQSVTQDQTDILSEVGKTITLNCRYETSWNTLSYYIFWYKQLSSGQMIYLIRQYSDDGNTRDGRYSVNFQKAHKSISLTISALELEDSAMYFCVLRA
Pantholops hodgsonii V323 trdv AGTT01175318.1 17781 SSVAQRVTQDQPDISSQVGKVVTLSCRYEKIQSGYNIFWYKQLPTGEMIYLIGQGSSSQNARYGRYSVNLQRSRKSISLTISDLELEDSAKYFCALWE
Pantholops hodgsonii V324 trdv AGTT01175320.1 2970 SGVAQKVTQDQPDISIQVGESATMNCQYETSRNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFQRSRKAISLIISALKLEDSAKYFCALWE
Pantholops hodgsonii V325 trav AGTT01175324.1 2232 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPVLLMILAKAGEVKTEQRLTGRLRETRQHSSLHLAAAQLSDAGTYFCAE
Pantholops hodgsonii V326 trdv AGTT01175325.1 3613 SGVAQKVTQDQSDVSSQVGQSVTLNCLYETSWGAYYLFWYKQLPSGQMAYLIQQYSGYSNARKGRYSVNFQKADKSISLIISSLQLEDSAKYFCALHE
Pantholops hodgsonii V327 trav AGTT01175328.1 9323 GTGAQLVTQPDGHINVSEGNRLELRCNYSYGGSISLFWYVQYPSQGLRFLLKYLSGPTRVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Pantholops hodgsonii V328 trdv AGTT01175332.1 2124 SGVAQKVIQDQPDISSQLGQSVTLNCRYATTWSYYYVFWYKLLPNGEMIYLISQVSSGQNARNGRYSVNIQKARKSVSLTISDLQLEDSSEYFCALWE
Pantholops hodgsonii V329 trav AGTT01175336.1 3439 VRGVDVEQSPPALTPQEGASSTLRCNFSTLADSVRWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLRTTDSGTYFCAVRHSAPQ
Pantholops hodgsonii V330 trdv AGTT01175337.1 2479 YSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTTAFYYIFWYKQLPRGKMTLLIRQYSEHGNTRNGCYSVNFQKAHKSISLIILALQLEDSAKYFCTLWE
Pantholops hodgsonii V331 trav AGTT01175343.1 4057 IMVDAEITQLSSMDCAEGEDVNLPCNHSTIDALDYIHWYRHTPNRSPQYVIHGFQDTVNSSMGSLNIASDRKSSTLVLSQVTLRDTAVYYCILRA
Pantholops hodgsonii V332 trav AGTT01175349.1 2727 ESTQQLEQNPKFLCIQEGGNVTVYCSSSSTFTFFQWYRQKPEEGPVLLVTLTKPKEMKEQKRIRAEFGEARKDSSLLITAAQPGDSGTYLCAG
Pantholops hodgsonii V333 trav AGTT01175350.1 1233 ESTQQLEQNPKFLCIQEGGNVTVYCSSSSTFTFFQWYRQKPEEGPVLLVTLTKPKEMKEQKRIRAEFGEARKDSSLLITAAQPGDSGTYLCAG
Pantholops hodgsonii V334 trav AGTT01175354.1 1422 LGVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSAINSKERYCQLYIRDSQPGDSATYFCAVE
Pantholops hodgsonii V335 trav AGTT01175357.1 6772 VLGDTKTTQPNSVEGAEEEPVHLPCNHSTISGSEYVYWYRQIPHQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILRE
Pantholops hodgsonii V336 trav AGTT01175357.1 13302 LGVQMKVEQSPEVLTLQEGRNSSLICSYSISMTSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Pantholops hodgsonii V337 trdv AGTT01175357.1 22833 FSMADKVTQAQTTVTGQQGEAATIGCTYETSQTYYTLFWYRQFPGGRMEFLIYQDSNQANPRRDRYSVNFQKGKKIISLTISSLHLADSAKYFCALWE
Pantholops hodgsonii V338 trav AGTT01175360.1 1766 VLGDTKTTQPNSVEGAEEEPVHLPCNHSTISGSEYVYWYRQIPHQGPEYLVHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCILRE
Pantholops hodgsonii V339 trav AGTT01175362.1 2029 VSAQQLNQSPQSMSIHEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTRKDSLLNNSAFEPKDGGTYFCAG
