WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Macropus eugenii ABQO000000000.1 (ABQO01) 200 17 38 53 54 19 9 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Macropus eugenii V6 trdv ABQO010007380.1 68 KIIRCNQVIQSSPYQEVVSGSKVTLSCRYETQYTNPYLHWFRTRSDSSIKSILNGHGSSDRSFTTGKFSVQRNSAQKIFNLVISEVGPEDSASYYCAL
Macropus eugenii V11 trgv ABQO010014234.1 4218 GQMAIVLEQKVISMTRNVGGSAALICEIFSPKFDNIHWYRYQEGRAPERLLRYSMTKSESVLDPGVSPEKIRAYKGKDNSCRLILSNLQLSDSGMYHCASWDG
Macropus eugenii V12 trgv ABQO010014235.1 2337 GQMAIVLEQKVISVTRNVGASATLTCEIFSPKFDNIHWYRYQEGRAPEHLLRYSMSKSESVLDPGVSPKNIRAYKGKDNSCRLTLSNLQLSDSGMYHCASWDG
Macropus eugenii V14 igkv ABQO010017577.1 108 TQAATVMTQTPTSLSVAPGDRVTISCKASTSISKWISWYQQKPGLSPKLLIYAASSLESGVPSRFSGSGSGTDFTFTISAVEAEDVADYYCSQYRSAPF
Macropus eugenii V15 igkv ABQO010017578.1 2844 TQAATVMTQTPASLSVAPGDRVTISCKASTSISKWISWYQQKPGQSPKLLIYYASKLESGVPSRFSGSGSGTDFTFTISAVEAEDVADYYCMQSNSAPF
Macropus eugenii V16 igkv ABQO010019252.1 7507 QAVTVMTQTPSSLSVAPGDRVTINCKASSSISKNIAWYQQKPGESPKLLIYYASYRQSGVPARFSGSGSGTDYTFTISAVEAEDVADYYCFHYSSTPF
Macropus eugenii V19 iglv ABQO010023288.1 1498 IIAQAVVTQEPSLTVIPGGTVTMTCSSSTGAVTSGHYPNWFQQKSGQSPRILIYSTNSLVSGVPARFSGSLLGNKAALTITGAQAEDEADYYCSLWYSGP
Macropus eugenii V25 igkv ABQO010029769.1 401 SQAAIVLTQTPASLSVATGDRVTINCKASSSISNYMAWYQQKPGESPKLLIYAASKLQSGVPARFSGSGSGTDFTFTISVVEAEDVADYYCFHYRSAPF
Macropus eugenii V38 trgv ABQO010046117.1 6086 VELTQPQVSITKELKTTARVTCQMSGATNVASEYIRWYQQKPNESLQHLLFVQSTNVPEKISLGDVRNKFVAEKNEDRRTSFVAINSITHEDEATYYCAWWD
Macropus eugenii V45 iglv ABQO010056646.1 7237 SGASLVLTQPPSLSKSLGETASISCAGDGTLGNYVNWYQQKPGQAPKLVIYNVNRRPSGIPDRFSGAKSGNTATLSISGLQAEDEADYYCGQWSSSV
Macropus eugenii V46 trbv ABQO010056929.1 5051 LGDAGVFQSPRSLVTERKKVVVLRCDPTKGHNYVYWYQQLPGQELTLSEYRDNNQVIHSSGMSKPQFSANWPSGSPYSLKIQPVELKDSALYFCASSL
Macropus eugenii V47 trgv ABQO010057652.1 1411 VQLTQPQVSISKEPGKTARVTCQVSNFTDCYSGYIYWYQQKQNQSLHHLLSVQSTSIPNKIPLGDVRNKFVAEKNENRRTSFLAINSITHEDEATYYCACWK
Macropus eugenii V50 trbv ABQO010061197.1 2285 LLDAGVIQISQHLITGIGQNANLICKQNLGHNALYWYRQDSKMGLQMMFYFNNKMLFEKATISDRFRPNSTENSLLRLHIEALKSEDTATYLCASSV
