WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Equus asinus JREZ00000000.1 (JREZ01) 277 16 30 19 114 58 21 19
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Equus asinus V621 trav JREZ01000039.1 7309459 VSQGENVDQHPPSLSVQEEKSCVINCTYSDSYSTYFSWYKQEPGKGPQLIIDILSNVDKKENPRLTVLLNEKAKYLSLHIAATQPGDSAVYFCAV
Equus asinus V699 trav JREZ01000039.1 6287535 GARAQTVTQPEESTSVIEGAPVQVKCNYSSSGSPYLFWYVQYPNQGPQLLLKHTSGESIKGFTANLNKGEKSFHLKKLSAQEEDSAMYYCALS
Equus asinus V700 trav JREZ01000039.1 6278718 VNSQKVEQNLQALSIQEGENVTMNCSYKTTITNLQWYRQDAGRGLALLILIRSHEKLKPGGRLQVTLDSSSKSSSLSITASRAADTATYFCAVE
Equus asinus V743 trav JREZ01000039.1 5548398 SSCGSKITQSSNMVTMIGIDVKFQCQHNTPDGNYDSVYWYLQRANQRLTYIYHAFRGTMESEHYLLSMDRELSSSTLTIKHVQPRDKAIYYCALR
Equus asinus V955 trav JREZ01000223.1 32141 TVGQDVHQPSELTAMEGAFVQVNCTYQTSGFNGLSWYQQHDGGAPIFLSYNVLDGWERKGHFSSFLSRSDTYSYLFLKELQVEDSASYLCAVS
Equus asinus V59 igkv JREZ01000033.1 3484851 CRGQIILTQSPETLAASQGSFISITCRSSIEVGTSMAWYQQKPNEAPRLLIFGASARAVGTPSRFRGSGSGSVFSLTIHGLEAKDFGVYYCQ
Equus asinus V60 igkv JREZ01000033.1 3505725 TTREGLLTQSLASLSLSPRERATLTCRASESVSSYLAWYQQKPGKALKLLMYGASTSATGIPARFSSHGSGTDFTLIIIHLDPKNVAVYYCCQCNSGY
Equus asinus V61 igkv JREZ01000033.1 3518891 NTRDIVMTQTPLSLPVVPGELTSVSCRSSQRLLYSSGNTFLNWYLQKPGQSPQLLIYMLSNWLSGVLNRFSGSGSGTDLTLKISRVEAEDVGVYYCVQVLQNP
Equus asinus V62 igkv JREZ01000033.1 3526220 STGDTVLTQTPLSLSVIPGESASISCKSSQSLLHGNGNTYLHWYLQKPGQSLQCLISMVSNWASGVPDRFSGSGSGTDFTLKISRLEAEDVGVYYCMQA
Equus asinus V63 igkv JREZ01000033.1 3549527 SSADVVLTQTPLSLPVVPGEPASISCKSSQSLKHSDGKTYLYWFLQKPGQSPKLLIYLVSTRYSGVSDRFSGSGSETDFTLKISRVEPEDVGVYYCVQALYAS
Equus asinus V64 igkv JREZ01000033.1 3569312 SNGDVVMTQTPLSLSVVPGEPASISCKSSQSLKHSDGNTYLYWFLQKPGQSPKHLIYLVSIRVSGVSDRFSGSGSETDFTLKISRVEPEDVGVYYCVQALYAP
Equus asinus V65 igkv JREZ01000033.1 3593558 TRAEITVTQSPESMLVIPGDKVIITCKASQDIGDDVNWYQRKPGEAPKLIIKEATTLWSGVPSRFSGTVHGVDFTLTIDDVKSEDAAYYFCLQHDRIP
Equus asinus V66 igkv JREZ01000033.1 3643345 SSGDVVMTQTPLSLPVVPGEPASISCKSSQSLLDSDGKTYLYWYLQKPGQSPKFLIYSVSNRDSGISDRFSGSGSGTDFTLKISRMEPEDVGVYYCVQA
Equus asinus V67 igkv JREZ01000033.1 3655722 SSGEIVLTQSPAFLSGTPGEKATITCRANQGISNYLHWYQQKPNQPPKPIIKYVSESISGVPARFSGSRSGTDFTLTISRPEAEDAATYYCQHSYYHL
Equus asinus V68 igkv JREZ01000033.1 3673887 ARCEIQMTQSPASLSASLGDRVTITCQATQGVNTWLAWYQQKTGKALKFLISKATILHTGVSSRFSGSGTWTDFTLTISSLEPEDAATYYCQQYKSSP
Equus asinus V69 igkv JREZ01000033.1 3762616 SSGDIVMTQTPLCLAVTLGEPVSISCRSSQSLLRSDDYTYLDWYLQKPGQSPRLLIYEVSKLVSGVSDRFSGSGSGTDFTLQISRVEAEDVGVYYCMQG
Equus asinus V78 trdv JREZ01000039.1 5336819 KDVICNEVTQSPPELTVANGNKVTLFCTYKTAYSNPDLYWYRIRPDYSFQFILYRDNTRSHDADFTQGRFSVQHGKTQKTFHLVISSVRTEDSAIYYCAIL
Equus asinus V264 trbv JREZ01000229.1 4019 SPMDAGITQKPRYHITQTGDKMILECSQTMSHLAMFWYRQDPGQGPRLIHYSSGVNSTAKGDITEGYSVSRNKKEVFLLTLESASTKQTSLYLCASSE
Equus asinus V265 trbv JREZ01000229.1 40158 HTVESAGVTQFPNHRVIEKKQAVTLRCDPISGHEALYWYRRAVGKEIKFLVYFLGEDKQDDSGMPNKQFSAERTGGTFSTLNIQHAELEDSGVYFCASSQ
Equus asinus V266 trbv JREZ01000229.1 42059 HMGAMVTQEPRYQVTRKGKTVTLGCSQNLSHEYMYWYQQKPSQPPKLLFYYYDKDFNNETDTSDNFQSSRPNTSFCSLSIRSPGVGDSAVYLCASKR
Equus asinus V267 trbv JREZ01000229.1 75120 PVDSGVSQTPRHLIKAKGQQVTLRCSPISGHNSVFWYQQPLGQGPQFLIQYHNGRENEKGNIPDRFSGQQFGDYSSELNVSVLQLKDLALYLCASSA
Equus asinus V268 trbv JREZ01000229.1 78568 PVDSGVIQTPRHVVKAKGQQAMLKCSPIYEHDTVSWYQQALGQGPKFLIQYYNGEVREKGDIPDRFSGQQFGNQSSELNLTILELTDSALYLCASSL
Equus asinus V269 trbv JREZ01000229.1 83281 PVNAGVTQTPRFQILGTGQNTTLRCAQDMNHNSMYWYRQDLGHGLRLIHYSAGAGVTEEDGPDGYRVSRSNTKNFPLTLVSATPSQTSVYFCASSY
Equus asinus V270 trbv JREZ01000229.1 101687 STDAGVTQEPRHYVTKMRQAVTLSCEPVSNHTALFWYRQTSVKGLKFLIYFRNQAPIAQTGMPKDRFSAEMPNRSLSTLKIQRTEPGDSAMYICASSL
Equus asinus V271 trbv JREZ01000229.1 107226 PVDSGVTQTPRYLIKARGQQVTLRCSPISGHNRVFWYQQPLGQGPQFLFYYYNGKENEKGDVPARFSGQQFSDYRSELNVSVLELKDSALYLCASSS
Equus asinus V272 trbv JREZ01000229.1 123494 HTDTGVSQSPRHRVTQYGEDVAFRCDPISEHTRLYWYRQTSGQNMEFLTYFQNDFASDTSGMPSDQFSAERPKGSYSTLKIQRAEQRDSAVYLCASSL
Equus asinus V273 trbv JREZ01000229.1 140232 HTVESAGVTQSPNHRVIEKKQAVTLRCDPISGHASLYWYRRAVGKEIKFLVYFLRKDKQDDSGMPNERFSAERTEGTFSTLKVQPAELEDSGVYFCASSQ
Equus asinus V274 trbv JREZ01000229.1 142124 HMCAMVTQNLKYQITRKGKLVTLSCFQNLNHELMYWYQQKPSQAPKLLFSYYDKEFNNETDTSDNFLPSRPNTSFCSLSICSPGVGDSAVYLCASR
Equus asinus V275 trbv JREZ01000229.1 146702 ALDAAVTQTPGHLVKGKEQKVKMNCVPKKGHRFILWYQQKLAKEFKFLISFQNETILDEGQMPKERFSAACPPNSPCSLEIPPTELQDSAVYLCASGE
Equus asinus V276 trbv JREZ01000229.1 173550 HTEPEVSQTPSHQVTEMGQEVILRCDPISGHLNLYWYRKILGQKVEFLISFYNENLSEKSEIFKDGFSAERSNGSFSTLKIQLTEVGDSAVYLCASSL
Equus asinus V277 trbv JREZ01000229.1 183771 PSDTAVSQTSKYLISQVGNKKTLSCEQNLGHNAMYWYKQDSEKLLKIMFIYYNNERNLNETVPSRFSPEAPDKAHLNLHISSLEPGDSAVYFCASSQ
Equus asinus V278 trbv JREZ01000229.1 201584 PVDSGVTQTPRHLIKARGQQVTMRCSPISGHKSVSWYQQPLGQGPQFLVQYYNRRENEKGDISDRFSGEQFSNYSSELNVSILELTDSALYLCASSV
Equus asinus V279 trbv JREZ01000229.1 210510 AVNAGVTQTPKFHILETGQNTTLICAQDMNHDYMYWYRQDLGHGLRLIHYSRTSGVTEAGDIPDGYRVSRSNTENFLLTLVSPTPSKTSVYFCASS
Equus asinus V281 trbv JREZ01000229.1 222262 PVEAGVTETPRYLIKTTGQAVTLRCSTISKHSGVSWYQQALSQDPHLLFEFYENVQRAKGEIPNRFSAQQLRDYRSELNVRVLELMDSALYLCASSV
