WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Bubalus bubalis AWWX00000000.1 (AWWX01) 203 12 14 7 86 53 8 23
Bubalus bubalis ACZF000000000.2 (ACZF02) 13 0 0 0 5 3 1 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Bubalus bubalis V0 trav AWWX01015829.1 95 GTGAQLVTQSDGHINISEGNRLELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLSGPTRVKGIKGFEAEFKKDENSFHLMKASAHWSDSAKYFCALY
Bubalus bubalis V1 trav AWWX01246015.1 1487 VSSKNQVEQNPPSLVVLEGQNCTFQCNYTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGRYTATVDATAKHSSLHLTAAQLSDPAFYICVVG
Bubalus bubalis V2 trav AWWX01249459.1 673 VQGLDVEQSPPALNLQEGASHVLRCNFSASVNNVQWYLQKPSGRLIHLFNIPSGTKQNGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bubalus bubalis V3 trdv AWWX01291581.1 1222 SSVAQQITQVQTAVPSQVGQTVTLNCQYEVSWTTEYYNIFWYKQLPRGEMTFLIRQYSEDDNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCAFWG
Bubalus bubalis V4 trdv AWWX01292935.1 4237 SSMADKVTEAQTTVTAREREAVTIGCTYETSQTYYTLFWYRQFPGGRIEFLIHQDSSNANAKRDRYSVNFQKGKKIISLTISSLYPADSAKYFCALWE
Bubalus bubalis V5 trav AWWX01293393.1 280 SIMAQKVTQNQSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSREMIFLIHQESYNELNKTKDQYFLNFQKATSSISLTISDAQLEDSAVYFCALR
Bubalus bubalis V6 trav AWWX01293500.1 302 MNGQQIKHFSEFLLLQDGENFTTYCNSSSTFYNLQWYKQRPGGSPALLMILAKGGEVKTEQRLTGRLGKTRHSSLHLTAAQLSDAGTYFCAGHSALE
Bubalus bubalis V7 trdv AWWX01313851.1 2076 SGVAQKVTQDQPEISSQVGESATMNCQYETSWNSYHIFWYKQLPSGEMIYLIGQNSYSPNARYGRYSIHFQRSRKAISLIISALKLEDSAKYFCALWE
Bubalus bubalis V8 trbv AWWX01314207.1 136 LVDSGVTQTPKYLIKSRKQQVILRCSPESGHRYVSWYQQALGQGPQFLVQYFDGKVSTKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAVYLCASSQ
Bubalus bubalis V9 trbv AWWX01315420.1 653 ISADPGITQIPKYLVMGMTDNKSLTCEQHLGHDAMYWYKQSAQKPPELMFVHNYQKLTGNESVPSRFWSECPDSSQCRLDLNALKPQDSAVYLCASSR
Bubalus bubalis V10 ighv AWWX01319144.1 193 VLSQVQLKESGPSLVKPSQTLSLTCTVSGFSLSSYAVGWVRQAPGKALECLGGISSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTTEDRATYYCAR
Bubalus bubalis V11 ighv AWWX01324272.1 82 VLSQVQLRESGPSLVKPSQTLSLTCTASGFSLTSYAVGWVHRAPGKALEWIGGLDNDGDTCYNPALKSQLSITKDNSKSQVSISLSSLTTEDTAVYYCAK
Bubalus bubalis V12 ighv AWWX01328336.1 2513 VLSQVQLQESGPSLMKPSQTLSLTCTTSGLSLTRYGIHWVRQAPGKALEWLGDISSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTATYYCAR
Bubalus bubalis V13 trav AWWX01335307.1 347 VSSQQNTVEQSPASLPVPEGAAASLSCTYSDSNSQYFKWYRQYPGKGPEFLLQVYANNNKEEGKFTAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bubalus bubalis V14 ighv AWWX01342633.1 146 VLSQVQLKESGPSLVKPSQTLSLTCTVSGFSLSSYAVGWVRQAPGKALECLGCIDSDGDTGYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTATYYCA
Bubalus bubalis V15 trdv AWWX01375227.1 418 SCVAQKVTQDQPYVTSQIGQSVILNCRYEVSWSRYKHYLYWYKQLSSGEMTFLIRQESSGPNARNGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVRE
Bubalus bubalis V16 trbv AWWX01385916.1 30 LVDSGVTQTPKYLIKPRKQQVILRCSPESGHLSVYWYQQALGQGPQFLVRYYNGQENEKGNMPDRFSVEQFGDSSSQMNLSSLELTDSAVYLCASSK
Bubalus bubalis V17 trgv AWWX01387246.1 226 TQVSSNMEEDKLSVMRATGSSVVIDCDLTGSYIHWYKFQEGAVPQRLLYYDVSNSKVVLGSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Bubalus bubalis V18 iglv AWWX01387398.1 674 SWAQAVLTQPSSVSGSLGQSVSITCSGSSSNVGYGYMSWYQQIEGSAPRMLIYGASSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASADSSSSN
Bubalus bubalis V19 ighv AWWX01388569.1 82 VLSQVQLRESGPSLVKPSQTLSLTCTASGFSLTSYAVGWVHRAPGKALEWIGGLDNDGDTCYNPALKSQLSITKDNSKSQVSISLSSLTTEDTAVYYCAK
Bubalus bubalis V20 ighv AWWX01402510.1 906 VLSQVQLRESGPSLVKPSQTLSLTCTTSGFSLTSYGVGWVRQAPGKALEWVGGVDNDGDTCYNPALKSRLSITRDTSKSQVSLSLSSVTPEDTATYYCAR
Bubalus bubalis V21 ighv AWWX01414272.1 193 VLSQVQLKESGPSLVKPSQTLSLTCTVSGFSLSSYAVGWVRQAPGKALECLGGISSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTPEDTATYYCAK
Bubalus bubalis V22 ighv AWWX01420846.1 82 VLSQVQLRESGPSLVKPSQTLSLTCTASGFSLTSYAVGWVHRAPGKALEWIGGLDNDGDTCYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTAVYYCAK
Bubalus bubalis V23 trav AWWX01422591.1 1293 GTSGDSVTQTEGVVTLPEKASLTLKCTYQSSYSDFLLWYVQYQNKELELLLKSSLNQKVASRGFEATHISSDSSFHLQKSSMQTSDSAVYYCALS
Bubalus bubalis V24 ighv AWWX01425918.1 905 VLSQVQLKESGPSLVKPSQTLSLTCTASGFSLTSYAVGWVRQAPGKALEWVGGLDNDGDTCYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTAVYYCAK
Bubalus bubalis V25 ighv AWWX01426466.1 193 VLSQVQLKESGPSLVKPSQTLSLTCTVSGFSLSSYAVGWVRQAPGKALECLGGISSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTPEDTATYYCAK
Bubalus bubalis V26 iglv AWWX01426660.1 1307 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGYGNYVSWYQQIEGSAPRRLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASADSSSSN
Bubalus bubalis V27 trbv AWWX01458104.1 19137 VRAQTIHQWPSTRVQPAGSPLSLECTVKGTSNPSLYWYRQEAGGSLQQLFYSVSAGQIEPREFQNFKASRPQDGQFTLSSKKLQLNNSGFYLCAWS
Bubalus bubalis V28 trav AWWX01461426.1 15311 PSVAQTVTQPQPEESVQETGTVTLDCTYSTSESDYYLFWYKQPPRGEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Bubalus bubalis V29 trdv AWWX01461437.1 906 VMSAVVLVPQDQEKTVAVGKSATLSCSMKGATFISKYYIFWYRKTPGNTMTFIYQERGVYGPGFEDNFRGKIVNLTNQAVLEVLKASERDEGFYYCATD
Bubalus bubalis V30 trav AWWX01466126.1 2731 QSVTQPEAEVPVSEGDPVTVKCTYSVSGSPYLFWYVQHHNQGLQFLLKYISGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVR
Bubalus bubalis V31 trav AWWX01466131.1 5045 SAGKGVEQPTELMAIEGASTQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGWETRGHFSSFLRRSDAQGYLLLKELHMKDFASYLCAVI
Bubalus bubalis V32 trav AWWX01466143.1 3351 GLRAQSVTQPEAEVSVAEGDPVTVKCTYSVSGSPYLFWYVQHGNQGLQFLLKYITGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bubalus bubalis V33 trav AWWX01466152.1 1353 QSVTQPEAEVPVSEGDPVTVKCTYSVSGSPYLFWYVQHHNQGLQFLLKYIRGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bubalus bubalis V34 trav AWWX01466157.1 5455 GLRAQSVTQPEAEVHVAERDPVTVKCTYSVSWSPYLFWYVQHRNQGLQFLLKYIGGDTLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bubalus bubalis V35 trav AWWX01475857.1 1055 VRGMDVAQSPPALSLQEGASSVLQCTFSTFADSVQWYLQNPGGHLIHLFYITSGTKRDGRLNATTVPAERHSSLHISSSQTTDSGTYFCAVLHSAPQ
Bubalus bubalis V36 trav AWWX01475858.1 3536 VNGQQISQIPQFLPLQEGENFTTYCNSSSTLSSLQWYKQSPGGSPVLLMILAKGGEVKTEQRLTGRLGETRKQGSLHLTAAQLSDVGTYFCA
Bubalus bubalis V37 trdv AWWX01475866.1 1380 SGVAQKVIQDQPYITSQIGQSVILKCRYELSQSGYTHYFFWYKQLPSGEMTFLIRQESFGQNARNGRYSVILQKAQNSISLTISALQVEDSAKYFCTVRE
Bubalus bubalis V38 trav AWWX01523549.1 1429 VQGVDVEQSPPALSLQEGVSYMLQCNFSTFPQSVNWYLQNPGGRIIHLLYIPSGTKQDGRLNATTVPKEGHSSLHISSSQTTDSGTYFCAVQHSAPQ
Bubalus bubalis V39 trav AWWX01523581.1 1208 TVINAKTTQPSSMDCAEGEDVTLPCNHSTIGGEDYIHWYQQNPSQSPQYVIHGLRGTVNSSTASLTIASDRKSSTLVLPQVTLRDTAVYYCILRE
Bubalus bubalis V40 trav AWWX01523585.1 2039 VRGVDVEQSPPALSLQEGASYTLRCNFSTYSQSVNWYLQNPGGRIIHLFYIPSGTKQDGRLNATTVPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bubalus bubalis V41 igkv AWWX01539046.1 2229 SSGDIVLTQTPLSLSVFPGETASISCRASQSLEDSYGDTYLSWHLQKPSQSPQLLIYLVSNRASGVLDRFTGSGSGTDFTFKISRVEAEDAGVYYCQQSIQ
Bubalus bubalis V42 igkv AWWX01539049.1 5603 SNGAIVLTQTPRSLSVIPGETASISCRASQSVQNRYGDNLLHWYVQKPSQSPQLLIYGASNQASGVSDRFTGSGSGTDFTLKIGRVEAEDAGVYYCQQSKETP
Bubalus bubalis V43 igkv AWWX01539053.1 3164 SSGDVVLTQTPPSLSIIPGEMASISCKSSQSLVHSDGKTYLSWIQYKPGQSPQGLIYQVSNHYSGVSDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGTEDP
Bubalus bubalis V44 igkv AWWX01539055.1 4611 TRCDIQVTQSPSSLSASLGDRVSITCQANQSVSHYLNWYQQKPGQVPKLLIYYATSLYTRVPSRFSGSGSGTDFTLTISSLEADDAATYYCQQDYS
Bubalus bubalis V45 igkv AWWX01539056.1 9604 ASGEAVLYQTPAYITVPLGESISITCRANQSISDYLSWYKQKPGQAPMILIYDADNRYNGVPERFTATQSETEFVFTISQVEADDAATYYCQQDYAFP
Bubalus bubalis V46 trav AWWX01559964.1 698 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGGSPVLLMILAKGGEVKTQRRWTGRLGESKQHSSLHLTAAQLSDAGTYFCAE
Bubalus bubalis V47 trav AWWX01559969.1 1827 VNNQQGKQKLQTLSIQEGENVTINCSYNITLTALQWYRQDSRRGFVHLILMRSNERQTHSGRLHFTLDNSIKSSSLSITASRAEDTATYLCAP
Bubalus bubalis V48 trav AWWX01559977.1 8175 RTNGDSVNQTEGPVTVSEGALMTLNCTYQTANSAPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVKRDSSFHLQKRAVQASDSAVYYCALS
Bubalus bubalis V49 trav AWWX01560001.1 773 GTNGDSVNQKEGPVTVSEGALLTLNCTYQNTYSDPYVFWYVQHLNKAPQLLLKGSMKDQSPVREGFQATLVRSDSSFHLQKRAVQASDSAVYYCALS
Bubalus bubalis V50 trav AWWX01560011.1 1505 GTSGDSVTQTEGVVTLPEKASLTLKCTYQSSYSGFLLWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bubalus bubalis V51 trav AWWX01560015.1 809 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTTDLAPYLFWYIQHLNKAPQLLLKGSMSDQNPKSKGFQATLVKRDSSFHLQKRAVQASDSAVYHCALR