Macropus eugenii V61 ighv ABQO010072681.1 348 VHCDDQLVESGGDVRQPGGSLRLSCKASFTISYSYMSWIRQAPGKGLEWIAWIYANSGSTSYADSVKGRFTISVDSSNNMVYLQMNSLKAEDSGSYYCAR
Macropus eugenii V62 ighv ABQO010072685.1 476 VHCDDQLVESGGDVRQPGGSLRLSCKASFTISYYYMSWIRQAPGKGLEWIAGISTNSGSTSYADSVKGRFTISRDNSNNMVYLQMNSLKAEDSGSYYCAR
Macropus eugenii V75 trbv ABQO010085664.1 2458 LLDAGVTQTPTHLIREKGQNALFKCNPNKGHPYVYWYQQLLGKEFKFLIYFQNERKVDDSGMLNSRFSAACNNDLNCKIEIQPTELTDSAVYFCASSV
Macropus eugenii V82 trav ABQO010097533.1 3060 VSSQKVEQSTLPVTVQEDERCSLSCSYTSSISNLQWYRQDPGKGLVFLILIRSNEKEKVREKFTARLDTSTRNSSLHLSACKPEDSAIYFCAVD
Macropus eugenii V83 iglv ABQO010097717.1 1560 SFSQAVLTQSSSMSASLGATAKLTCTLSSQHKSKGINWIQQSPGKAPRYLMYITTIGSAGKGEGIPDHFSGSGSGTNRYLTISNLQPEDEADYYCGIYYGNN
Macropus eugenii V84 iglv ABQO010097721.1 2416 SFSQDVLTQSSSVSASLGATAKLTCTLSSQYRSNTVSWIQQSPGKAPRYLMYITTIGSASKGEGISDRFSGSGSGANRYLTISNLQPEDEADYYCGTYGNN
Macropus eugenii V92 trav ABQO010110270.1 1527 ASCQQKVEQNPPFLSVQEGEDITINCTYSVQDSQGLQWYRQDPGKGLTLLFYLASWTKEEGRFKSMLSRNDRHSSLHITASQPGDSATYLCAAD
Macropus eugenii V93 trav ABQO010110273.1 2626 VSCLQKVEQSPQTLKIQEGERATINCSYTEATNQGLQWFRQDPGKGLISLFYMTSEEKQNGRLRSMMSRKERHSSLHITDAQPEDSATYLCAVG
Macropus eugenii V94 trav ABQO010110273.1 6209 ASCQQKVEQNPPFLSVQEGEDITINCTYSVQVSQGLQWYRQDPGKGIILLFFLASGTKEEGRFKSMLSRNDRHSSLHITASQPGDSATYLCAAD
Macropus eugenii V100 trav ABQO010128498.1 1671 VSSQEEVSQSPQSLTLQEGHHVGMNCTYKNSAFVYFLWYKQHSGKGPEFLMDIRSNMNKKENGRVTILLNKGAQHLSLHITDAQSGDSGTYFCEAS
Macropus eugenii V110 trav ABQO010137561.1 874 GSCQQKVEQNPPFLSVQQGENITINCTYSVQVSEGLQWYTQDPGKGLTLLFHLVSGTKVEGRFKAMVSRNDRHSSLHISSSQPGDSATYLCAAD
Macropus eugenii V111 trav ABQO010137562.1 256 GSSQQKVEQNPPFLSVQEGEDITINCTYSDQASKGLWWYRQDPRKGITSVFYLTSGTKKEGRFKSTLSRNYRHSSLYINASQPGDSATYLCAAD
Macropus eugenii V112 trbv ABQO010137996.1 46 PTEAEISQIPRFLIRRVKQEVTLTCHQDLNHDAMYWYQQEPQKGPKLMFSFSYQEMSLNESVPQRFNATSPVKSLLKLLIQGVESEDSSTYFCSSSK
Macropus eugenii V115 iglv ABQO010139681.1 6538 SGASYVLTQPPSESKSLREMASITCVGDRIGRKSVDWYQQKPGQAPKLVIYSDNSRPSGIPERFSGSNSGNTATLRISGLQAEDEADYYCQVWDSSAD