Equus asinus V282 trbv JREZ01000229.1 254862 HTSAGVTQFPSHRVVEKKQSVTLRCDPVPGHQALFWYQRAVGKEITFLIYFLRENKQDESGMPNKRFSAERTGGTFSTLKIQPAELEDSGVYFCASSQ
Equus asinus V283 trbv JREZ01000229.1 264104 PIDSGVTQEPRHQVTKMGQDVTLRCEPISSHTDLFWYRQTSVQGLEFLIYFSNQAVIDQTGMPKDRFSAEMPNRSFSTLKIQHTEPRDSAVYLCASSL
Equus asinus V284 trbv JREZ01000229.1 280883 QVDSGVIQTPRHLIKAKGQHMTLKCSPISTHLSVYWYQQALGQGPQFLIQYYDGEEREKGNISGRFSGQQFRDRSSELNVSILELTDSALYLCASSL
Equus asinus V285 trbv JREZ01000229.1 285856 AVNAGVTQTPKFQVLKTRQNTTLRCTQDMNHDSMYWYRQDLGHGLRLIHYSVGAGVTANRDVPDGYRVSRSNTENFPLILVSATPSQTSVYFCASS
Equus asinus V286 trbv JREZ01000229.1 308161 HTKAGVSQSPRHRVTERGQDVAFKCDPISGHTRLYWYRQTRGQGLEFLMYFQDDFASDTSGMLKDQFSAERPEGSSPTLKIQHAEQGDSAVYLCQQL
Equus asinus V287 trbv JREZ01000229.1 331545 HMGAMVTQNPRYQITRKGNPVNLSCSQNLNHDTMYWYQQKPSQAPKLLFYYYDKEFNNETDTSNNFQSSRPNTSFCSLSIRSPGVGDSAVYLCASR
Equus asinus V288 trbv JREZ01000229.1 335628 VLDAAVTQTPGQLIKGKEQKVKMYCVPKKGHPFIFWYQQNLAKEFKFLISFQNENILDETEMPKERFSAECPPNSPCSLEIHPTELQDSAVYLCASGE
Equus asinus V289 trbv JREZ01000229.1 348444 TMDGGITQSPKSLFREEGREVTLECEQNLDYSAEYWYRQDLGQGLRLIYYSHIVNAVQKGDVSEGHSASQEKKAFFPLTVTSTQKNQTALYLCASSR
Equus asinus V290 trbv JREZ01000229.1 354303 GLGLGALVSQHPSKAICMNGTSVKIECRSMDFQARTMFWYRQLPKQGLTLMVASNDNSSITYEQGFTRAKFPINHLNRTFSTLTVMSVHPADSGLYFCSAS
Equus asinus V291 trbv JREZ01000229.1 371586 SMDTKVTQRPGHLVKGKEQKAKMDCFPIKTHIHVYWYRRKLEGEFEFLVYVRNGEITDKIEGFDQQFSVERPQDERYSLEIKSTEPGDSALYFCASSD
Equus asinus V292 trbv JREZ01000229.1 384062 TMDGGITQRPKYLIREERRDVTLECEQSLDYDYMCWYRQDPGQGLRLIYYSQVLKAVEKGDVSEGYRASREEKAFFPLTVTSTRKNQTALYLCASSR
Equus asinus V293 trbv JREZ01000229.1 399968 SMDTKVTQRPGHLVKGKEQKAKMTCVPIKSHSYVYWYRRKLEGEFEFLVYLQNNDVINKIEGFDQQFSAQCPKNASCSLEIKSTEPGDSALYFCASSE
Equus asinus V294 trbv JREZ01000229.1 414795 TMDGGITQSPKYLIREEGKDVTLECEQSLDYDYMYWYRQDPGQGLRLIYYSLFVKDIQNGDLSEGYRVSREEKAFFPLTAISTQKNQTSLYLCASSR
Equus asinus V296 trbv JREZ01000229.1 443411 TMDGRITQSPKYLIREERRDVSLECEQNLDYNAMYWYRQDPGQGLRLIHYSLFVKGVQKGDISEGYSASREKKASFPLTVKSTQKNQTALYLCAYSR
Equus asinus V298 trbv JREZ01000229.1 460104 SGLGALVSQQPSRAVCKNGSSVKIDCRPVDFQAQIVCWYRQLPNQGLTLIAISNQGSDPTYEQDFPKVKFPISHPDRTISTLTIMSAHPADSSLYFCGAS
Equus asinus V299 trbv JREZ01000229.1 472660 GSGLGVLVSQHPSRPICKNGSSVEMECRTVDLEAQTVCWYHQLPNQGITLIATSIQGSDPKYEQGFSDAKFPISHPNLTFSTLTILSAHPANSGLYFCGAS
Equus asinus V300 trbv JREZ01000229.1 497359 SMDTKVTQSPGHLVKGKEQKAKMDCVPIKTHSYVYWYRQKLEGEFDFLVYLRNGKITDKIEGFDQQFSAQYPQDASCSLEIKSTEPGDSALYFCASSE
Equus asinus V301 trbv JREZ01000229.1 502606 SIDANITQTPGHLVKSKGQKARMDCMPQKGHTSVYWYQQIQKKEFKFLIYLEDGQVLDEIELVKERFSPQCPKNLTCSLEIKSSEPGDLALYFCASSR
Equus asinus V302 trbv JREZ01000229.1 516193 LMDADVFQTPKHCVTGTGKKITLECSQSMNHNNMYWYRQDAGRELQLLHYSYGVNNTEKGDVPSESTVSRLRKDRFSLTLESASPSQTSLYLCASS
Equus asinus V303 trbv JREZ01000229.1 534964 PMDAKVIQTPRHLITETGKKLTVNCSQDMNHDAMYWYRQDPGLGLKLIRYSTNVEVLYKGDVPDGYTVSRKDKGNFSLTLESASINQTSLYLCASSE
Equus asinus V304 trbv JREZ01000229.1 560058 FMDAAVTQTERYLVKRTREKVVMECSQNMGHDSMFWYRQDPALGLQLLHFSYRVDDEQKGDAPEGYSASRKTKENFTLILESASTNQTAVYLCASSF
Equus asinus V305 trbv JREZ01000229.1 566861 FMDAKVTQTPRYLVKRIREKVVMECSQNMDHERMLWYRQDPALGLQLLHFSIGIDDKQEGDAPEGYSVSRKKKENFTLILESASTNQTSVYLCASSL
Equus asinus V306 trbv JREZ01000229.1 574667 FMDATVTQTERYLVKRRGDKVVMDCQQNMDHNSMFWYRQDPALGLQLLYFSDSVGDKQEGDAPEGYSVSRKKKENFTLILDSASTNQTSVYLCASSL
Equus asinus V307 trbv JREZ01000229.1 581694 SVFGALLSQKPSRAICQRGTTMKIQCEVDTELALMFWYSQLPGQSLTLIATANQGSEATYESGFTKDKFPISRPTLRFSTLTVNNTSPEDSSFYFCSAG
Equus asinus V441 iglv JREZ01000628.1 141122 SWAQSALTQPAPVSGTLGQSVTISCAGSTGSYKYISWYQQHPGTAPKLLIYNGNNRASGIPDRFSGSTSGNTMSLTISGLQAEDEADYYCHAYAGSYS
Equus asinus V442 iglv JREZ01000628.1 212818 SWAQSALTQPASVSGALGQSVTITCAGSSSDIGGYNAVTWLQQHPGTAPKVLIYSVNTRASGIPDRFSGSKSGNTASLTISGLQVEDEADYYCYSLVSG
Equus asinus V443 iglv JREZ01000628.1 231772 SWGQSALIQPSSVSVALGQSVTISCAGSSSDIGYYNSISWYQQHPGTTPKLLIYYTNKKHSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCCSYAGSGN
Equus asinus V444 iglv JREZ01000628.1 248392 SVSSSKLTQYPAVSFSLGQTATITCQGETLRSHYASWYQKNTGQAPVLLIYGNNNRPSGIPARFSSSYSEDTGTLTISGVQIEDEADYYCQSWGSDY
Equus asinus V445 iglv JREZ01000628.1 273300 SVVSLELTQPASVSVALGQTATITCQGGIFDKKYVDWYQQKPGGTPVIVIYKDSERPSGIPGRFSSSSSGNTATLTISRAQAEDEAVYYCHSPDSDN
Equus asinus V446 iglv JREZ01000628.1 330897 PVASSELTQPSEVSVALGQRATLTCQGSNFEFFSPSWYQQKPGQAPVLLINVNNERPSGIPERFSGSSSGDTSTLTISGAQAEDEADYYCLAVDALSSE
Equus asinus V447 iglv JREZ01000628.1 361178 PMASSEVTQPSAVSVALGQTATLTCQGDYYERYIVNWYQQKPGQAPVLVIYANSEWPSGIPERFSGSSSLGTSTLTISGAQAEDEADYYCQPADAHSSE
Equus asinus V448 iglv JREZ01000628.1 375756 PIASSELTQPSAVSVALGQTATITCKGGDFESAFGNWYQQKPGQAPVLVIYASNERPSGIPERFSGSSSGDTATLTISGAQAEDEADYYCLAADAYAAE
Equus asinus V449 iglv JREZ01000628.1 413277 SVASSELTQPPGVSVALGQTATINCQGESIESYNANWYQQKPGKAPMLVIYANSEQPSGIPERFSGSSSEGSATLTISGAQAEDEADYYCQVFDFSGNE
Equus asinus V450 iglv JREZ01000628.1 429888 GCAVSSELTQPPSVSVAPGQTAMITCGGNNIGGKYSYWYQLKPGQAPVLVIYSDSKRPSEISSRFSGSNSGNMSALIISGAWTEDEADYYCAVADGSGSS
Equus asinus V451 iglv JREZ01000628.1 479427 SVTSHDLTQPPSTLVALEQTATIPCSGDNLEDENAYWYQQKPGQSPALVIYKDSEYPSGIPDQFSGSNLGNTATLTIRGAKTEDEADYYCQSWSSAN