Bubalus bubalis V52 trav AWWX01560036.1 6047 GSNGDSVTQPKGQVTLLEGESLTVNCSYETKQYPALFWYVQYLGEGPQLLLRAQRGNEKGSNKHFEATYNTETISFHLEKALVQESDSAVYYCAR
Bubalus bubalis V53 trav AWWX01560039.1 2337 DSRGQSVTQPDDPVLVSEGTSLELKCNYSYSATPYLFWYIQYPRQRPQLLLMYFAGNTVVQGIRGFVAEFKSNDFSFNLRKFSAHWSDSAEYFCALS
Bubalus bubalis V54 trdv AWWX01560056.1 2212 SGVAQKVTQDQPEISSQIGESATMNCQYETSWNSYNIFWYKQLPTGEMIYLIGQNSYSPNARDGCYSVNFQRSRKAISLIISALKLEDSAKYFCALWE
Bubalus bubalis V55 trav AWWX01560057.1 3110 VSSLLTVEQRPLLLWVQEGESTNFTCSFPSSSFYALHWYRWKPAKGPKNLFVISVNGDEKKQGRVRVTLNTKEGYSSMYLRGSQPEDSATYLCA
Bubalus bubalis V56 trav AWWX01560059.1 522 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPALLMILAKGGEVKTEQRLTGRLGESKQHSSLHLTAAQLSDAGTYFCA
Bubalus bubalis V57 trdv AWWX01560060.1 3267 SGVAQKVTQDQSDVASQVGQSVTLNCQYETSWTTYSLYWYKQLPSGQMTYVIHQGSLATNANKDRYSVNFKKADKSISLTISALQLEDSAKYFCALSD
Bubalus bubalis V58 trdv AWWX01560063.1 768 SGVAQKVTQDQSDVSSQVGQSVTLNCRYETSWSAYYLYWYKQLPSGQMTYVIRQGSEVTNARKDRYSVNFKKADKFISLTISALKLEDSAKYFCALCD
Bubalus bubalis V59 trav AWWX01560073.1 1778 GTGAQLVTQSDGHINISEGNRLELRCNYSYGGSIYLFWYVQYPNQGLQFLLKYLSGPTRVKGIKGFEAEFKKDENSFHLMKASAHWSDSAKYFCALY
Bubalus bubalis V60 trdv AWWX01560080.1 1349 SGVAQNVIQDQPNTSGQLGQSVTLNCRYGTTWSYYYMFWYKLLPNGEMIYLISQASSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Bubalus bubalis V61 trav AWWX01560085.1 1114 VRGVDVEQSPPALTPQEGASSTLWCNFSTSADSVLWYLQKPGGRLIHLIYIPSGTRQEGRLNASTVPKERRSSLHISSLRTTDSGTYFCAVQHCAPR
Bubalus bubalis V62 trav AWWX01560088.1 584 VRGVDVEQSPPALTPQEGASSTLWCNFSTLADSVRWYLQKPRGRLIHLIYIPSGTRQEGRLNATTVLKERRSSLHISSLWTTDSGTYFCAVQHCAPR
Bubalus bubalis V63 trav AWWX01565336.1 1650 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVSRSPYLFWYVQHRNQGLQFLLKYIGGDTLVKSNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bubalus bubalis V64 trbv AWWX01567351.1 787 LKDAAVTQFPRRRILEAEKELTLQCSQKMNHYAMYWYRQDPGFGLRLIYYSTGPDSFKKGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAE
Bubalus bubalis V65 trav AWWX01571776.1 3079 GVRTMKVEQSPSVLNLQEGANCTLRCNFSATMKTLQWFQQNPGGSLISLFFIASGMKQNERLSSTVNSKEQYSTLHITASQLEDSATYLCAVE
Bubalus bubalis V66 trav AWWX01578817.1 1788 TVINAKTTQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQLTLRDAAVYYCVLRE
Bubalus bubalis V67 trav AWWX01585449.1 3302 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTTDLAPYLFWYIQHFNKAPQLLLKGSMSDQNPKSKGFQATLVKRDSSFHLQKRAVQASDSAVYYCALC
Bubalus bubalis V69 trav AWWX01594621.1 98 GTRAQTVTQPESHTYVSEGAPVQVKCNYSYSGSPVLFWYVQYPRQRLQLLLKHTSRESIQGFTAELSQTEASFHLKKPSAQEEDSAVYYCALG
Bubalus bubalis V70 igkv AWWX01606205.1 2058 SSGDVVLTQTPLSLSVIPGETVSISCKSTQSLKYSDGKTYLCWLQHKPGQSPQGLIYQVSNRNTGVPDRFTGSGSETDFTLTISSVQAEDAGVYYCYQA
Bubalus bubalis V71 igkv AWWX01606205.1 8450 SIGAIMQTQTPCSLSVIHGETASISCRASQSIQNRYGDNFLHWYVQKSSQSPQLLIYRASNWESWVPDRFTSSGLGTDFILIISRVEAEDAGVYYCQQSLQ
Bubalus bubalis V72 trav AWWX01606236.1 11541 LRRADWIRSQDSEVSGEEGKTVSLFCNYYTSSRNFISLLWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Bubalus bubalis V73 trav AWWX01607238.1 3720 VSLENKVEQSPSTLSVQEGNSCFITCTYTDVTSSYFPWYKQEPGKGPQLLIDIRSNMRKNEGQRLTVLLNKTAKHLSLNITTTEHGDSAVYFCAAS
Bubalus bubalis V74 trav AWWX01613158.1 7385 VSAEQLNQSPQSMSIQEGEDVSMNCNSSSMLNLLLWYKQDAGQGPILLIKLLKGGELARNGKRTAQFGGTRKDSLLNISASEPKDAGTYFCAG
Bubalus bubalis V75 trav AWWX01613174.1 3484 GTNGDSVNQTEGPVTVSEGALMTLNCNYQTRYSNPYLFWYVQRLNKAPQLLLMSLTADKKVEHEGFQATLVKRDSSFHLQKRAVQASDSAVYYCALS
Bubalus bubalis V76 trav AWWX01613174.1 9178 RTNGDSVNQTEGPVTVSEGALMTLNCTYQATYSTPYLFWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLDRTDSSFHLQKRAVQASDSAVYYCALS
Bubalus bubalis V77 trav AWWX01617875.1 19448 VSGKNGVEQSPQYLSAQEGDLVTINCNYLEGMTTLQWLQQNPGGGIISLLILSLEMKRKGRVSATINSRERYSSLNITASQPTDSAIYFCAVE
Bubalus bubalis V79 trav AWWX01628401.1 2382 RTNGDSVNQTEGPVTVSEGALLTLNCTYQATYSNSYLFWYVQHLNKAPHLLLMSLTADKKVEHEGFQATLVKRDSSFHLQKRAVQASDSAVYYCALS
Bubalus bubalis V80 trav AWWX01186966.1 946 QSVTQPDSHITVSEGARLKLRCNYSSPVSPYLFWYAWVNLPDSLALRVQYPNQGLQLLLKYISGEGLVSGIKGFKAEFKSGATFHLEKPLAHWRDLAKYFCALG