Pantholops hodgsonii V340 trav AGTT01175363.1 8790 VKSDDDVMQSPSSLIVHEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFALISTGIEKTSGRLRGTLDRKELLSTLHITVTKPGDSATYLCAVE
Pantholops hodgsonii V341 trav AGTT01175364.1 2590 PRRADWIRSQESEVSGAEGKTVSLFCNYYTSSTSFVSLFWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Pantholops hodgsonii V342 trav AGTT01175368.1 16555 PSVAQTVTQPQPEESVQEADTVTLDCTYSTSESDYYLFWYKQPPSGEMVFIIRQYAYEQQNATNDRYSGNFQKEAKAFSLKISDSQLEDAAMYFCAYSG
Pantholops hodgsonii V343 trav AGTT01175368.1 19465 PSVAQTVTQPQPEECVQETGTVTLDCTYTTSESNYYLFWYKQPPSGEMVFIIRQNAYEQQNATNDRYSGNFQKEAKAFSLKISDSQLEDAAMYFCAYSG
Pantholops hodgsonii V345 trav AGTT01175369.1 22354 VSGKNGVEQSSRYLSAQEGDLVTINCNYLEGMTTLQWLQQNPGGSIISLLTLSLEMTRKGRVSATINRRECYSSLNITASQPTDSAMYFCAVE
Pantholops hodgsonii V346 trdv AGTT01175369.1 52206 SNNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSRGEMIYMINIYSQSKHTREGRYSVEFYKPNQMLKLTISALMLSDSAIYFCAVRE
Pantholops hodgsonii V348 trdv AGTT01175372.1 17596 VMPVVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKYYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLEILKASKRDEGFYYCASD
Pantholops hodgsonii V361 trbv AGTT01184582.1 34175 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKKLIENETVPSRFSPESPDKAHLNLHIDSLEPGDSAVYFCASS
Pantholops hodgsonii V362 trbv AGTT01184582.1 38761 VSADPGITQIPKYLVMGMTDKKSLKCEQHLGHNTMYWYKQSAQKPPELMFIHNYMKLSGNESVPSRFWPECPDSSQCRLDLSALKPQDSAVYLCASSR
Pantholops hodgsonii V363 trbv AGTT01184584.1 803 LVDSEVTQTPKYLIKSRKQQATLRCSPESGHRSVNWYQQALGQGPRFLIQYYRGQVSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSR
Pantholops hodgsonii V364 trbv AGTT01184584.1 5613 AVHAGVTQDPKFQEVRRGQRVTLRCTQDLNYDYMYWYRQDPGHGLRLIHYSDGPPTIEKGDVPDGYSVSRPSTENFPLMLESPSRSQTSVYFCASSY
Pantholops hodgsonii V365 trbv AGTT01184584.1 9508 LVDSEVTQTPKYLIKSRKQQSTLRCSPDSGHFSVYWFQQALGQGPQFLFQYYNQKVRGEAHLPDGFSGKQFSDSCSELNLSSLELMDSAMYLCASSQ
Pantholops hodgsonii V366 trbv AGTT01184585.1 5295 LVDSEVTQTPKFLTKSRKQQGTLRCSPESGHRSVYWFQQALGQGPQFLIQYFDGEVYQRGNMSDRFSGQQLGLELNLTSLELMDSALYLCASSP
Pantholops hodgsonii V367 trbv AGTT01184586.1 1816 LVDSGVTQTPKYLIKLRKQQVTLRCSPESGHRSVYWYQQALGQGLQFLIQYYNREVNEKGNISDRFSGKQFSDSRSELNLTSLELTDSAVYLCASSQ
Pantholops hodgsonii V368 trbv AGTT01184588.1 2272 LVDSGVTQTPRYLIKATGQRGTLGCSPVSGHLYVYWYQQALGQGPQFLVQYYRQDVSGETQLPDRFSGKHFSDFHSELNLTSLELTDSAVYLCASSQ
Pantholops hodgsonii V369 trbv AGTT01184590.1 5081 LVDSEVTQTPKYLIRSRKEQVMLRCFPKSGHRSVYWYQQALGQGPQFLVQYYNQELSREAQLPDRFAGKQFSDFHSELNLTSLELTDSAMYLCGSSQ
Pantholops hodgsonii V370 trbv AGTT01184590.1 8969 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLYVYWYQQALGQGPQFLVQYYSQDVWGETNLLDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Pantholops hodgsonii V371 trbv AGTT01184594.1 1225 LVDSGVTQTPKYLIKSKKQQVTLRCSPESGHRSVYWYRQALGQGPQFLIQYYNREVNEKGNISDRFSGKQFSDSRSELNLTSLELTDSAVYLCASSQ