Macropus eugenii V120 trav ABQO010146281.1 2657 VRGQVKVDQTPRVLNLQEGENFMVSCNYSSFTTALQWFKQKPEEGLISLFFLTGQTQEKGNLRATLNSKERQSSLFITPSQLGDSGTYLCAVQ
Macropus eugenii V122 iglv ABQO010148345.1 5169 SGASYVVTQPPSVSKSLRETASITCVGDRIGSKAVDWYQQKPGQAPKLVIYSDNSRPSGIPERFSGSNSGNKASLSISGLQAEDEADYHCLAWDSSAD
Macropus eugenii V133 igkv ABQO010165332.1 311 VRGAIELTQSPASLPVSAGETVTMSCKASQSISNYLHWYQQKPGQAPRLLIKDASTRPSGIPSTFSGSGSGTDFSLKISNVETEDVAVYYCQQNSGWP
Macropus eugenii V134 igkv ABQO010165334.1 2733 ARGAILLTQSPASLSVSAGETVTMSCKATQSIGNNLHWYQQKPGQPPRLLIRDASTRPSGIPSRFGGSGSGTDFSLKISSVEAEDVAVYYCHQSYSWP
Macropus eugenii V135 trav ABQO010168317.1 167 VSTQQLSQSPQSVSIQEGEDFITNCNSSTNLPSLYWYRQDPGKGLTFLMMISKGKELKSQGKITARFDEKRQHSFLLIKGTQPRDSARYFCAY
Macropus eugenii V136 iglv ABQO010168458.1 2657 AWAQFVLTQPASASGSLGQSVTVSCTRSSGNIGSYYVQWYQQHQGQAPKLIIYDWNKRPSGIPERFSGTKDTSTNSASLTISDLQTEDEADYYCQSYDSSGN
Macropus eugenii V137 trgv ABQO010171227.1 1528 GQMAIVLEQKVISMTRNVGASATLTCEIFSPKFDNIHWYRYQEGRAPERLLRYSMSKSESVLDPGVSPEKIRAYKGKDNSCRLILSNLQLSDSGMYHCAIWDG
Macropus eugenii V140 iglv ABQO010175645.1 13514 SGTSYVLTQPPSVSKSLGEMASISCVGDGIGGKYVKWFQQKPGQAPKLVIYTDSRRPSGIPDRFSGSNSGNMASLSISGLQAEDEADYYCLASSGIA
Macropus eugenii V143 ighv ABQO010178672.1 537 VHCDMRLVESGGEVRQPGGSLHLSFKACGFTFSSCHMHWVCQAPAKGLKRLSLIWSSSGTKYADSVKGRFTISRDNSSSMLHLQMNSIKAEDTVMYYCTR
Macropus eugenii V144 ighv ABQO010179344.1 1891 VQCDVQLVESGGDVRQPGGSLRLSCKVSGFTISSYWMSWVRQAPGKGLEWVAEIYRSGSTYYADSVKGRFTISRDNGNSMLYLQMDSLNTGDTPLYYCTR
Macropus eugenii V145 trav ABQO010179567.1 2865 GARSQNKVEQSPQLLNVKEGEDSYLKCSYKIIPFNNIRWYQQSPGKELVLLMLLTYFEAIKSNGRFKATLNATSEESFLHITSSQSEDSATYFCVAG
Macropus eugenii V146 iglv ABQO010188496.1 2588 SGASYVLTQPPSVSKSLGEMASISCTGDKIGSYAVQWYQQIPGQALKGVIYGTSSRPSGIPDRFSGSKSGNTATLSISGLQAEDEAEYYCKQWIGSD
Macropus eugenii V147 igkv ABQO010189561.1 756 ARGAIGLTQSPASLSVSAGETVTMSCKATQSISNYLHWYQQKPGQAPRLLIQYASTLHSGVPARFSGSGSGTDFSLKISSVEAEDVAVYYCQHSYNLP
Macropus eugenii V150 trbv ABQO010197042.1 523 LMDDGIIQTPKYLVTRKGAKVIFSCDPIKGHTQVYWYQQLLEREITFLISFLNNSPTDKSGMDPRFSANCSQSLPCELSIKTSEPGDSGIYFCASSE