Equus asinus V452 iglv JREZ01000628.1 493972 SVASSMLTQPLTLSVAFGSTVTITCQGELLDSYYAEWYQQKPDQAPMLVIYYGSKRPSGISIRFSGSYSSKMATLTLSGAWAEDEADYYCQVWDSSGNQ
Equus asinus V453 iglv JREZ01000628.1 540412 SVVSSELTQPPTVSASLGQTTKITCQGGSFGSYYASWYQQKPGQAPVLVIYSNNKRSSGIPDQFSGSYSGNTATLTISRAQTEDEADYYCQSLDSSSY
Equus asinus V504 ighv JREZ01000950.1 82132 VLSQVQLQESGPGLVKPSQTLSLTCTVTGYSITSGYYWSWIRQPPGKRLAWMGSIYYSGSIYYSPSLKSRITISTDTSQNQFSLQLSSVTTEDTAVYYCAR
Equus asinus V505 ighv JREZ01000950.1 107118 AAAGVRTRPDESLTDTVPHMHCHWLLHHQWLWLELDPPATKGLEWMGSISYSGSTNYSPSLRSRITISRDTSKNQFLLQLSSVTTEDTAAYYCAT
Equus asinus V506 ighv JREZ01000950.1 147348 ALSQINLQESGPGLLKPTQTLTLTCSFSGFSLTTSDIGVGWMRQPPGKALEWLTYVWWTDEKHYNPSLKSRLTISKDTSKNQVMLTMTSLDPADTATYYCVKR
Equus asinus V507 ighv JREZ01000950.1 162408 VLSQVQLQESGPGLVKPSQTLSLTCTVTGSSITTSYSGWSWIRQPPGKGLEYMGIIYNDGDTYYNPSFKSRTSISRDTSRNQFSLQLSSVTAEDTAVYYCAG
Equus asinus V508 ighv JREZ01000950.1 165575 VEAEDPLVQWGGGVVVSSQTLTLTCAAYKRKVSEYSMWWIRLLPGKGLECVGVIWTNGDTQCSPHLQSRVSISRDTTKNQVFLQLSSVMPEDSGVYYCAQ
Equus asinus V509 ighv JREZ01000950.1 182063 VSSEVQLIQSGPELKKPGSSVKISCKASGYTFTEYAMHWVRQANGKGIEWMGYISPHDDDTSYAPKFQGRVTITVDKSTSTVYMELSSLTSEDTAVYYCAK
Equus asinus V510 ighv JREZ01000950.1 258704 VSSELQLVQSGAEVRKPGESVKVSCKASGDSFTYYSMSWVRQAPGQGLEWMGGISSVVDDTSYAQKFQGRVTMTADKSTSTVYMELSSLTSEDTAVYYCAT
Equus asinus V511 ighv JREZ01000950.1 267691 VLSQVQLQEVGPGLVKPSQTLSLTCSVSGVSITTSGDWWSWIRQPPGKGLEWMGYISYSGSAYYTTSLKSRLSISRDTSKDQFSLQLSSVTTEDTAVYYCAR
Equus asinus V512 ighv JREZ01000950.1 280370 VLSQVQLQESGPGLVKPSQTLSLTCTVTGYSITSSYGWCWIRQPPGKALQFMGCISYSGSTNYNPSLKSRISISRDASKNQFSLQLSSVTTEDTAVYYCAR
Equus asinus V513 ighv JREZ01000950.1 298021 VQCEVRLVESGGGLVKPGGSLRLTCATSGFAFSSYGMSWVCQAPGKGLQWVSSINSDGGSTHYADSVKGRFTISRDNAKNTVYLQMNSLRDEDTAMYYCTK
Equus asinus V524 iglv JREZ01001209.1 32398 SWAQCVTEPASVSGTLGSTVTISCSGSSSNIGGYGVGWFQQIQGKAPKTIISANNKQPSGIPDRFSGSKSGNTATLTISGLQADDEADYYCGTYDSSLSN
Equus asinus V525 iglv JREZ01001209.1 73909 SWAQSLTQPASVSGTLGQTVTISCSGSSSNIGNSYSSVGWFQQIPGTAPKTLIYATNTRASGVPDRFSGSKSGNTATLTISGVQAEDEADYYCVAGDSSING
Equus asinus V526 iglv JREZ01001209.1 94591 SWSEVVLTQPRSVSESLGQKATISCTHSSDNIGSSYVYWYQQHPGSAPTTVIYDDDERPSGVPDRFSGSIDSSSNAAYLTISGLQPEDEADYYCQSYDSSY
Equus asinus V527 iglv JREZ01001209.1 104238 SWAQSVTQPASVSGTLGQTVTISCTGSSSNIGSGDVSWYQQIPGTAPKLLIYSSISRASGVPDRFSGSRSGNTATLTISGLQAEDEADYYCGASGSSWSS
Equus asinus V529 iglv JREZ01001261.1 12532 SWAQSVTQPASVSGTLGQTVTISCTGSSSNVGSGYVGWYQQIPGRAPKLLIYYATNRASGVPDRFSGSRSGNTATLTISGLQAEDEADYYCGTSGSSWSS
Equus asinus V531 iglv JREZ01001261.1 66811 SWAQSVTQPPSVSGTLGQTVTISCSRSSSNIGYSSSYVSWYQQIPGTVPKTLIYYATSRVSGVPDRFSGSRSGNTATLTITGLQAEDEADYYCSAADSSLRS
Equus asinus V532 iglv JREZ01001324.1 39256 SWAQSLTQPTSVSGTLGQTVTISCSGSSSNIGYSSSYGGWYQQIPGTALKLLIYEGNKRSSGVRDRFSGSKSGNTATLTITGLQAEDEADYYCASYDSSLSS
Equus asinus V601 igkv JREZ01000033.1 4218432 ACGDIVMTQSPGSLAASLGQRVEMKCKASQSVSSSLDWYQHKPGQAPKLLIYRASSRASGVPDRFSGSGSGTDFTLTISSLQSEDVAVYYCMHAYYNP
Equus asinus V602 igkv JREZ01000033.1 4213321 ACGDIVMTQSPGSLAASLGQRVEMKCKASQSVSSSLDWYQHKPGQAPKLLIYRASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCMQSNTAP
Equus asinus V603 igkv JREZ01000033.1 4165491 ACGDIVMTQSPESLAESVGQRVEMKCKASQSVSSYLAWYQHKPGQAPKLLIYRASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYNSAP
Equus asinus V604 igkv JREZ01000033.1 4113623 ACGDIVMTQSPDSLSVSPGQRVDMKCRASQSVSNELSWYQQKPGQAPKLLIYAASNRASVVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCLQHYNNP
Equus asinus V605 igkv JREZ01000033.1 4097183 ACGDIVMTQSPGSLAASLGQRVEMKCKASQSASSYLAWYQQKPGQAPKQLIYSASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCFQSYNAP
Equus asinus V606 igkv JREZ01000033.1 4088052 ACGDIVMTQSPGSLAASLEQRVEMKCKASQSASSYLAWYQQKPGQAPKQLIYSASSRASGVPDRFSGSGSGTDFTLTISSLQAEDLAIYYCQQYNSAP
Equus asinus V607 igkv JREZ01000033.1 4033436 AFGDIVMTQSPDSLAVSLGQRVEMKCKASQSVSSYLAWYQQKPGQAPKLLIYKASNRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCFQSYNAP
Equus asinus V608 igkv JREZ01000033.1 3906826 ACGDIVMTQSLGSLAVSPGQRVTISCKASQSVSNYLDWYQQKPGQAPMLLIYAASSRASGVPDRFSGGGSGTDFSLTISSLQAEDMAVYHCQQHYTNP
Equus asinus V618 trav JREZ01000038.1 7612928 AHTQVVQVNDSMYGFIGTDVVLHCSFANLLPGVKITQVTWQKATNGSKQNVALYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Equus asinus V622 trav JREZ01000039.1 7302474 SSICQKVTQSQPAMSVQEMEAVTLNCTYDTSSGTYSLFWYKQPSSGAMIFLIRQDSYQQNATEGRYSLNFQKAKKSINLVISAPQLEDSAVYFCALSE
Equus asinus V623 trav JREZ01000039.1 7291544 QTHGESVTQMEGQVTLSEGASLTVNCTYSATGYPILYWYVQYLGEGPQLLLRAAKANEKGKNKDFEATYNTETTSFHLEKASVQESDSAMYYCAVS
Equus asinus V624 trav JREZ01000039.1 7280372 GVRGVKVEQSPSALSLQEGASSTLRCNFSITVNSVQWFRQNPEGDLINLFFTASVLKQSGRLNSTMNSKELYSTLHITASQVEDSATYLCAVE
Equus asinus V625 trav JREZ01000039.1 7271522 SSIAQKVTQDQSAVLVQEKEAVTLNCRYDTSSSSYSLFWYKQSSTGVMMLLIRQDSYNQQNATEGRYSLNFQKANKSIQLVISTSQLADSAVYFCALIE
Equus asinus V626 trav JREZ01000039.1 7265839 QTYGESVTQMEGQVTLSEGASLTLNCTYSTTGYPTLFWYVQYPGEGPQLLLRATKANKKEPSKSFEATYNTETTSLHLEKASVQESDSAMYYCAMS