Pantholops hodgsonii V372 trbv AGTT01184595.1 4909 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPQFLVQYYSQDVWGETNLLDRFSGKQFSDSSSELNLTSLELTDSAVYLCASSQ
Pantholops hodgsonii V373 trbv AGTT01184596.1 10380 LVDSGVTQTPKYLIISRKQQGTLRCSPESGHRYVSWYQQALRQGPHFLVQYYDGKVHTKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAVYLCASRQ
Pantholops hodgsonii V374 trbv AGTT01184600.1 9112 LVDSGVTQTPRYLIKARGQQGTLGCSPVSGHLSVYWYQLVLGQGPQFLVQYYRQEVSGEEQLPDRFSGKQFSDSSSELNLTSLKLTDSAVYLCASSQ
Pantholops hodgsonii V375 trbv AGTT01184608.1 4315 EVLAGVSQDPRFQIMRTGQNATLKCTQDLGHDRMYWYRQDLGHGLRLIYYSAGPPSTQKGDVPDGYRVSRSSKENFPLTLESASRSQTSAYFCASRYSMA
Pantholops hodgsonii V376 trbv AGTT01184608.1 6500 LVDSGVTQTPKYLIKARKQQGILRCSPQSGHRYVSWYQQALGEIPRFLVQYYDGKVRTKGNMPDRFSREQFSDSHSQMNLSSLELTDSALYLCACRQ
Pantholops hodgsonii V377 trbv AGTT01184608.1 9330 AVHAGVTQDPRFQVVRTGQSLTLKCTQDLNHDSMYWYRQDLGHGLRLIHYSSFTDATYKGDVPDGYNVSRSSTENFPLTLESANRSQTSVYFCASST
Pantholops hodgsonii V378 trbv AGTT01184608.1 12173 HTGAGVVSQSPRHWVAGRGQNVTLRCDPISGHISLYWYRQTLGQGPEFLTYFQNEQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Pantholops hodgsonii V379 trbv AGTT01184609.1 4623 PLKAEVTQIPRHLIKTTGQAATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Pantholops hodgsonii V380 trbv AGTT01184609.1 31833 TTDANLGVIQTPRHEVTEKGQAVILSCEPIKSHTALYWYRQTSVRGLELLIYFRNEAPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Pantholops hodgsonii V381 trbv AGTT01184611.1 1274 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHVALFWYRQTSVRGLELLMYFNNQSPIDESGMPKDRFLAKMPNASFSTLKIQPTDPGDSATYLCASSK
Pantholops hodgsonii V382 trbv AGTT01184611.1 6058 HVGAMVIQNPRYLTTGLGKPVTLSCSQNMNHDAMYWYQQKPSQAPKLLLYYYDKEITKEKNTSENFQSSRPNTSLCSLDIRSAGLGDSAVYLCASSR
Pantholops hodgsonii V383 trbv AGTT01184611.1 11037 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKKFKFLISFRNDKVMDDKEMPKKRFSAECPSNSPCSLKIQPAEPQDSAMYFCASSD
Pantholops hodgsonii V384 trbv AGTT01184614.1 1116 SGLGAVVSQQPRRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNEGTSAKYEQGYSKDKLPISQPNLTFSSLMVTSVAPADSSLYFCGAR
Pantholops hodgsonii V385 trbv AGTT01184614.1 12956 SMDTEVAQSPSHLVKGKDQRAKMDCVPIKGHSYVYWYRKKLEAFEFLVYLWNGKITEETAMFKQRFSAECPQNSPCSLEIKSTEAPDSALYFCASS
Pantholops hodgsonii V386 trbv AGTT01184616.1 2033 SMDTEVTQSPSHLVKGKDQRTKMDCVPKKGHSYVYWYLRKLEEAFEFLVYLQDEKIIEDTAMFKQRFSAECPQTSPCSLEIKSTKAADSALYFCASSQ
Pantholops hodgsonii V387 trbv AGTT01184618.1 814 SMDTEVIQSPGHLVKGKDQKAKMDCVPVKGHVHVYWYRKKPEGAFEFLVYLQNQDIVEDTEVFQQQFLAQWPQNSPCSLEIKSTKAADSALYFCASSQ
Pantholops hodgsonii V388 trbv AGTT01184618.1 4743 SMDTEVIQSPSHLVKGKGQKAKMDCVPIKGHINVYWYRRKLEEALEFLVYLQNQDIVEDTEVFKEQFSAQCPQNSPCSLEIKSTKAADSALYFCASSQ