Macropus eugenii V151 trbv ABQO010197043.1 342 LLDDGITQTPKYLVTRKGAKVIFSCDPIKGHTQVYWYQQLLEQGITFLVYFQGSNPVDKSGIEKRGLSAQCPQNSPCELSIETSEPGDSGIYFCASSD
Macropus eugenii V152 trbv ABQO010197043.1 1632 AQMDSRVIQHPSHLISSTGQSVTLGCDPISGHESTFWYRQILGQGLEMLFYFYDKRQNNKGEISDRFRAHQHDNFHFKLIINTSEEGDSALYLCASR
Macropus eugenii V158 trav ABQO010208245.1 8683 VRGQLKQSPASLSLQEGERTTLNCTYTSSINNLQWYRHSPGTGPKILFIMIFNGDEKQQGRFKATLSTKSCHSFLSISATQPRDSATYFCALE
Macropus eugenii V160 igkv ABQO010209060.1 253 AQADIVLTQTPASLSVAPGDRVTITCKATSSIYNHMAWYKQKPGQTPKLLIYAASTLQSGVPARFSGSGSGTDYTFIIRAVETDDAADYYCFQHYSAPF
Macropus eugenii V167 igkv ABQO010220339.1 42 SRGDIVLTQSPASVSVAPGQRVTISCKASQSVKHSDGNTYLDWLQHKPGQSPRLLIYKVSNLGTGVPARFSGSGAEKDFTFTISSLEPEDGAVYYCSQGTSFP
Macropus eugenii V168 igkv ABQO010220341.1 44 SRGEIVLTQSPASVSVAPGQRVTITCKASQSLKHSDGITYLYWLQQKPGQSPRPLIYLVSNLNAGVPARFSGSGAVKDFTLTISSLEPEDGAVYYCLQGISVP
Macropus eugenii V170 trbv ABQO010224646.1 5175 PTEAEISQTPRFLITTVKQEVTLTCHQDSNHNAMYWYQQEPQKGPKLMFSFSYQEMSLNESVPQRFNATSPEKNLLKLLIRGVESEDSSTYFCSSSA
Macropus eugenii V172 trav ABQO010225811.1 2736 GSCQQKVEQNPPFLSVQEGDDITINCTYSDQASTSLEWFRQDPGKGLTLLFYLASGTKEEGRFKSLWSRNDRHSSLHITSSQPGDSATYLCATE
Macropus eugenii V178 trav ABQO010244233.1 378 VSGKQTVEQSPPSLKVQEGDNVVFNCSYSDSASRGLQWFKQDLGKGLTSLFVMTSEGKERGRLRCTIKRVERLSILYITASQPGDSGTYLCGA
Macropus eugenii V185 igkv ABQO010262473.1 1161 SQEAIVLTQTPVSLSVAPGDRVTINCKASSSISNYMDWYQWKPGQSPKLLIYAASYLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCFQWDSYPF
Macropus eugenii V192 trav ABQO010278943.1 2135 TRCKSQVTQPISQEATEGQEVNLPCSHQDISTNMNIHWYRQFPNQGPQFLIQTYKTNVTSQMVSLTISPDRKSSTLNLPSVTLRDTAVYYCILQS
Macropus eugenii V200 igkv ABQO010292294.1 371 SQAAIVLTQTPSSLSVTPGDRVTINCKASSSVSSYMEWYQQKPGQSPKLLIYDASTLQSGVPARFSGSGSGTDFTLTISAMEAEDAATYFCFQWDSSPF
Macropus eugenii V201 igkv ABQO010293402.1 1629 SQAATVLTQTPASLSVAPGDRVTINCKASSSIGNAMFWFQHKPGQSPKLLIYAITYLLSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCFHSSSAPF
Macropus eugenii V214 igkv ABQO010328711.1 744 ASGQIVMTQSPTSLSVTPGDTVTISCKASQDISKYLAWHQQKPGQSPKALIYYTSTLNSGIPSRFKGSGSGTEYTLTISPVEADDAGVYYCMQCSNWP