Equus asinus V627 trav JREZ01000039.1 7249029 GTRAQSVTQPDVHITVSEGAPLELKCRYSSSLPSSLFWYVQYPNQGLQLLLKYTSGNSLVSGIKSFEAEFKKSDTSFHLRKPSAHWSDSAEYFCVLV
Equus asinus V628 trav JREZ01000039.1 7241662 GARAQTVTQPEDRISVIEGAPVHVKCSYSSSVSPYLFWYVQYPNQGPQLLLKHTSVESIKGFTANLNKGEKSFYLKKPSAQEEDSAMYYCALS
Equus asinus V629 trav JREZ01000039.1 7228158 GTNGDSVTQTEGPVILPEGAPLTLNCTYQSSYSFSLFWYVQYQNKEPQLLLKSSSENQGADSRGFQATLNRSDSSFHLQKPSVQVSDSAVYYCALR
Equus asinus V630 trav JREZ01000039.1 7215324 GTKGDSVNQTEGPVTLSEGAPVILNCTYQTTYSASFLFWYVQYLNKSPQLLLKSSTGNQRTEAQGFQANHVKSDSSFHLQKPSVQMSDSAVYYCAVR
Equus asinus V631 trav JREZ01000039.1 7203182 LSGDQVEQSPQTLRRQEGDSLSLNCSYTVSYFRGLQWYRQDPGKGPELLFLLSSAEREKEKERLRATLSKNGSSLHITAPKPEDSATYLCAVE
Equus asinus V632 trav JREZ01000039.1 7191990 VSSKQQVEQSPEALSVREGDSLALNCSYTDSAILFLQWFRQDPGKGLTSLLLIQSNQREQISGRMKVSLDKSSRHSALYIAASQPGNSATYLCAV
Equus asinus V633 trav JREZ01000039.1 7189210 GTGAQSVTHPDVHITVSKGAPLEVRCNCSSFVLPDLFWYVRYPNQGLQLLLKYTSGNSVVSEIQNFEAEFKKSDTSFHLRKSSTHWSDSAKYFCALS
Equus asinus V634 trav JREZ01000039.1 7183624 VRGAQVEQSPPALSLQEGASSTLRCNFSISVKNVQWFRQHPGGRLIDLFYIPSGEKQSGRLNAMTVMKERRSSLYISSSQTTNSAIYFCAVKPQC
Equus asinus V635 trav JREZ01000039.1 7171891 KSDQQQVKQSPQSLIIQEGEISILNCTYENSAFDYFPWYQQYPGEGPAFLIAIHSVVSTKEDGRCTVSFNKSTKQFSLTITAPQPGDSATYFCAAS
Equus asinus V636 trdv JREZ01000039.1 7165037 STVAQTVTQGQTATSKQEGTTVTLDCRYETGWSRYSLFWYKQLPNGEMIFLILQDSSSRDAKNGRYSTNFWKAAQFITLTISTLQLEDSAKYFCALC
Equus asinus V637 trav JREZ01000039.1 7127628 GPRAQSVTQPKDQITVAEGNPLTVKCTYSFSGSPYLFWYVQYPNQGLQFLLKYITGDSLVKGSYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Equus asinus V638 trav JREZ01000039.1 7119834 TLSLAKTTQPIFIDSYEGQEVNITCNHTDIATNEYILWYRQFPDQGPQFAIQGFKETVKNEVAILFIPHDRKSSTLSLPLATLRDTAVYYCIVT
Equus asinus V639 trav JREZ01000039.1 7112232 GTGAQSVTQPDVHVTVSEGAPLELRCNYSSSVSPYLFWYMQYPNQGLHLLLKYTSGISLVPGIKGFKAEFRRNETSFHLKKPSAHWSDSAEYFCAVS
Equus asinus V640 trav JREZ01000039.1 7109935 GMRGVKVEQSPSALSLQEESSSTLRCNFFSTVNPVQWFRQNPGGGLISLFFMTSGMKQNGRLNSTINSKELYSTLHITASRVEDSATYLCAAG
Equus asinus V641 trav JREZ01000039.1 7096259 DAKAQSVTQPDGHVLVSEGARLELRCTYSYDRAPALFWYVQYPSQGLQLLLKYFSGDALVKGIKGFEAEFRKNESSFNLRKSSAHWSDSAVYFCVLS
Equus asinus V642 trav JREZ01000039.1 7082162 DARAQSVTQPDGHVLVSEAASLELRCTYSYGATPYLFWYVQYPNQGLQLLLRYFSGDTLVEGIKGFKAELKKNESSFNLRKSSAHWSDSAEYFCAVS
Equus asinus V643 trav JREZ01000039.1 7070901 QTYGDSVTQMEGQVTLSEEASLTINCTYSATGYPTLFWYVQYPGEGLQVLLRATTPNKKETSKGFEAMYNKESTSFHLEKASVLESDSAMYYCAMS
Equus asinus V644 trav JREZ01000039.1 7052495 VRSQEVEQSPQSLIIQEGENVTINCSFSKTLYALHWYWQKHGEGPIFLMMLMKDGEEKSHDRIAAILNEKNQQSSLFITASQCSHSGTYFCGVE
Equus asinus V645 trav JREZ01000039.1 7032603 IMSDSKTTQPNAMECAEEEPVHLPCNHSTISGNEYIYWYRQIPHQGPVYMIHGIKNNVTNGMLSLTMTTDRKSSTLILPQVTLRDAAVYYCIVRK
Equus asinus V646 trav JREZ01000039.1 7008192 IVGDAKTIQPNAMESTEKEPVHLPCNHSTISGSEYIYWYRQIPYQGPEYVIHGLKSTETNGMASLIIATDRKSSTLILSQVTLRDTAVYYCVLRE
Equus asinus V647 trdv JREZ01000039.1 6993851 SSNTQSVYQAANVMSAQVGESVTLDCKITVSYTYYNMYWYRQLSSGEMTHIIRLYSANRNSREGRYSVVFQKPTLTLTISALTPGDSAVYFCAV
Equus asinus V648 trav JREZ01000039.1 6967729 SSIAQKVTQVQPAMLVQEKEAVTLNCRYDTSSVSYSLFWYKQPSSGSMIFIIRQDSYNQQIATEGRYSLNFQKANKSINLVISAAQLEDSAVYFCALSE
Equus asinus V649 trav JREZ01000039.1 6961887 QAHGDSVTQMEGQVILSEGASLNMTCSYSATGYPTLFWYIQYPGEGPQLLLSAKKDNEMGRNKGFEAKYNKEATSFHLVKASVLESDSARYYCALS
Equus asinus V650 trav JREZ01000039.1 6953068 VRSQQKAVEQSPGSLRVPEGDVASLNCTYSDSASQTFMWYRQYSGKGPELLMYIYSSGDEDKGRFTAHLNKAGQYVSLLIRDSQPSDSATYLCAV
Equus asinus V651 trav JREZ01000039.1 6937169 VNSQQGQQNLQALSVQEGENATMNCSYKSSIDSLQWYRQDAGRGFSRLILIRSNEKRKPSGRLLVTLDSSSKSSSLSITASRAADTATYFCAVE
Equus asinus V652 trav JREZ01000039.1 6931958 GTNGDSVTQTEDPITLPEGAPLTLNCTYQSSYSVFLFWYVQYQNKEPELLLKSSSENQGADSRGFQANHVNSDSSFHLQKPSVQMSDSAMYYCALR
Equus asinus V653 trav JREZ01000039.1 6917973 GLSGEDQVEQSPQTLRRQEGDSISLNCSYTVSNFRGLLWYRQDPGKGPELLFLLSSVGKPEHKERIRATLFEKGSSLHITDSKPEDSATYLCAVE
Equus asinus V654 trav JREZ01000039.1 6906713 VSSKQQVEQSPEALSVREGDSLALNCSYTDSAIYSLQWFRQDPGKGLASLLLIQSNQREQISGRMKASLDESSRHSALHIAASQPGDSATYLCAV
Equus asinus V655 trav JREZ01000039.1 6903455 GTGAQSVTQPDVHMTVSEGAPLKLRCNCSSSLPPCLFWYVRYPNQGLQLLLKYKSENNLVSGIKGFEAELNRSDTSFHLRKPSTHWSDSAKYFCALS
Equus asinus V656 trav JREZ01000039.1 6884564 AQQQVKQSPQSLIIQEGEISVLNCTYEDSVFSYFPWYRQYPGEGPAFLIAIRSGSGVNTSEGRFTVSFNKSAKQFSLTITASRPGDSATYFCAAS
Equus asinus V657 trdv JREZ01000039.1 6879601 STVAQTVTQSQTATSKQEGATVTLDCVYETSWSTYSLFWYKQLPNGEMIFLIRQDSSSQNAKSGRYSTNFWKEANFVSLTISSLQLEDSAKYFCALV
Equus asinus V658 trav JREZ01000039.1 6872293 AQQQVKQSPQSLVIQEGEISILNCTYVDSTFDYFPWYRQYPGEGPAFLIAIRSVRNEIEGGRFTVFFNKSTKQFSLTITASQPGDSATYFCAAS
Equus asinus V659 trdv JREZ01000039.1 6865432 STVAQIVTQGQTATSRQEGTTATLDCLYETSWSTYYIFWYKQLPNGEMIFLIRQGSSSQNAKNGRYSTNLQKAAKFITLTISALRLEDSAKYFCALY
Equus asinus V660 trav JREZ01000039.1 6851856 VNGQQIQQIPPSLLLQEGENFTMYCNSSSTLTRLQWYKQRPGGSPTFLMLLVSAGQMQEQERLTARFGETRKHSSLHITAAQTADVGTYFCAG
Equus asinus V661 trav JREZ01000039.1 6832489 GTGAQSVTQPDDHISVSEGAPLELRCIYSYSGTPTLFWYVQYPSQGPQLLLKYYSGNTRVKGIKDFEAEFKKNETSFHLRKSSAHWSDSAEYFCALS