Bubalus bubalis V81 trdv AWWX01293290.1 1134 SIMAQKVTQNRSEISVLEKEDVTLNCAYEANSYTYYLFWYKQPPSGEIIFLIHQDSYNELNTTKDQYFLNFQKATSSISLTISDSQLEDSAVYFCALR
Bubalus bubalis V82 trav AWWX01293305.1 1019 VSLGNKVEQSPSTLSVQDGNSCFITCTYTDVTSSYFPWYKQEPGKGLQLLIDIRSNMGKNEGQRLTVILNKTAKHLSLNITTTEPGDSAVYFCAAC
Bubalus bubalis V83 trav AWWX01293695.1 2495 VSGKNQVEQSPPSLVVLEGENCTFQCNYIVSPFNNLRWYTQDTGRGLVSLITMTYSDNRKSNGRYNASVDATAKHSSLHLTAAQLCDPAFYICVVG
Bubalus bubalis V84 trav AWWX01293701.1 383 GAGAQSVTQPDDHITVFEGARLELKCNYSSFVSPSLFWYVQYPSQGLQLLLKYVSGDNLVSGIKGFEAEFRRSEKSFHLRKIPALWKDSAKYFCALS
Bubalus bubalis V85 trdv AWWX01293743.1 950 SGVAQKVIQDQPDTSSQLGQSVTLNCRYATAWSYMFWYKLLPNGEMIYLIGQVFTGQNARNGRYSVNLQKASKSISLTISDLQLEDSAEYFCALWE
Bubalus bubalis V86 trbv AWWX01309009.1 1816 AVHAGVTQDPRFQVVRTGQKATLTCTQDLGHNYMCWYRQDLGHGLRLIHYSARPSSTEKGDMPDGYSVSRSSKDSFPLTLESANHSQTSVYFCASSY
Bubalus bubalis V87 trbv AWWX01315000.1 1206 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFAQALGQGPQFLLQYFDGEVYQRGNMSDRFSGQQLGDSRSELNLTSLELMDSALYLCASSP
Bubalus bubalis V88 trav AWWX01315503.1 699 GTSGDLVTQTEGVVTLPEKASLTLKCTYQSSYSDFLLWYVQYQNKELELLLKSSLGNQKVTSRGFEATHISSDSSFHLQKSSVQTSDSAVYYCALS
Bubalus bubalis V89 trgv AWWX01316723.1 748 IQQEIRVFQRSVMVGHTGGAITMPCQISKSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLRKLAKSDEGLYYCATWES
Bubalus bubalis V90 iglv AWWX01317127.1 689 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGSGNYVSWYQQIEGSAPRTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCATYDSSSSN
Bubalus bubalis V91 iglv AWWX01384581.1 1459 SWAQAVLTQPSSVSGSLGQSVSITCSGSSSNVGSGNYVSWYQQIEGSAPRRLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCVSADSNSDN
Bubalus bubalis V92 trbv AWWX01384693.1 638 LVDSEVTQTPKYLIKSRKQQVILRCSPESGHQSVYWYQQALGQGLQFLIQYYNRAEYEKGNISDRFSGKQFSDSSSELNLTSLELTDSAMYLCASSQ
Bubalus bubalis V93 trbv AWWX01385422.1 979 AVHAGVTQNPRFQVVRRGQSATLTCTQDPGLDRMYWYQQDLGHGLRLIHYSAGVHTCEPGDMPHGYSVTRSNTENSPLMLESAKCSQTVVYFCASSYSMELQ
Bubalus bubalis V94 trbv AWWX01385624.1 726 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFAQALGQGPQFLLQYFDGEVYQRGNMSDRFSGQQLGDSRSELNLTSLELMDSALYLCASSP
Bubalus bubalis V95 trav AWWX01389025.1 732 GLRAQSVTQPEAEVRVAEGDPVTVKCTYSVSRSPYLFWYVQHRNQGLQFLLKYIGGDTLVKSNYGFEAEFNKSQTSFHLKKPSVLGSDSALYFCAVS
Bubalus bubalis V96 ighv AWWX01414756.1 2161 VLSQVQLKETGPSLVKPSQTLSLTCTVSGFSLSDSSVGWVRQAPGKALEWLGAIYSGGSTGYNPALKSRLSITKDNSKSQVSLSLSSVTTEDTATYYCAK
Bubalus bubalis V97 trav AWWX01420703.1 3700 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGYGNYVSWYQQIEGSAPRRLIYGATSRAVGGPRPILRLQVWDTATLTISSLQAEDEADYFCASADSSSSN
Bubalus bubalis V98 iglv AWWX01420712.1 564 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGYGNYVSWHQQIPGSAPRTLIYGGTSRASGVPDRFSDSRSGNTATLTISSLQPEDEGDYYCSSYGSSSSI
Bubalus bubalis V99 trav AWWX01423417.1 3229 RTNGDSVHQTEGPVIVSEGALMTLNCTYQTASLVPYVFWYVQHLNKAPQLLLKGWMKDQSPVHEGFQATLVRTDSSFHLQKQAVQASDSAVYYCALS
Bubalus bubalis V100 trav AWWX01423438.1 1712 NVFDAKTTQPSSMGYPEGEEVTLPCNDSTISGNECIYWYWQYPKQSPQYVIHGLRDTVNSSMASLTITSDRKSSILVLPQVTLRDTAVYYCVLRE
Bubalus bubalis V101 trav AWWX01427253.1 905 TVIDAKTTQPSSMDCAEGKDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYVIHGFRDTVDSSTASLTIASDRKSSTLILSQVTLRDTAVYYCVLRE
Bubalus bubalis V102 trav AWWX01441469.1 1803 KSTQQVEQNPQFLRIQEGGNVTVHCNSSSTFTFFQWYRQKPEQGPVLLMTLTKPKEMKEQKRIRAQFGEARKDSSLLITAAQPGDAGTYLCAG
Bubalus bubalis V103 iglv AWWX01446283.1 1901 HLASSQLTQPPVVSVSLGQTASITCQGDDFESSFAHWYQQKPGQAPVLVIYESSGRPSGIPERFSGSSSENTATLTISGAQAEDEADYYCQSADISGV
Bubalus bubalis V104 iglv AWWX01456016.1 1083 SLSQPVLTQPVTLSASLGASARLSCTLSSGYNVSNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPSRFSGSKDASTNAGLLLISGLQPEDEADYYCAVWHG
Bubalus bubalis V105 trbv AWWX01458078.1 3240 SMDTEVTQSPSHLVKGKDQKAKMDCVPIKGHASVYWYHKKLEAFEFLVYLLNGKITEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bubalus bubalis V106 trbv AWWX01458106.1 16245 PLEADVTQSPRHRITETRKRVTLTCSQNMNHDVMYWYRQDPGLGPKLIYFSRNVGFIEKGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSE
Bubalus bubalis V107 trbv AWWX01458106.1 10423 LMDAQVTQTPRYLVKRRGEKVMIECIQNMDHERMFWYRQDPALGLQLLHFSIDVGMVEEGHVPHGYNVSRKKKESFPLTLESATTNQTSMYLCASSE