Pantholops hodgsonii V389 trbv AGTT01184619.1 3045 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNQDTMEDTAEFKQRFSAECPQNSPCSLEIKSTEAADSALYFCASSQ
Pantholops hodgsonii V390 trbv AGTT01184619.1 7600 PMDAEIYQVRFLLTEAGQDVTLECKQNLGYSAMYWYRQDPGQGLKLIYYSTVEKDIQRGELSEGYSVSQEKKELFPLTVKSAHTKQTAVYLCSG
Pantholops hodgsonii V391 trbv AGTT01184620.1 4672 SMDTGVTQTPRNRIAITGKSTVLECSQTKGHESMYWYRQDPGRGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPSQMAVYFCASSI
Pantholops hodgsonii V392 trbv AGTT01184620.1 9531 FMDADVYQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGANTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Pantholops hodgsonii V393 trbv AGTT01184620.1 11459 LEDAAVIQFPRHRILEAEKEFTLQCSQKMNHYAMYWYRQDPGFGLQLIYYSTGPDTFKKGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAE
Pantholops hodgsonii V394 trbv AGTT01184621.1 2616 PLEADVTQSPRHRITETRKRVTLTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVGFLENGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSE
Pantholops hodgsonii V395 trbv AGTT01184621.1 8691 LMDAQVTQTPRYLVKRRGEKVLIECIQNMDHERMFWYRQDPALGLRLGPFSIDVDMIEEGDVPYGHSVCRTKRKRFPLTLESATTNQTSMYLCASNE
Pantholops hodgsonii V424 ighv AGTT01264227.1 777 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSNAVGWVRQAPGKAPEWVGGIDSDGDTSYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTALYYCAR
Pantholops hodgsonii V425 ighv AGTT01264229.1 2325 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSNAVGWVRQAPGKAPEWVGGISSGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTALYYCAR
Pantholops hodgsonii V441 igkv AGTT01006386.1 37199 AKCDIQVTQSPSSLSASLGDRVSITCQASQNIDTKLAWYQQKPRKAPKLLIYAVSRSPSWFPSQFSGSGFGIDFTLTISSLKADDIATYYCQQ
Pantholops hodgsonii V442 igkv AGTT01006387.1 17696 ARCDIQMTQSPSSLSASLTESVSITCRASQSISNYLNWYQQKPGQAPKLLIYYATRLHTNVPSRFSGSGSGTDFTLTISSLEADDAATYYCLQDYS
Pantholops hodgsonii V443 igkv AGTT01006387.1 2088 AIGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRRNGVPERFTATQSGTEFVFTISQVEADDAAMYYCQQSYVFP
Pantholops hodgsonii V444 igkv AGTT01006391.1 36261 SSGAIVLTQTPRSLSVIPGETASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Pantholops hodgsonii V445 igkv AGTT01006391.1 9971 SSGDVVLTQTPLSLSVIPGGTVSISCKSSQSLVHSDGKTYLNWIQHKPGQSPQGLIYQVSNRYSGVSDRLTGSGSGTDFTLTISSVQAEDAGVYYCYQGTEAP
Pantholops hodgsonii V473 trav AGTT01023298.1 26192 SRGQSGTQPDDPVLVSEGTSLELKCNYSYGATPYLFWYVQYPRQRPQLLLKYFAGNTVVQGIRGCVAEFKSSDFSFNLRKFSAHWRDSAEYFCALS
Pantholops hodgsonii V499 trgv AGTT01041785.1 23899 TQVSSNMEEDKLSVTRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLDSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Pantholops hodgsonii V500 trgv AGTT01041785.1 10625 MQVSANMEGEKMSITKAAVPGAFVEIICDLITQTVKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE
Pantholops hodgsonii V501 trgv AGTT01041788.1 32944 GLGLSKVEQAQISLSTEVKKSIDIHCKIESTNFESEAVYWYRQKRNQALEHLVYVISTTTAARNQVDGKNKIEARKDARMFTSTLMVNFVEKEDVGIYYCAGWS