Equus asinus V662 trav JREZ01000039.1 6806876 VEAQMKVEQSPGVLILQEGSNASLTCNCSNTMNRVQWFQQNPGGPLISLFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus asinus V663 trav JREZ01000039.1 6797709 VGAQMKVEQSPGVLILQEGSNSTLMCNYSNSMNSVQWFQQNPGGPLISLFYMTSKPQEKGRLKSTISTKDRYSHLYIRDSQPGDSATYFCAV
Equus asinus V664 trav JREZ01000039.1 6782429 DARAQSVTQPDGHVLVSEAASLELRCNYSYSAAVYLFWYVQYPCQGLQLLLKHLSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCAVS
Equus asinus V665 trav JREZ01000039.1 6770351 VSGVENAVQQPSTLSVQEVNSCVFCCSYSDSTLSHFSWYKQECGKGPQLITDVLSNVDKKDERLTLLFDKMVKHLSLHLAATQPGDSAVYFCGD
Equus asinus V666 trdv JREZ01000039.1 6762780 SCISQKVTQAKPALLVQEKEVVTLHCTYDTNEPTYSLFWYKQSSSGAMKFLIRQDSYNQQNAKEGRYLLNFQKANKSINLVISAAQLEDSAVYFCALSE
Equus asinus V667 trav JREZ01000039.1 6751322 GTRAQSVTQPDSHITVSEGAGLELRCNYSSSVSQFLFWYVQYPNQGPQLLLKYFSGPLLVKGIKGFEAELKKSETTFHLRKPSAHWSDSAEYFCALM
Equus asinus V668 trav JREZ01000039.1 6748768 GARAQTVTQPEDRISVTEGAPVQVNCNYSYSGSPYLFWYVQYPKRGLQLLLKHTSGESIKGFTANLNNDEGSFHLKKPSAQEEDSAMYYCALS
Equus asinus V669 trav JREZ01000039.1 6738888 VNSQQEEQNLQALSVQEGENATVNCSYKISIDNLQWYRQDAGRGLARLILIRSNKKYAASGRLQVTLDTSSKSSSLSITASQAADTATYFCAVE
Equus asinus V670 trav JREZ01000039.1 6735948 GTNGDSVTQTEGPIVLLEGTRLTLNCTYQSIYSVSLFWYVQYQNKEPELLLKSSSENQEVDNRGFQAKLVKSDSSFHLQKPSVQMSDSAVYYCALR
Equus asinus V671 trav JREZ01000039.1 6731109 VRGAQVEQSPPVLSLQEGASSTLWCNFSISVSNLQWFRQNPGGRLISLFYVPSGTQRNGRLNATTVAKERHSSLHISSSQTTDSGIYFCAVEPQCSP
Equus asinus V672 trdv JREZ01000039.1 6708845 STVAQRVTQGRTATSMQEGATVTLDCVYETSWSAYYIFWYKHLPNGEIVFLIRQDSYSPIAKNGRYSTNLQKAAKFITLTISSLRLEDSAKYFCALY
Equus asinus V673 trav JREZ01000039.1 6694360 VNGQQIQQIPPSLLLQEGENFTTYCNSSSTFNSFQWYKQRPGGSPVLLIILLSGGEVQKQERLAAQFGETRKHSSLHITAAQTADVGTYFCAG
Equus asinus V674 trav JREZ01000039.1 6688681 TVIDAKTTQPNSMDCAEGEDVKLPCNHSSIGIADYIHWYWQNPSQSPQYIINGFRDNVTNNKASLTIAADRKSSTLILPWVTLRDTAVYYCIVRK
Equus asinus V675 trav JREZ01000039.1 6678218 GTGAQSVTQPDDHITVSEGAPLELKCNFSYSTSLYFFWYVQYPSQGLQLLLKYITGDNRMVKGIKGFEAEFRKSETTFHLRKPSTYLNDSAEYFCALG
Equus asinus V676 trdv JREZ01000039.1 6632025 FSNTQSVDQPKREEYKREGESVTLDCTIVVSYTYYIMYWYRQASSGEMTHIINLDSNKKDSRQGRYSVVFRKPNLKLTISALTLRDSAVYFCAV
Equus asinus V677 trav JREZ01000039.1 6615728 GVRGVNVEQSPSALILREGTSSTLRCNFSATVNRVQWFRQNPESGLINLFFTASGTEQKGRLNCTVNSKELYSTLHITSSQLEDSATYLCAV
Equus asinus V678 trav JREZ01000039.1 6600883 KRSQQKGVEQSPGSLSVPEGANASLNCTYSDSASQSFMWYRQYSGKGPELLMYVYFDRYSTEGRFTAQHSRAGQYISLLIRDSQPSDSATYLCAV
Equus asinus V679 trav JREZ01000039.1 6589253 GTRAQTVTQPEDRISVIEGAPVQVKCNYSYSWSSTLFWYVQYPKQGLQLLLKHTSAESIKGFTANLNNDEGSFHLKKPSAQEEDSAMYYCALS
Equus asinus V680 trav JREZ01000039.1 6584072 VNSQQGEQNLQTLSIQEGENVTMNCSYKTTITNLRWYRQDAGRGLAQLILIRSNEREKPGGRLQVTLDTSSKSSSLSITASRAADSAAYFCAVE
Equus asinus V681 trav JREZ01000039.1 6578612 GTNGDSVNQTEGPVTLPDRAPLTLNCTYQSSYSVFLLWYVQYQNKEPELLLKSSSENQDVNSRGFQANHVKSDSSFHLQKPSVQVSDSAVYYCTLR
Equus asinus V682 trav JREZ01000039.1 6572896 AQQQVKQSPQSLIIQEGEISVLNCTYEDSAFGYFPWYRQYPGEGPAFLIAIRSGSGVNTSEGRCTVSFNKSAKQFSLTITAPRPGDSATYFCAAS
Equus asinus V683 trav JREZ01000039.1 6551403 TVIDAKTTQPNSMDCAEGEDVKLPCNHSTVSVDDYIHWYRQNPSQSPQYIIHGLRDNVTNNKASLTIATDRKSSTLILPQVTLRDTAVYYCIVRK
Equus asinus V684 trav JREZ01000039.1 6541858 GTGAQSVTQPDDHITVSEGAFLQLKCNYSYGGSLALFWYVQYPSQGLQLLLKYITGDPLVKGIKGFEAEFKKSETTFHLRKPSAHLSDSAEYFCALR
Equus asinus V685 trav JREZ01000039.1 6518607 NRGMVTSNRSSKILHVSVQEGGISILNCDYNNKLFDYFLWYRKYPAKGPALLISIPLGMDKNEDGRFTVFLNKSTKHLSLHIAASRPGDSALYLCAAS
Equus asinus V686 trdv JREZ01000039.1 6508981 SSMAQKVTQAQIIITRQEGEAVTMDCKYEISWTSYYDLYWYKLPPSGEMVFLIYQDYYKPSAKQGRFSVNFQSTKKSISLTISSLQSADSAMYFCALWI
Equus asinus V687 trdv JREZ01000039.1 6484519 SSNTQSVDQPKKEEHKREGESVTLDCRITVSYAYYVMYWYRQASSGEMPHIIYLLSDSRNSRRGRYSVVFQRPNLKLTISALTLTDSAVYFCAV
Equus asinus V688 trav JREZ01000039.1 6463113 VRSQQKGVEQSPGSLRVPEGTVASLNCSYSDRNSQSFMWYRQYSGKGPEFLVYAYSNNDKNEGKFIAQHSRAGQYISLLIRDSQPSDSATYLCAV
Equus asinus V689 trav JREZ01000039.1 6452006 GARAQTVTQPEESTSVIEGAPVQVKCSYSSSLSPVLFWYVQYPNQGPQLFLTHTSRKSIKGFTANLNKGEKSFHLKKLSAQKEDSAMYYCALS
Equus asinus V690 trdv JREZ01000039.1 6423580 SSVAQRVTQGQTATSMQEGASVTLDCRYETSQSTYSIFWYKQLPNGEIVFLIRQSSSSQDAKNGRYSTNLQKAAKFISFTISTLQLEDSAKYLCALQE
Equus asinus V691 trav JREZ01000039.1 6408384 VNGQQIQQIPPSLLLQEGENFTMYCNSSSTLASFQWYKQRPGGSPVFLILVSGREVQKQERLAAQFGETRKDSFLHITAAQTADVGTYFCAGAQSSR
Equus asinus V692 trav JREZ01000039.1 6402120 TVIDAKTTQPNSMDCTEGEDANLPCNHSSIGIADYIHWYRQNPSQNPQYIINGLQGNVTNNMASLTIATDRKSSTLILPQVTLRDTAVYYCIVRE
Equus asinus V693 trav JREZ01000039.1 6392369 GTGAQSVTQPDDHISVSEETSLELKCNYSSGNLYFFWYVQYPSQGLQLLLRYSSGPTLVNGIKGFEAELKKNETSFHLRKSSAHLGDSAVYFCAAS
Equus asinus V694 trav JREZ01000039.1 6341773 RSNGDSVTQTKGQVTLSEGASLTVNCSYETTQYPALLWYVQYPRKGPQLLLRASKANDKDRNKGFEATYNTETTSFHLEKASVQESDSAMYYCALS
Equus asinus V695 trav JREZ01000039.1 6336744 SSIAQKVTQAQPAMLVQEKEAATLNCTYDTSDFSYSLFWYKQPSSGAMMFLIRQDSHKQQNATEGRYSVNFQKTDKSVNLVILDSQLEDSAVYFCALRG
Equus asinus V696 trav JREZ01000039.1 6316004 GVRALNVEQSPSALSLQEGTSSTLRCNFSATVNYVQWFRQNPGSGLINLFFMTSEMKQNGRLNSTINPKELYSNLHITDSRLEDSATYLCAV
Equus asinus V697 trav JREZ01000039.1 6309432 VSGKNQVEQSPPSLTILEGENCTFQCNYTVSPFNNLRWYKWDTARGPVSLIIMSSSERRRSNGRYTATLDTTNKGSSLHITAAQLSDAAVYICVVG