Bubalus bubalis V108 trbv AWWX01458106.1 4696 SVFGALLSQKPSRAICQRGTSVTIECHQVDSQLASMYWYRQLPGQSLVLMATANQGSKATYESGFTENKFPISRPKLAFSTLTVSNASSEDSSSYFCSAG
Bubalus bubalis V109 trbv AWWX01458106.1 1693 SVFGALLSQKPSRAIHQRGTFVTIECQVDSQVNFMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPISRPKLEFSTLTVSNASSEDSSSYFCSAG
Bubalus bubalis V110 trbv AWWX01458113.1 9410 SMDTEVTQSPSHLIKGKDQRAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNQNMMEDTALFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQ
Bubalus bubalis V111 trbv AWWX01458113.1 4903 PMDAEIYQVRFLLAEAGQDVTLECKQNLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSAHTNQTAVYLCSG
Bubalus bubalis V112 trbv AWWX01458114.1 1585 SMDTEVIQSPGHLVKGKGQKAKMDCVPIRGHINVYWYHRKLEEALEFLVYFQKQDIVKGTEVFKERFSADCPQNSPCSLEISSTEAADSALYFCASSQ
Bubalus bubalis V113 trbv AWWX01458121.1 4740 STDTEVTQSPSHLVKGKGQKAKMDCVPIRGHINVYWYRRKLEEAFEFLVYFQEQDIVKGTEVFKERFSADCPHNSPCSLEINSTEAADSALYFCASSQ
Bubalus bubalis V114 trbv AWWX01459658.1 2238 TTDANLGVTQTPRHEVTEKGQEVTLSCEPIKSHTALYWYRQTSVRGLELLAYFRNEAPIDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSATYLCASSK
Bubalus bubalis V115 trbv AWWX01459663.1 624 AVHAGVTQEPRFQVVRRGQSMTLKCTQDPGLDRMYWYRQDLGHGLRLIYYSVGPPSTEKGDVSDGYGVSRSSKENFPLTLESANHSQTSVYFCASSYSRALR
Bubalus bubalis V116 trbv AWWX01459665.1 10483 AVHAGVTQDPRFQVVRRGLSMTLRCTQDLGNDRMYWYRQDQGHGLRLIHYSAGPPTTEKGEVPEGYSVSRSRKENFSLTLESANRSQTSVYFCTSSY
Bubalus bubalis V117 trbv AWWX01459665.1 5754 AVHAGVTQDPRFQVVRTGQNVTLRCTQDLYHDSMYWYRQDLGHRLRLIHYSSLTDATYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCASST
Bubalus bubalis V118 trbv AWWX01459665.1 2814 HTGAGAVSQSPRHKVAGRGQTVNLRCDPISGHVSLYWYRQTLGQGPEFLTYFQDEQELDTSGMPKNRFYAERPEKTYSYLKIQPAEPGDSAVYLCASSP
Bubalus bubalis V119 trbv AWWX01459668.1 4412 AVHAGVTQDPSFQVVRRGQKATLTCTQDLGHDCMYWYRQDREHGLRLIHYSVAAPATEKGDIPEGYSVSRPSTENFLLTLKSANHSQTSVYFCASSY
Bubalus bubalis V120 trbv AWWX01459668.1 899 LVDSGVTQTPRYLIKARGQHGTLGCSPVSGHLSVYWYQQALGQGPVFLVQYYRKEVRGEAQLPDRFSGKQFSDFHSELNLSSLELMDSAVYLCASSQ
Bubalus bubalis V121 trbv AWWX01459670.1 1814 AVLAGVSQDPRFQVLRTGQSVTLTCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPHATEKGAVPEGYSVSRPSTENFPLRLESANRSQTSVYFCTCGY
Bubalus bubalis V122 trbv AWWX01459671.1 1103 AVHAGVTQDPRFQVVRRGQSTTLTCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPTTEKGAVPEGYSVSRPSTENFPLTLESANRSQTSVYFCACGYP
Bubalus bubalis V123 trbv AWWX01459674.1 1311 LVDSGVTQTPKYLIKPRKQQVILRCSPESGHLYVSWYQQALGQGPQFLVQYYNERENEKGNMPDRFSGEQFGDSSSQMNLSSLELTDSAVYLCASSK
Bubalus bubalis V124 trbv AWWX01459675.1 1238 AVHAGVTQDPRFQVVRRGQSATLTCTQDLSFNYLNWYRQDPGHRLRLIHYSVIPPSTEKGAVPEGYSVSRPSTEDFPLTLESANRSQTSVYFCTCGY
Bubalus bubalis V125 trbv AWWX01459678.1 664 AVHAGVTQDPRFQVVRRGQSMTLKCTQDLGHDRMYWYRQDPGHGLRLIHYSAGVHTSEPGDMPDGYSVTRSNTENSPLMLESANRSQTVVYFCASSYSRAQQ
Bubalus bubalis V126 trbv AWWX01459693.1 2640 AVHAGVTQDPRFQVVRRGQSATLTCTQDLGHDRMYWYRQDLGHGLRLLHYSNGPPTTEKGDVPEGYSISRPSTNDFPLTLESAKRSKTSVYFCASSY
Bubalus bubalis V127 trbv AWWX01459693.1 345 LVDSGVTQTPRYLIKARGERGTLGCSRVSGHLSVYWYQQALGQGPQFLVQYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSALYLCVSSQ
Bubalus bubalis V128 trbv AWWX01459697.1 1211 VCADPGITQIPKYLVMGMTDKKSLTCEQHLGHNAMYWYKQTAQKPPELMFVHNFQEIAGNESVPSSFWPECPDSSQCRLDLNSLKPQDSAVYLCASSR
Bubalus bubalis V129 trbv AWWX01459698.1 580 ISADPGITQIPKYLVMGMTDNKSLTCEQHLGHDAMYWYKQSAQKPPELMFVHNYQKLTGNESVPSRFWPECPDSSQCRLDLNALKPQDSAVYLCASSR
Bubalus bubalis V130 trbv AWWX01459700.1 3167 TWGTGVFQTPKYLLTQMGTKTSLECEQKLNHDSMYWYKQDSKKLLKAMFSYNNKLLVENETVPSRFSPQSPDKAHLNLHIDSLEPGDSAVYFCASS
Bubalus bubalis V131 trav AWWX01469291.1 895 VSSQQNTVEQSPASLPVPEGDTASLGCTYSDSTSQYFAWYRQYPGKGPEFLLYVYANNNKEEGKFTAQSNKTNKHVSLRIRDSEPSDSATYLCAV
Bubalus bubalis V132 trav AWWX01469293.1 4462 VSSQYTLDQSPSFLSIQERTYADVNCTYQKKTFYNFVWFKQEPGKELVSLSLIQSSQKEEADKNFKELLGKEKVYSVLHISASHPGDSATYFCALHRSALQ
Bubalus bubalis V133 trav AWWX01469294.1 1521 VSGKNQVEQSPPSLVVLEGENCTFQCNYTVSPFNNLRWYTQDTGRGLVSLITMTYSDNKKSNGWYTATVDATAKHSSLHLTAAQLSDPAFYICVVG
Bubalus bubalis V134 trav AWWX01469297.1 2117 QTRGDSVTQLGGQVTLPEKAAMTINCTFSVTGYPTVFWYVQCSREGPQILLKATKDKEKGISKEFEATYHRKSKSFHLKKASVQESDSGVYYCALR