Pantholops hodgsonii V502 trgv AGTT01041788.1 20670 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTAPAQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCASWLS
Pantholops hodgsonii V503 trgv AGTT01041788.1 13909 GDIKMKISQHQLSFTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD
Pantholops hodgsonii V702 iglv AGTT01150021.1 8769 SWAQAVLTQPPSVSVSLGQKVSITCTGSSSNIGGGNYVCWYKQLPGSAPKLLICCTPSGASGFSDRFSCSRSGNTATLTISSLQAEDEADYYCATYESSGYN
Pantholops hodgsonii V703 iglv AGTT01150024.1 1282 CLSQPLLTQPASLSASPGASARLTCSLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPSRFSGSKDASTNTGLLLISEVQPEDEADYYCAVWHG
Pantholops hodgsonii V743 trdv AGTT01175387.1 24960 KGMLCNQVTQSSPEQRVASGREVTLQCTFQTTYSDPDLYWYRKTPDAVFQFVLYRDNTRSRDADFARGRFTVQHSVSRKTFHLVISSVRPEDTATYYCALEI
Pantholops hodgsonii V752 trav AGTT01180753.1 13527 AHAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Pantholops hodgsonii V760 trbv AGTT01184626.1 8975 VRAQTIHQWPSTMVQPAGSPLSLECTVKGTSSPNLYWYRQEAGGSLQLLFYSVGVDQIEPREFQNFKASRPQDGQFTLSSKKLQLNNSGFYLCAWS
Pantholops hodgsonii V796 iglv AGTT01264694.1 5588 SWAQAVLTQLPSFSGILGQRVTLSCTGSSSKIGGYYVSWYQQLPGSAPRLLTYENSKRASGVPDRFSGSKSGSSASLTTSVQAEDDADYYCFSWADGLEV
Pantholops hodgsonii V797 iglv AGTT01264698.1 14601 SWAQAVLTQPPSVSGSLGQTVTISCSGSSSNIRIVGVSWYQLLPGSAPKTLIYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLSLNS
Pantholops hodgsonii V799 iglv AGTT01266193.1 2347 CLSQPLLTQPASLSASPGASARLTCTLSSGYNVGSYNIYWYQQKAGSPPQYLLRFKSDSDKRQGSGVPSRFSGSKDASTNAGLLLISGPQPEDEDDYYCAVWHG
Pantholops hodgsonii V800 iglv AGTT01266200.1 570 SWAQAALTQPSSVSGSLGQSVSITCSGSSSNIGSSGVAWLQQLPGLGLRTVIYYSSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCTAYDSSSSN
Pantholops hodgsonii V802 trav AGTT01266571.1 8946 VRGMDVVQSPPALSLQEGASSTLRCNFSTFADNVRWYLQNSGGRLIHLIYIPSGTKQEGRLNATTVPTERRSSLNISSSQTTDSGTYFCAAQHSAPQ
Pantholops hodgsonii V803 trav AGTT01267091.1 4768 GTNGDSVSQTEGPVTVSEGALMTLNCTYQTTYPDFYLFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVTSDSSFHLQKRAVQASDLAVYYCALS
Pantholops hodgsonii V804 trav AGTT01267091.1 2539 SIMAQKVTQNRSEISVLEKEDVTLNCAYEADSYTYYLFWYKQPPSGEVIFLIHQESYNELNTTKGQYFLNFQKATSSISLTISDLQLEDSAVYFCALR
Pantholops hodgsonii V805 trav AGTT01267095.1 16811 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTADPAPYLFWYVQHFNKAPQLLLKGLTADKKVEHEGFQATPVKSESSFHLQKRAVQASDSAVYYCALS
Pantholops hodgsonii V806 trav AGTT01267095.1 11317 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTAGLTPYLYWYIQHLNKAPRLLLKGSARDPKPKSEDFQATLVQSDRSFHLQKRAVQASDSAVYYCSLS
Pantholops hodgsonii V809 iglv AGTT01273847.1 3120 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGRYGVGWFQQLPGSGLRTVIYDSTKRPSGVPDRFSGSKSGNTATLTISSLQAEDETDYYCAAYDSSSSN