Equus asinus V698 trav JREZ01000039.1 6298390 RRSQQEGVEQSPGSLRVPEGANASLNCTYSDSASQYFMWYRQYSGKGPELLIYIYSNKDKNEGRFKVQLNKAGQYVSLLIRDSQPSDSATYLCAV
Equus asinus V701 trav JREZ01000039.1 6273454 GTNGDSVTQTEGPVILPEGAPLTLNCTYQSSYSVFLFWYVQYQNKEPELLLKSSSENQEEDSRGFQAKLVTSDSSFHLQKASVQVSDSAVYYCALR
Equus asinus V702 trav JREZ01000039.1 6265560 GTNGDSVNQTEGPVTLSEGASLTLNCTYQTYSSPLLLWYIQYLKPPQLLLKSSTENQRTENHFQATLIMSDSSFHLRKPSVQMSDSAVYYCALR
Equus asinus V703 trav JREZ01000039.1 6247749 VSSKQQVEQSPEALSVREGDSLALNCSYTDSTIYSLQWFRQDPGKGLASLLLIQSNQREQVSGRIKALLDKTSRHSAFYIVASQPGDSATYFCAV
Equus asinus V704 trav JREZ01000039.1 6204969 VNGQQIQQIPPSLLLQEGENFTTYCNSSITLNRLQWYKQRPGGSPILLMMLVTGGDVQKQERLTARFGETRKHSSLHITAAQTADVGTYFCAG
Equus asinus V705 trav JREZ01000039.1 6197594 TVTDAKTIQPNSMDCAEGEDANLPCNHSTISGDDYIHWYWQNSNKSPQYIIHSLRDNVTNNMASLTIATDRKSSILTLPQVTLRDTAVYYCIVRE
Equus asinus V706 trav JREZ01000039.1 6196690 TVTDAKTIQPNSMDCAEGEDANLPCNHSTISGDDYIHWYWQNSNKSPQYIIHSLRDNVTNNMASLTIATDRKSSILTLPQVTLRDTAVYYCIVRE
Equus asinus V707 trav JREZ01000039.1 6185510 GTRAQSVTQPDDHITVSEGNSLELRCNFSYSGTPYLFWYVQYPSQGLQLLLKDITRDTLVEGIKGFEAEFNKSETSFHLRKPSAHFSDSAVYFCAVS
Equus asinus V708 trav JREZ01000039.1 6170642 ESTQQLEQSPQFLSIQEGANFTVDCNSSSIFTTFQWYKQEPGEGPVLLTMLTKGGQMRKLERLRAEFGKERKDSFLLITAAHPGDAGIYLCAG
Equus asinus V709 trav JREZ01000039.1 6165003 VGAQMKVEQSPGVLILQEGRNSSLMCNCSTTMTGVQWFQQNPGGRLISLIYIASGVQRKGRLIFTVNTKERYSHLYIRDSQRGDSATYFCAV
Equus asinus V710 trav JREZ01000039.1 6149663 VSGQKKNMVQSPSILNVWGRETAATICSYTDGALNYFSWSEKKAAKDFTLLKQIYSEADRKQDRRFTAKVQQVSLRTAAAQPGDSALYFCAG
Equus asinus V711 trav JREZ01000039.1 6139197 IMGDAKTIQPNAMESTEKEPVHLPCNHSTISGSEYIYWYRQIPHQGPEYVIHGLKSTETNGMASLTITTDRKSSTLILPQVTLRDTAVYYCVLRE
Equus asinus V712 trdv JREZ01000039.1 6125145 SSNTQSVSQPTNVVYTQVGESVTLDCKITVSYSYYSMYWYRQLSSGDMTHIIRLYSSNRNSRQGRYSVVFQKPTLKLTISDLTRGDSAVYFCAV
Equus asinus V713 trav JREZ01000039.1 6107648 GVRGVNVKQNPPALSLQEGTSSTLSCNFSTTVYSVQWFRQNPGGGLISLFFMTSVMRQNGRLNCTLNSKELYSTLYIMASQPEDSATYLCAVE
Equus asinus V714 trdv JREZ01000039.1 6085703 SSNTQSVSQPVNVMYTGEGESVTLDCKITVSYAYYNMYWYQQLSSGEMTHIIQIYSGSRNSKEGRYSVEFQKPTLTLSISALTPRDSALYFCAVVKL
Equus asinus V715 trav JREZ01000039.1 6070286 LSQGKNVEQHPSTLSIQEGNCCVINCTYSDSTLSYFRWYKQEHGKGPQLIIDIHSNVDKREDQRLAVLLNKTAKHLSLNITATQPGDSAVYFCGAS
Equus asinus V716 trav JREZ01000039.1 6063241 SSIAQKVTQAQPAMLVQEKEAVTLKCRYDTSDARYSLFWYKQPSSGAMIFLIRQDSYNQQNATEGRYSLNFQKANKSINLAISASQLEDSAVYFCALME
Equus asinus V717 trav JREZ01000039.1 6052564 QVHGNSVNQMKGPVTLSEGAFLTMNCTYSTTGYPTLLWYVQYPGEGPQLLLKASKAGEKGRNDGFEALYNEESTSFHLEKASVQESDSAMYYCVLG
Equus asinus V718 trav JREZ01000039.1 6041240 GVLGVNVEQSPSALSLQEGTSSTLRCNFSTTVDNVQWFRQNPGGSLINLFVIVSDTKQNGRLNGTVNSKELYSTLLITASQLEDSATYLCAV
Equus asinus V719 trdv JREZ01000039.1 6016152 SSMAQKVTQDEATLTRQEGDDVTMNCTYEIYWRSHYNLYWYKEPASGEMVFLVYQDYYKPSGKQDRFSVDFQKEKNFISLTISPLQLVDSATYFCVLGI
Equus asinus V720 trav JREZ01000039.1 6008654 FLNPSGTVGDAKTTQPNAMECTEEETVHLPCNHSTISGNEYIYWYRQIPHQGPEYVIHGLKKNETNEMASLTMTTDRKSSTLILPQVTLKDTAVYYCMLRD
Equus asinus V721 trdv JREZ01000039.1 5996173 SSNTQSVFQPTNVMYTRVGESVTLDCKITVSYSYYYMYWYRQLSSGEMTYLIQLYSTSSSSREGRYSVKFQKPTLTLSISALTPGDSAVYFCAV
Equus asinus V722 trav JREZ01000039.1 5984574 GVKGVNVEQSPSTLSLQEGTSSALRCNFSTTVRYVQWFLQNSGGNLISLFFVTSEMKNSGRLNATINSKELYSTLHITASQMEDSATYLCAVE
Equus asinus V723 trav JREZ01000039.1 5975659 QTYGESVTQMEGQVTLSEGASLTVHCTYSAIVYPALYWYVQYPGKGPQLLLRATKANEKGSNKGFEATYNKETTSFHLEKASVQESDSAMYYCAV
Equus asinus V724 trav JREZ01000039.1 5956512 VRSQQKGVEQSLGSLRVPEGANASLNCTYSDSASQTFMWYRQYSGKGPELLMYISSNKVKDEGRFTAQHSRAGQYVSLLIRDSQPSDSATYLCAV
Equus asinus V725 trav JREZ01000039.1 5949262 GARAQTVTQPEDRISVIEGAPVQVKCNYSYSGSPDLFWYVQYPKQGLQLLLKHTSGESIKGFTANLNKSEKSFHLKKPSAQEEDSAMYYCALS
Equus asinus V726 trav JREZ01000039.1 5940208 VNSQQEEQNLQALSVQEGENATMNCSYQTSIENLQWYRQDAGRGLARLILIRSNEKHKTNGRLRVTLDSSSKSSSLSITASGAADTATYFCAVE
Equus asinus V727 trav JREZ01000039.1 5934960 GTDGDSVTQTEGPIVLLEGTRLTLNCTYQSIYSVFLFWYVQYQNKEPELLLKSSSENQEEDSRGFQAKFVKSDSSFHLQKPSVQVSDSAVYYCALR
Equus asinus V728 trav JREZ01000039.1 5918368 GTNGDSVTQTEGPVILSEGAPVILNCTYQTSYSISFLFWYVQYLNNAPQLILKSSTENQRTENQDFHATLIKSDSSFHLQKPSVQMSDSAVYYCTLR
Equus asinus V729 trav JREZ01000039.1 5905052 GLSAEDQVEQRPQTLRLQEGDSLSLGCSYTVSSFRGLQWYRQDPGKGPELLFLLYSVGEPKQKERLKATLSKMGSSLHITDSKPEDSATYLCAVE
Equus asinus V730 trav JREZ01000039.1 5864801 VSSMLNVEQSPRLLHVQEGESTNFTCKFPSSSFYALHWYRWEPAKSPKILFVITVNGDEREEGRASATLNTNEGYSYFYIEGAQPEDSATYLCAS
Equus asinus V731 trav JREZ01000039.1 5855623 VNGEQMKQIPPSLLLQERENFTTYCNSSSTLSSLQWYKQRPGGSPVFLMILARRGEVQKQERLTARFGETRKDSSPHITAAQTADVGTYFCAG
Equus asinus V732 trav JREZ01000039.1 5849240 TVIDAQITQPNSVDCAEGEDVNLPCNHSTIVREEYVYWYRQNPNQSPQFIIHGLRNNVTNNMASLTIATDRKSSILILPQVTLRDTAVYYCAVRE
Equus asinus V733 trav JREZ01000039.1 5839161 GTRAQSVTQPDDHIIVSEGAPLELKCSYSYTGTPTLFWYVQYPSQGLQLLLGYFSGPTLVKGIKGFEAELKKNETSFHLRKQSAHLGDSAVYFCALR
Equus asinus V734 trdv JREZ01000039.1 5810476 SSMAQKVTQTQTIMTRKEGESVTMDCKYELGWSNYYALYWYKQLPSGEMVFLIYQDSSKPSTKQGHFSLNFQSSKNFISLTISPLKLADSATYFCALWD