Bubalus bubalis V135 trav AWWX01469303.1 2859 SIIAQKVTQDPQPMLAQEKEAITLNCTYDTRDSSYTLFWYKQPSNGAMIFILHQDSYGKQNATKGRYSLNFQKASKSITLVISASQLEDSAVYFCALRE
Bubalus bubalis V136 trav AWWX01469307.1 1623 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATGYPILFWYVQYPGEGPELLLKAMKANDKETNKGFVATYNTETTSFHLEKASVQESDSAVYYCALS
Bubalus bubalis V137 trdv AWWX01469326.1 4144 SGVAQSVTQDQPDILSEVGKAVTLNCQYETSWDMFHYYIFWYKQIPSGQMTYLIRQHSDDGNARDSRYSVNFQKAHKSISLTISDLELEDSAKYFCLLLD
Bubalus bubalis V138 trdv AWWX01481649.1 742 SGVAQKVTQDQPDISSQVGQSVTLNCRYETSWSYYTLFWYKQLPSGQMTYLIQQYSEHGNARNGRFSVNFQKADKSISLIISSLQLEDSAKYFCALC
Bubalus bubalis V139 trav AWWX01481653.1 3829 VSSKQDVSQSPEALNVREADSVVLNCSYTDSALFFLQWFRQDPGKGLTPLLSVQANQKEQASGRITVSLDKSSRHSALYIAASQHSDSTTYLCAV
Bubalus bubalis V140 trdv AWWX01481685.1 4490 SGVAQSVTQDQPDIVSEVGKAVTLNCQHETSWDMLYYYIFWYKQLPSRQMTYLIRQYSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCLLLD
Bubalus bubalis V141 trgv AWWX01484468.1 12825 GHGLSKVEQAQISLSTEAKKSIDIHCKIESTNFGSEAVHWYRVKLNQALEHLVYVTSTTTAARKQVDGKNKIEARKDARMFTSTLTVHFVEKEDVGIYYCAGWS
Bubalus bubalis V142 trgv AWWX01484468.1 8777 GLGQLTLEQPEVSLTGTREKSVIMSCKVFSKDFRKDYIHWYRQKLDQGLEQLLYVLTVPVLKDLGGKKNKLEAKKDNPSSTSTLKISFLEKEDEATYYCAGWFL
Bubalus bubalis V143 trgv AWWX01484468.1 4962 IPITQHITSITKKKGNTAFLECKIKIDKLKKNVYMHWYRQKPEQPLKRVLYISSNENVVHEQGISEERYEARKSPSNSLVSLRIHQATEEDAGLYYCACWV
Bubalus bubalis V144 trgv AWWX01484469.1 3373 GLGLSKVEQAQISLSTEVKKSIDIRCKIESTNFESEAVYWYRQKKNQALEHLVSVTSTTTAARNQVDGKNKIEARKDAQMFTSTLTVHFIEKEDVGIYYCAGWS
Bubalus bubalis V145 trav AWWX01502222.1 1028 TVIDAKTTQPNSVDCAEGENVTLPCNHSTIGRDEYIYWYWQNPNQSPQYVIHGLRDTVDSSMASLTISSDRKSSTLVLPQVTLRDTAVYYCVLRE
Bubalus bubalis V146 trdv AWWX01502224.1 1740 QIVTEDQPYISSQAGEVVTLNCHYETHRSSYIFWYKQLRSGQIIYLILQDSSTQNAMDVHYSVNFQRSHKSLSLTISDLQLEDSAKYFCTLWELSA
Bubalus bubalis V147 trav AWWX01502249.1 3954 QTRGDSVSQTDGQVTLLEGATLTVNCTSSATGYPTLIWYVQYPGEGPELLLKATKANDKGTNKDFEATYNAKTTSFHLEKAPVQESDSTVYYCALS
Bubalus bubalis V148 trav AWWX01502262.1 1751 VSLGNKVEQSPTLSVQEGNSSVITCTYTDGNSDYFPWYKQEPGKGPQLLIAIRSNKAKEEDQRLTVLLNKTAKHLSLHIATTEAGDSAVYFCAAS
Bubalus bubalis V149 trav AWWX01502263.1 1935 QTRGDSVSQMDGQVTLLKGATLTVNCTYSATRYPTLFWYVQYPGEGPELFLKATKANGKGTNKGFEATYNTETTSFHLEKAPVQESDSAVYYCALS
Bubalus bubalis V150 trav AWWX01502269.1 636 QTHGNSVTQMDGHVSHSERTSMTINCTYSTSGYPYLFWYVQYPGEGPELLLKATKANEKGTNKGFEATYNTATTSFHLEKDSVQESDSAVYYCALR
Bubalus bubalis V151 trav AWWX01502270.1 2903 TLSLAKTSQPIFIDSYEGQEVNISCNHTTIATSDNIFWYRQFPNQGPRFIIHGYKTNVENEVASLLIPPDRKFSTLSLPQASLRDTAVYYCIVGE
Bubalus bubalis V152 trdv AWWX01502271.1 6790 SSVAQQVTQVQTAVPSQVGQTVTLNCRYEVSWTTEYYYIFWYKQLPRGEMTFLIHQYSEYGNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCALWE
Bubalus bubalis V153 trdv AWWX01502271.1 721 SGVAQNVTQDQPVIISQLGKVATLNCRYEISRNVHDYWIFWYKQLPSGEMTYLIRQYSEDRKERDGRYSVNFQKECKSINLTISFLKLEHSAKYFCALW
Bubalus bubalis V154 trdv AWWX01502274.1 1866 SGVAQRVIQDQPDTSSQLGQSVTLNCRYGTTGSYYYVFWYKLLPNGEMIYLIGHSGQNARNGRYSVNFQKASKSSSLTISNLQLEDSAEYFCALWE
Bubalus bubalis V155 trdv AWWX01502279.1 3052 SGVAQKVTQDQPAISTQVGQSVTLNCRYETSSGVYYLFWYKQLPSGQMTYLIQQYSEHGNARNSRYSVNFQKADKSISLIISSLQLEDSAKYFCALRE
Bubalus bubalis V156 trav AWWX01502291.1 957 GVRGMKVEQSPSVLSLQEGANSTLWCNFSNTVNSVQWFQQNPGGSLTRLFFIASGTKKNERLSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Bubalus bubalis V157 trav AWWX01502296.1 360 SSIAQKVTQDQPPKSVQEKETVTLDCTYDTGDTTYSLFWHKQHSIGVMTFLIRQDSYNKPNTAEGRYSLNFQKESKFITLTISASQLEDSAGYFCALSE
Bubalus bubalis V158 trav AWWX01502300.1 855 NVFDAKTTQPSSMDYPEGEDVTLPCNHSTVSRTEYIHWYRQNPSQSPQYVIHGFQDTVNSSMASLTIASDRKSSTFVLPQVTLRDTAVYYCVLRE
Bubalus bubalis V159 trav AWWX01502312.1 5125 TVIDAKTTQSMDCAEGENVHLPCNHSTIGGDEYIHWYRQNPNQSPQYVVHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCVLRK
Bubalus bubalis V160 trav AWWX01502312.1 2107 VRGVDVEQSPPALSLQEGASYTLLCNFSTSQQSVNWYLQNSGGHLIQLFYIPSGTKQDGRLTATTVPKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bubalus bubalis V161 trav AWWX01541049.1 409 TVIDAKTTQPSSMDYTEGEDVTLPCNHSTIGRNEYILWYRQNPNQSPQYVIHGLRGTVNSSTVSLTIASDRKSSTLVLPQVTLRDAAVYYCILRE
Bubalus bubalis V162 trdv AWWX01541119.1 1351 SSVAQQVTQVQTAIPSQVGQTVTLNCRYEVSWTKNYYYIFWYKQLPSGEMTFLIRQYSVHLNARNGRYSVNFQKADKSISLIISALQLEDSAKYFCAFWG
Bubalus bubalis V163 trdv AWWX01541131.1 3561 SSVAQRVTQDQPEIASQVGEVVTLSCQYETIQSRYNIYWYKQLPSGEMIYLIGQGSSSQNARYGRYSVNFQRSRKSISLTISDIQLEDSAKYFCALWE
Bubalus bubalis V164 trav AWWX01541135.1 2208 TVIDAKTTQPSSMDCAEGENINLPCNHSTIGGNEYIHWYRQNPNQSPQYVIRGLQGTVNSSMASLTIASDRESSTLVLPQVTLRDTAVYYCILRE
Bubalus bubalis V165 iglv AWWX01564291.1 24946 SVVSYELTQPTSVSVALRQTAKITCSGDLLDKKYTYWYQQKPGQGPVRVIYKDSERPSGIPDRFSGSSSGNTATLTISGAQTEDEADYYCLSADSSDI
Bubalus bubalis V166 iglv AWWX01564291.1 12852 SVVSYELAQLTSVSVTLGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVMYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYI
Bubalus bubalis V167 iglv AWWX01564291.1 8119 QLASSQLTQPPAVSVPLGQTASITCQGEDFESAFAHWYQQKPGQAPVLVIYESSERPSGIPERFSGSSSENTATLTISGAQAEDEADYYCQSADIIGV
Bubalus bubalis V168 trav AWWX01564450.1 2745 VYSQQGEQNLQTLSIQEGENVTMNCSYKSITLNALQWYRQDSRRGFVHLILMRSNERQKHSGRLHFTLDNSIKSSSLSIMASQAEDTATYLCAS
Bubalus bubalis V169 trbv AWWX01566778.1 21393 SVFGALLSQKPSRAICQRGTSVMIECRQVDSQLPWMYWYRQLPGQSLVLMATANQGSKATYERGFTEDKFPISRPKLEFSTLTVSNASSEDSSSYFCSAA
Bubalus bubalis V170 trbv AWWX01566778.1 18907 SVFGALLSQKPSRAICQRGTSVMIECHQVDSQLTWMYWYRQLPGQSLVLMATSNQGSKATYERGFTEDKFPIDRPKLEFSTLTVSNASSEDSSSYFCSAG
Bubalus bubalis V171 trgv AWWX01567237.1 26510 TQVSSNTEGEKMSITKATGSGSSVEIICDLITQTLKYIHWYKYQEGTAPRRLLYYDISYSKVVLESGVSEGKYKVYKEKSYTFAILNLQESDSGMYYCAAWE
Bubalus bubalis V172 trbv AWWX01567925.1 14530 AVHAGVTQDPRFQVMRRGQSMTLRCTQDLGHDRMYWYRQDLGHGLRLIHYSDGVHTSQPGDVPNGYSVSRSNTGNFLLTLESANHSQTSVYFCASSY
Bubalus bubalis V173 trbv AWWX01567925.1 12304 LVDSGVTQTPRYLIKARGQLGTLRCSPVSGHLSVYWYQQAPGQGPVFLVQYYRQDVSGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAMYLCASSR
Bubalus bubalis V174 trbv AWWX01567925.1 10474 AVHAGVTQDPRFQVVRRGQSATLTCTQHLNHDYMYWYRQDPGHGLRLIYYSAGPPTTEKGDAPDGYSVSRSSKKNFPLTLVSANHSQTSVYFCASSYSKA
Bubalus bubalis V175 trbv AWWX01567925.1 7182 AVHAGVTQDPRFQVVRSGQNATLKCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPSTEKGAVPEGYSVSRPSTENFPLRLESANRSQTSVYLCTCGY
Bubalus bubalis V176 trbv AWWX01567925.1 3530 VVHAGVSQDPSFQVIRRGQSVTLKCTQDLGHNSMYWYRQDLGHGLRLIHYSHGPPIMEKGDVPEGYSVSRPSKNDFPLTLESANRSQTSVYFCASSY
Bubalus bubalis V177 trbv AWWX01567925.1 1308 FVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPEFLVEYYRQEVRGEAQLPDRFSGKQFSDFHSELNLSSLELTDSAVYLCASSQ
Bubalus bubalis V178 iglv AWWX01575697.1 12747 SWAQAVLTQPPSVSGSLGQTVTITCTGSSSNIGILGVSWYQQLQGSAPKTLIYDSNKRPSGVPDRFSGTKSGNTATLTITSLQAEDEADYYCASADLSLSG
Bubalus bubalis V179 trbv AWWX01578242.1 6781 SMDTGVTQTPRNRIANTGKSTVLECSQTKDHESMYWYRQDPGQGLRLIYSSYGINDINKGDVSDGYNVSRKEKAKFSLYLEPATPNQTAIYFCASNI
Bubalus bubalis V180 trav AWWX01578693.1 8902 GAGAQSVTQPDDYIAVSEGARLELKCNYSSPFSPYLFWYVQYPNQGLQLLLKYVSGDNLVSGIKGFEAEFRSSEKSFHLRKIPAHWKDSAKYFCALS
Bubalus bubalis V181 trbv AWWX01578966.1 871 SMDTEVTQSPSHLVKGKDQKAKMDCVPIKGHVHVYWYHKKPEGAFEFLVYLWNGKITEDTAMFKQRFSAECPQNSPCSLEINSTEPADSALYFCASSQ
Bubalus bubalis V182 trav AWWX01579752.1 6032 VSLGNEVEQRPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLIAIHSNMGEKKDQRLTVLLNKTAKHLSLHIATIQPGDSAVYFCAAR
Bubalus bubalis V183 trav AWWX01579752.1 2049 SIIAQKVTQEQPQVLGQEKEAVTLDCKYDTSDSGYSLFWYKQPSSGGMILLIRQDSSNQQNATEGRYSLNFQKARKSITLVISASQLEDSAVYFCALRE
Bubalus bubalis V184 trbv AWWX01585102.1 4703 GSGLGALVSQQPRRAVSKSGASVTIECRAVDFQASSMFWYRQFPKRGLVLMATSNEGTNATYEQGYNKDKFPISHPDRTFSSLMVTSVDPADSGLYFCSAR
Bubalus bubalis V185 trgv AWWX01585909.1 5600 IQQEIRVFQRSVMVGHAGGAITMPCQISKSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLRKLAKSDEGLYYCATWES
Bubalus bubalis V186 trav AWWX01586287.1 731 LSGEDQVEQSPQTLRIQEGNGLILNCSYTASSFKGLQWYRQDPGKGPELLFLLHSVGDEKQKERLRATLLKKGSSLHIEAPKPKDSATYLCTVE
Bubalus bubalis V187 trav AWWX01593039.1 3367 GVRGVKVEQSPSVLSLQEGANSTLRCNFSETVNNVQWFQQNPRGSLTRLFFIASGMKKNERMSSTVNSKEQYSTLHITASQLEDAATYLCAVE
Bubalus bubalis V188 trav AWWX01597551.1 802 VRGVNMEQSPPALTPQEGASSTLWCNFSTSADSMRWYLQKPPGASSSTSFTFLQETRQEGRLNATTVLKERRSSLHVSSLRTTDSGTYFCAV
Bubalus bubalis V189 trav AWWX01598012.1 627 VLGDSKTTQPNSVEGAEEEPVHLSCDHSTISGPEYVYWYRQIPHQGPEYLIHGLNNNVTNRMASLSIAKDRKSSTLVLPQVTLRDTAVYYCVLRD