Equus asinus V735 trav JREZ01000039.1 5801088 IIGDAKTTQPNAMDCTEEETVHLPCNHSTISGSEYIYWYRQIPHQGPEYVIYGLKSNVTNGMASLTITTDRKSSILILPQVTLRDTAVYYCIVRE
Equus asinus V736 trav JREZ01000039.1 5782955 VSSQEVQQSPQSLNIREGEDFIINCNASKTLYAFHWYRQKHGEGLISLMVLQKSGEEIHYEKMTAKLDEKKQQSSLHITASQPSHSGIYLCGAE
Equus asinus V737 trav JREZ01000039.1 5777030 VSGQQLNQSPQSVSVQEGEDVSMNCNSSSTLSTFLWYKQDVGEGLVLLIALYKIGEWTRNGKLAAQIARTRKDSFLNISVSEPKDAGTYFCAG
Equus asinus V738 trav JREZ01000039.1 5760759 PGRADWIRPRETELSGTEGKTVNLLCNYGTSSRGLVDLYWYRQYPNQALEYILYRGWGYSGKGDASFATERFYSKTTANSTDLYIGNLEPADTAVYYCALR
Equus asinus V739 trav JREZ01000039.1 5743011 SSMAQTVTQPQPEMSVHVAETATLNCMYDTSESNYYLLWYKQPPNGEMILIIRQEAYKQQNATNNRFSVNFQKADKSFGLRISDSQLEDAAVYFCAFMR
Equus asinus V740 trdv JREZ01000039.1 5736169 SSMAQTVTQPQQEISVHEAETVTLNCMYDTSDSDYYLFWYKQPPNGEMILIIRQEAYKQQNATNNRFSVNFQKADKSFGLRISDSQLEDAAMYFCAFMR
Equus asinus V742 trdv JREZ01000039.1 5657996 SSNTQSVNQPINVVYTQEGESVTFDCKITVSFSVYVVYWYRQLSSGEMTHLIHLRSDNKNTAEGRYSMVFQKSDVKFTISNMMHRDSGVYFCAVAEC
Equus asinus V744 trdv JREZ01000039.1 5542117 VSVDIILEPVTKTLIVLAGETATFRCNITGGDLKNYRMSWYKKNEDNSLTLVYGPRNNSNDDLRKSFKGEINILKNQYILDIQKATTKDVGTYYCGSD
Equus asinus V756 trbv JREZ01000044.1 185931 PLDTAVSQTPKYLISQVGNKKTLKCEQNLNHDAMYWYKQDSKKLLKIMFIYVYMKLNLNETGSGRFSPHAPDNAHLNLHISSLEPGDSAVYFCASSQ
Equus asinus V757 trbv JREZ01000044.1 178226 HMETGISQTPSHYIREMGQNISLRCEPISSHFYFYWYRQTLEKGVEFLISVYNKVPSEKADFLKDRFSAEMPDGLHFTLKIQPVQLGDSAVYLCASSL
Equus asinus V758 trbv JREZ01000044.1 168452 PVDSGVIQTPRHLIKAKGQQMTPRCSPISTHPYVYWYQQVLGQGPRFLIQYFGEKENDRGDSSDRFSGEQFSNYSSELIVRVLELVDSALYLCASSL
Equus asinus V759 trbv JREZ01000044.1 163414 AVNAGVTQTPKFRVLETGQNTTLRCAQDMNHDSMYWYRQDLGHGLRLIRYSAGAGVTEKRDVPDGYSVSRSNTENFPLTLESATPSQTSVYFCASS
Equus asinus V760 trbv JREZ01000044.1 147932 HTDAGISQSPRHRVTERGQDVALKCDPISGHTYLYWYRQTLGQNLEFLTYFQDDLASDTSGMPDDRYSAKRPEGSSSTLKIQRAEQGDSALYLCASSS
Equus asinus V761 trbv JREZ01000044.1 138298 QVDAGAGITQSPHKITATGKRVTLTCHQTLKHDYMYWYRQDLGHGLKLIHYSYDILKTEEGEVPDGYNVSRSNIEDFPLTLESATPSQTSVYFCASSY
Equus asinus V762 trbv JREZ01000044.1 123578 PTDAGVIQTPRHQLTKMGQTVTLTCEPISTHDTVFWYRQTLVKGLEFLIYFRDQAPMDKTGMPNDRFSAEMPNGSFSTLKIQRTEPGDAAVYLCASSL
Equus asinus V764 trbv JREZ01000044.1 113903 GSGLDALISQHPGRGVCKNGTSMKIACCSMDFQARTMLWYHQLPKHSLTLMATSNHGSSATYQQGFTEAKFPINHPNQTFSNLMVMSVHPADSSLYFCGAS
Equus asinus V765 trbv JREZ01000044.1 107236 PLDTAVSQTPKYLISRVGNEKTLKCEQNLGHNAMYWYVQDSKKLLKIMFSYNNKQTIVNETGSGRFSPHAPDNAHLNLHISSLEPGDSAVYFCASSQ
Equus asinus V766 trbv JREZ01000044.1 88396 AVDSGVTQTPRHLIKTKGQQVTLRCSPISGHPRVSWYQQALGQGPQFFFQYYMGRENGKGDIPDRFKGQQFSDYRSELNVNILELTDSALYLCASSA
Equus asinus V767 trbv JREZ01000044.1 79483 PVNAGVTQNPKFQVLGTGQNTTLRCTQDMNHNSMYWYRQDLRHGLRLIHYSRAANVTEKGDIPDGYRVSRPNTENFLFTVESATPSQTSVYFCASSY
Equus asinus V768 trbv JREZ01000044.1 69998 SVDAAVTQKPRYYITQTGHKMILECSQNKNHLSMFWYRQDPGQGPRLIHYSRGVNSTAKGDITEGYSVSRNKKEDFHLTLESASTKQTSLYLCASNE
Equus asinus V769 trbv JREZ01000044.1 46383 QADAGGGITQSPHKITGTGKMVTLTCHQAQNHDYMYWYRQDRGHGLRLIHYSNGIGSTDKGEVPDGYSVSRSSTENFPLTLESATPSQTSVYFCASSY
Equus asinus V770 trbv JREZ01000044.1 22290 PVDSGVTQTPRHLVKTRGQQVTLRCSPMSGHDTISWYRQPLGQGLQFLIQYYRGEENGKGDFPGRFKGQQLDNYSSELNVSVLELVDSALYFCASSL
Equus asinus V771 trbv JREZ01000044.1 17060 PVNAGVTQNPKFQVLRRGENTTLRCTQDMNHNSMYWYRQDLGHGLRLIHYSVGADVTANGDVPDGYRVSRSDTKNFALMLESATPSQTSVYFCASS
Equus asinus V772 trbv JREZ01000044.1 4324 PMDAGITQKPRYHITQTGDKMILECSQNMSHFAMFWYRQDPGQGPRLIHYSGDVNSTAKGDITEGYSVSRNKKEVFLLTLESATTKQTSLYLCASSE
Equus asinus V826 trgv JREZ01000083.1 5657943 TQISPNLEGTQMSVTRQARSSVEITCDIKQSSDHIHWYRFQKRMAPRHLLYYQFSSSKFVESGTSSQKYRAYEGPGRTCKLYIRFLEESDSGVYYCAVWE
Equus asinus V827 trgv JREZ01000083.1 5655945 NQAVVSLEQPPSVTARLGSSAILPCVASTTVSYIHWYRHQEGKAPERLLQLAMFQLDVQWDSVVKADKVTAMEAKDGTSCTLSILKLEKSNEGVYYCAAWD
Equus asinus V828 trgv JREZ01000083.1 5636264 GLGLTKVEQSQISISAEVKKSIDIHCKITSSNFEGEYIHWYRRKTYEALEHLIYVSSTKSPAQANLGGKKNKIEARKDSQTSTAILTVNFIENEDVAIYYCTGWY
Equus asinus V829 trgv JREZ01000083.1 5616450 TSEDILITQLITSITKKKGNTAFLECKVKRDDLKKNAHIHWYRQKPGQPLRRILYISSNENVVHERGVSEDRYEARRRQGDPSASLRIHHVEEADAGLYFCACW
Equus asinus V830 trgv JREZ01000083.1 5574304 TQVSSNLEGTQMLVTKQAGSSVEITCDIKQSSSYVHWYQYQERMAPQRLLYYQLSGSEVVMDSGFSSWKYRAYEGSGRTYKLSIKLLEESDSGVYYCAVWE
Equus asinus V831 trgv JREZ01000083.1 5547509 TQVSSNLEGTQMLVTKQAGSSVVITCDITQSSDYVHWYRYQEGMAPRRLLYYQFSSSKVVVDPGISSQKYNAYQGTGRTCKLYIKFLEESDSGVYYCAVWE
Equus asinus V832 trgv JREZ01000083.1 5543550 HLGKPQLSSNKCLSKRSHIGCVVSHVTISSMPIYWYQESPGQALLPLQHVSPDNTVRMESGILMGKFEVDEIPEPSASTLTTHSGGKEDSATYYCAFWK
Equus asinus V833 trgv JREZ01000083.1 5475126 TQVSSNMEGIQIVFTRQAGSSVLITCDLKQSSDYIHWYRFQEGTAPRRLLYYHLSSSKVVVESGISSQKYQAYQGTGRTCNLYIQSLEESDSALYYCAVWE
Equus asinus V834 trgv JREZ01000083.1 5471454 TQVSSNMEGTQMSLTRQAGSSAQITCGIQQSSDYIHWYQYQEGTAPQRLLYYQLSSSKVVAASGITSRKYHVSRGTGMTCKLSIKNLEESDSAVYYCAAWE
Equus asinus V835 trgv JREZ01000083.1 5419325 GLGLTKVEQSQISISAEVKKSINIHCKITSSDFAGEYIHWYRQKPNEALEHLITVSSTKSPARANLGGKKNKLEARKDSQTSTAILTVNFIEKEDVAIYYCAGW
Equus asinus V836 trgv JREZ01000083.1 5367553 TQVYSNLEGPPISVTKRARSSVVITCDIKQSSDYVHWYRYQEGTAPQRLLYYQFSSAKFVVDSGISSEKYHAFEDTGRTCKLFIKILEERDSAVYYCAAWE