Bubalus bubalis V190 trav AWWX01598603.1 3701 LSVQMKVEQSPGVLTLQEGRNSSLICNFSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Bubalus bubalis V191 trbv AWWX01601563.1 11007 PLEAEVTQTPRHLIKTTGQTATLRCSPMSGHSSVSWYQQAQSQGPQFIFEFYETLQRAKGNFSNRFLAKQFHDFSSELNVNSLDLTDSALYLCASSL
Bubalus bubalis V192 trbv AWWX01601563.1 6067 HTRAGVVSQSPGYRVAGRGQTVNFRCDPIPGHQVLYWYRQMLGQGLEYLTYFQGKEEPDKSGMPKNQFSAERPESTYSYLKIQPVEPEDSALYLCASSP
Bubalus bubalis V193 trdv AWWX01604479.1 3848 SSVAQRVTQDQPDISSQVGEVVTLSCQYEARLSIYRIFWYKQLPSGEMIYLIGQVSSSQNARDGRYSTDIQRSRKSISLTISDLQLEDSAKYFCTLWE
Bubalus bubalis V194 trav AWWX01605987.1 2161 IMVDAEITQLSSMDCAEGEDVNLPCNHSTIDPLDYKRWYQQNPNQSPQYVIHGLQDTVNSRMASLNIASDRKSSTLVLPQVTLRDTAVYYCILKE
Bubalus bubalis V195 trav AWWX01606052.1 309 SIIAQKVTQDQPQVLGQEKEAVTLDCKYDTSDSRYSLFWYKQPGSGGMILLIRQDSNQQNATEGRYSLNFQKAGKSITLVISASQLEDSAVYFCALRE
Bubalus bubalis V196 trbv AWWX01613003.1 17319 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQAPIDESGMPKDRFSAKMPNVSFSTLKIQPTDPGDSATYLCASSK
Bubalus bubalis V197 trbv AWWX01613003.1 14839 YISAEVSQSPSHRVIEKKQAVNLSCDPISGHESLFWYYHATGKEMKLLIYFLRESMQDDSGMPKGRFTAERTEGTSSTLRVHSAELGDSGVYFCASSR
Bubalus bubalis V198 trbv AWWX01613003.1 12516 HVGAMVVQNPRYLVTGLGKPVTLSCSQNMKHDAMYWYQQKPSQAPKLLLYYYDKQITKEKNTSENFQSSRPNTSFCSLDIRSAGLGDSAVYLCASSR
Bubalus bubalis V199 trbv AWWX01613003.1 7782 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILSKEFKFLISFQNDKVLDDKEMPKKRFSAECPSNSPCSLKIQPTEPQDSAVYFCASSD
Bubalus bubalis V200 iglv AWWX01614629.1 9497 SWAWAVLTQPSSVSGSLGQRVSITCTGSGNNIGIVVVSWYQQLPGSGLRTLIYGTSSRASGVPDRFSGSRSGDTATLTISSLQAEDEADYFCAAADSSSDN
Bubalus bubalis V202 iglv AWWX01617716.1 3107 SWAQSGLTQPSSMSGNLGQTVTISCAETSIDVGSYNGVGWYQQLPGSAPKTLIHNVSKRPSGIPDRFSGSKSGSTATLTISGLQAEDEADYYCGSPRSG
Bubalus bubalis V203 ighv AWWX01618464.1 10316 EGVGPQPGEALTDPLPHMHGLWILIDQLCCKRVRQAPGKALEWVGVIYSGGSTGYNPALKSRLSITRDTSKSQVSLSVSSVTTEDTAVYYCAR
Bubalus bubalis V204 trav AWWX01620080.1 1290 QTHGNSVTQMDGQVSRSEGTSVTINCTYSSSGYPNLFWYVQYPGEGPQLLLKAMKANDKGTNKGFEATYNTETTSFHLEKDSVQESDSAVYYCALR
Bubalus bubalis V205 iglv AWWX01628674.1 7333 SWGQSGLTQPSSVSGNLGQTVTISCAGTSSDIGGYNGVGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCS
Bubalus bubalis V36 trbv ACZF021130083.1 29 AVHAEFTQDPRFQVVRRGQSATLTCTQDLGHDRMYWYRQDLGHGLRLLHYSNGPPTTEKGDLPEGYSISRPSTNDFPLMLESAKRSKTSVYFCASSY
Bubalus bubalis V37 trbv ACZF021130107.1 260 GLFWCHSGPRFPVVMTEQSATLKCTQDLGHDHEYWYRQDLGHGLRLIHYSAGAHTSEPGDMPDGYSVSRPSTENFPLTLKSANRSQTSVYFCASSY
Bubalus bubalis V38 trbv ACZF021130225.1 207 SMDTEVTQSHSHLVKGKDQRAKMDCVPKEGHTYVYWYHKKLDEALEFLVHLQDEEIIEDTAMFKQRFSAECHQNSPCSLEINSTEAADSALYFCASSQ
Bubalus bubalis V45 trav ACZF020102781.1 445 VQGLDVEQSPPALSLQEGASHVLICNFSASVSNVQWYLQNPKGRLIHLFYIPSGTKQNGRLKATTIPTERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Bubalus bubalis V46 trav ACZF020102856.1 407 KSTQQVEQNPQFLRIQEGGNVTVHCNSSSTFTFFQWYRQKPEQGPVLLMTLTKPKEMKEQKRIRAQFGEARKDSSLLITAAQPGDAGTYLCAG
Bubalus bubalis V47 trdv ACZF020102917.1 456 SSVAQQVTQVQTAVSSQVGQIVTLNCRYEVSWTTEYYYIFWYKQLPRGEMTFLIHQYSEYGNARNGRYLVNFRKEHKYISLIISALQLEDSAEYFCALWE
Bubalus bubalis V48 trav ACZF020102981.1 471 MNGQQIKHFSEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPALLMILAKGGEVKTEQRLTGRLGESKQHSSLHLTAAQLSDAGTYFCA
Bubalus bubalis V49 trav ACZF020103173.1 318 TMINAKTTQPSCVDCAEGEDVNLPCSHSTIGGNEYMHWYQQNPNQNTQYVIHGLRGTVSSSMASLTTASDRKPSTLVLPQVILRDTAVYYCILRE
Bubalus bubalis V50 trdv ACZF020103178.1 458 SGVAQKVIQDQSDVSSQVGQSVTLNCRYETSWTAYYLFWYKQLPSGQMTYVIRQGSLVTNASKDRYSVNFKKADKSISLTISALQLEDSAKYFCALCE
Bubalus bubalis V51 trdv ACZF020103380.1 351 SGVAQKVTQDQPDITYQVEQSVTLNCQYEVSWYMISYSIFWYKQLPSGQMTYLIRQYSEDGNARDGRYSVNFQKADNSISLTVSALQLEDTAKYFCALRE
Bubalus bubalis V52 trav ACZF020103555.1 526 SAGKGVEQPTELMAIEGASTQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGWETRGHFSSFLRRSDAQGYLLLKELHMKDFASYLCAVI
Bubalus bubalis V56 trdv ACZF020379656.1 386 TQAQMVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Bubalus bubalis V81 trgv ACZF021096845.1 451 IQQEIRVFQRSVMVGHTGGAITMPCQISKSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLRGDKVNAARGTDGKSCTMSLRKLAKSDEGLYYCATWES