Equus asinus V837 trgv JREZ01000083.1 5262501 TQVSSNLEGTQMSVTRQPGSSVVITCGIKQSSDYVHWYRYQEGMAPQRLLYYQLSSSKVVVDSAFSSWKYHASKDTGRTYKLLIKFLDESDSAVYYCAVWE
Equus asinus V838 trgv JREZ01000083.1 5248189 TQVSSNLEGTQISVTREAGSSVAITCDIKQSSDYVHWYRYQEGTAPQHLLYYQFSSSKVVMGSGFSSRKYHAYEGTGKTCKLLIKILEESDSAVYYCAVWE
Equus asinus V839 trgv JREZ01000083.1 5196319 TQESSNLEGTQISVTRQAGSSVAITCDILKRSDNYVHWYRYQEGMAPQRLLYYDFSSSKAVWDSGISSGKYHAYEAIGRTCKFLTENLEESDSGVYYCAVWE
Equus asinus V840 trgv JREZ01000083.1 5149846 IQLSSNLEGTQMSVTRQAGSSVVITCDIKESSDYVHWYRYQNRMAPQRLLYYQFSSSNDVLDSGISSRKYHAYEGTGRTSKLLIKILEESDSGVYYCAAWE
Equus asinus V841 trgv JREZ01000083.1 5134177 GLGLSEVEQSQISISTEVKKSIKIHCKITSSDFEGEYIHWYRQKPKKALEHLISVSSTKSPARASLGGRKNKLEARKYSQTSTSVLTVNFIENEDVAIYYCAGW
Equus asinus V842 trgv JREZ01000083.1 5071693 TQVSSNLEGTQMSVTKQAGSSVVITCDFKQSITYVHWYRYVEGMAPQRLLYYHYHSAKFVMEPGISSQKYRTYEGARKNRKIEIRNLEERDSGVYYCAVWE
Equus asinus V843 trgv JREZ01000083.1 5036082 TWISSNVEGTQTSITKQAGSSVVFTCDSKQRITYVHWYRHKEGMAPQRIVYYHHQDSRLVSDPGIRLERYRVYESTERNRKIEIRKLEQSDSGVYYCAIWE
Equus asinus V844 trgv JREZ01000083.1 4982987 TQVSSNLEGKQMSLTRQAGLSAVITCDIEHTSNYIHWYQYQEGMAPRRLLYYQVFSSNVMVESGITSGKYHAYGGTGRTCKFSLENLEESDSGVYYCAVWE
Equus asinus V845 trgv JREZ01000083.1 4883831 TQVSSNLEGTQMPIIRQAGSSVQFTCDIKQSVTYVHWYRYQEGIALQRLVYYHYQYSRLMTDPGVSSGKYHTFGGTDKNRNIEVRSLEERDSGVYYCAVWE
Equus asinus V846 trgv JREZ01000083.1 4790251 GLGLTKVEQSQISISTEVKKSINIHCKITSSDFAGEYIHWYRQKPKKALEHLIYVSSTKSPARANLGGKKNKLEARKDSQTSTSVLAVNFIENEDVAIYYCAGW
Equus asinus V898 iglv JREZ01000131.1 28396 ADSQSVVTQEPSLSVSSGGTVTLTCGLNSGSVSSSNHPSWHQQTPGQAPRTLIYYTNTRASGVPNRFSGSISGNRATLTITGAQPEDEADYYCALYTGS
Equus asinus V960 trbv JREZ01000229.1 627488 VRTQTIHQWPPTRVQLVGSPLSLECTVKGTSNPNLYWYRQAAGGTLQLLFYSYGADEIHSEAPQNFKASRSKDGKFILSSKKLLLNDSAFYLCAWS
Equus asinus V1001 trav JREZ01000306.1 67047 GLRAQSVTQPDDLVTITEGNPLTVKCTYSISGSPYLFWYVQYPNQGLQFLLKYIAGDNLVKGSYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Equus asinus V1002 trav JREZ01000306.1 58106 TLSLAKTTEPIFIDSYEGQEVNITCNHTDIATNEYILWYRQFPDQGPQFVIQGFNTKMENEVASLFIPDDRKSSTLSLPRATLRDTAVYYCIVT
Equus asinus V1003 trav JREZ01000306.1 45656 GTGAQSVTQPDVHVTVSEGAPLELRCNYLSSVSLYLFWYVRYPNQGLQLLLKYTSGNSLVPGMKGFKAEFRKNETSFHLKKPSAHWSDSAEYFCAVS
Equus asinus V1004 trav JREZ01000306.1 35232 GSNEEMVTQTDGLVTFPKGPLLTLNCTYQTSDSVFLLWCVQYYNKAPKLLLNYSFLSSTENQWTERQGFQANHVKSDGSFYLQKPSVQMSDSTVYYCDLR
Equus asinus V1005 trav JREZ01000306.1 28986 DARAQSVTQPDGHVLVSEGSSLDLRCSYSYGATPYLFWYVQYPRQGLQLLLKHLSGQDTRVPGIKGFEAEFRKSNSSFNLRKSSAHWSDSAEYFCALS
Equus asinus V1006 trav JREZ01000306.1 11921 QIYGDSVTQMEGQMTLSEGASLKMNCTYSTTTYVALFWYVQYPREGPQLLLRAMTANEKGSNKGFEATYNTETTSFHLEKASVLESDSAMYYCAMS
Equus asinus V1007 trav JREZ01000306.1 793 GVQGMKVEQNPSALSLQEGTSSTLRCSFSASMKNVQWFRRNPVGRLINLFFIALGTKQNGRLNSTLNSKDLYSTLHITASRLEDSATYLCAVE
Equus asinus V1113 iglv JREZ01000628.1 1036567 ADSQAVVIQEPSFSVSLGGTVILTCGLSTGSVSTSNYPRWYQQTPGKAPRTLTYSTNNRPSGIPERFSGSISGNKAALTITGAQPEDEADYYCDLYVDRGV
Equus asinus V1114 iglv JREZ01000628.1 984231 SWAQSVLTQQASVSGNLGQRVTISCTGSSSDISDYDVHWYQQLPGMAPKLIIYDNSKQPSGVPEGFSGSKSGNSATLTITGLKSEDDADYYCECYDDSLS
Equus asinus V1115 iglv JREZ01000628.1 654716 SWAQSGLTQEASVSGSVGQKVTLSCAGNSNNVGIFDVGWYQISHGAPKTVTLRSSRPSGIPARFSGSKSGNTAYLTISGLQPEDEADYYCSAWDDSISN
Equus asinus V1118 iglv JREZ01000630.1 1035202 SWAQSVLTQPASVSGNLGQRVTISCTGSSSNTRDNYVNWYQQLPGTAPKLIIYENSKRPSGTPDRISGSKSGNPASLTITGLQAEDEADYYCQSYDDNLN
Equus asinus V1149 iglv JREZ01000912.1 71215 WVTQEASVSGSVGQKVTLSCAGNSNNVGIFDVGWYQISHGAPKTVMLRSSWPSGIPARFSSSKSGNTAYLTISGLQPEDEADYYCSAWDNSISN
Equus asinus V1150 iglv JREZ01000912.1 59408 VDSQTVVTQEPSLSVSSAGRVTLTCGLSSGSVSSGYDPSWYQQTPGQARFTLIYSKNSRLSGVPNRFSGSIFGNKATLTTTGAQPGDEPDYYCDLGMGS
Equus asinus V1151 iglv JREZ01000912.1 38041 SRAQSVTQPASVSGTLGQTVTISCTGSSSNIGSGHVSWYQQIPGTAPKRLIYSSASRASGVPDRFSGSRSGNTATLTISGLQAEDEADYYCGTLYSSWSS
Equus asinus V1175 ighv JREZ01001274.1 61342 VQCEVQLVESGRGLVKPGGSLRLSCAASGFTFSSYYMDWVRQAPGKGLEWVAYINSDVGSTHYADSVKGRFTISRDNAKNTLHLQMNSLRDEDTAVYYCAG
Equus asinus V1176 ighv JREZ01001274.1 15867 VSSELQLVQSGAEVRKTGESVKVSCKASGDSFTYYSMSWVRQAPGQGLEWMGYIYPEYDAMGYPQKFQGRVTMTADKSTSTVYMELSSVASEDTAVYYCAK
Equus asinus V1181 ighv JREZ01001370.1 9607 VLSQVQLKESGPGLVKPSQTLSLTCTVSGLSLSSNAVGWVRQAPGKGLEYVGAIASSGSAYYNPALKSRASITKDTSKSQVYLTLNSLTGEDTAVYYCAR
Equus asinus V1184 ighv JREZ01001427.1 3167 VLSQVQLKESGPGLVKPSQTLSLTCTVTGGSITSSYYGWSWIRQTPGKWLEYIGGIAYSGSTYYSPSFKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Equus asinus V1185 iglv JREZ01001441.1 20535 SWAQSVTQPASVSGTLGQTVTISCTGSSSNIGSGYVGWYQQIPGTAPKLLIYYATNRASGVPDRFSGSRSGNTATLTISGLQAEDEADYYCGASGSSWSS
Equus asinus V1186 iglv JREZ01001441.1 2856 SWAQSLTQPASVSGTLGQTVTISCSGSSSNIGYSYSYVGWYQQIPGTAPKTLIYANNKRPSGVPDRFSGSKSGNTATLTISGLQAEDEADYYCSSGDSSGSS
Equus asinus V1187 ighv JREZ01001470.1 14828 VLSQVQLKESGPGLVKPSQTLSLTCTVSGFSLSSYSVGWIRQAPGKGLEYVGAIASSGSAYYNPALKSRASITKDTSKSQVYLTLNSLTGEDTAVYYCAG
Equus asinus V1188 ighv JREZ01001505.1 7513 VLSQVQLKESGPGLVKPSQTLSLTCTVSGLSLSSNAVGWVRQAPGKGLEWVGVIYGSGSTYYNPALKSRASITKDTSKSQVYLTLNSLTGEDTAVYYCAK