Macropus eugenii V226 trav ABQO010355680.1 2941 GTGAQSVTQPEDQVTVSEGDLLELKCTYSYGATPSLFWYAQYPDQGLHLILKYISGSTLVKGIKGFEAEFNKSKTSFHLKKLSAQGSDSARYFCAVS
Macropus eugenii V237 iglv ABQO010384551.1 1016 SGASNVLTQPPSVSKNLGETASISCAGVGTSGNYVYWYQQKPGQAPKLVIYYDNRRPSGVPDRFSGAKSGNVATLSISGLQAEDEADYYCEQWSSSGV
Macropus eugenii V244 iglv ABQO010416220.1 568 IIAQVVVTQEPSLSVIPGGTVTMTCSTSTEAVTSGHYPNWFQQKSGQSPRRLIYTTNNLVSGVPARFSGSLLGNKAALTITGAQAEDEADYYCTLWYNGP
Macropus eugenii V257 igkv ABQO010458151.1 495 SCAAILLTQSPASLSITPGDRVTISCRASQGVSTYLSWYQHPPGQSPKLLIYGASNLHSGVPARFSGSGSGTDFTLTISSVDAEDVGHYYCQQRNQYPN
Macropus eugenii V267 igkv ABQO010484433.1 1115 AQALIVLTQAPASLSVTLGDRGIISCKASSSVYNYLAWYQQKPGESPKLLIYAASTRASGVPDRFIGSGSGTDFTLTISAVQAEDAADYYCFQHYSAPF
Macropus eugenii V280 trav ABQO010505773.1 1243 GTYGDSVNQTEGNIILPEGEPLALNCSYQTNGAPYLFWYIQYPNEALKLFLRETSGKDQEKENNGFWTTKIKEKYSFYLEKTSVQMKDSAVYYCVLS
Macropus eugenii V282 ighv ABQO010512757.1 1236 FWAQVQLVETGGQMIHEGQSLTLTCTASGLRFKDFAMSWHRSSGTGGSKEFVASITAGRGSTNEYREGMKGRAFIFRKNEANTVSLTLRQVQKEDSGIYYCAS
Macropus eugenii V285 ighv ABQO010527433.1 442 VHCDVQLVESGGDVRQPGGSLRLSCKGSGFTFSSNVYMHWIRQAPGKGLEWIAGISTNSGSTSYADSVKGRFTISVDSSNNMLYLQMNSLKAEDSGIYYCAR
Macropus eugenii V286 trav ABQO010530637.1 3678 GSCQHKVEQNPPFLSVQEGEDITINCTHSIQGSQGLQWYRQDPGKGITFLFYLASGTKQEGRFKAMLKRNDLHSSLDITASQPGDSATYLCAAD
Macropus eugenii V288 trav ABQO010538293.1 445 GNCQQKVEQHPSFLSVQEGENVTINCNYSNQNSQGLQWFRQDPGKGLTLLFFLASGTKQEGRLKSTLSRTDRHSSLHIAASQPGDSATYLCADR
Macropus eugenii V291 trav ABQO010550766.1 496 VSCQQKVTQSPPSLRVQEGESLTINCTYSESNPRSFQWYRQDPGKAPSFLFYMTSGRKQRGRFGSTTILKESHSSLYINASQLGDSAMYLCAVD
Macropus eugenii V292 trav ABQO010551199.1 177 VSCQQKVEQSPQMLMVQERESITINCSYSDSAINNLQWFRQDSGKGLILLFYIASEGKQKGRLRSTINRKERHSSLHISDAQPEDSTTYLCAVE
Macropus eugenii V294 ighv ABQO010554698.1 305 VHCDVQLVESGGDVRQPGGSLRLSCKRSGITFSNVYMSWIRQAPGKGLEWLSRIYGNGGSTYYADSVKGRFTISVDSSNSMLYLQMNSLKAEDSGTYYCAR
Macropus eugenii V304 trav ABQO010580601.1 2000 VRGQQRVEQNPQFSSVQEGEDVTINCTYSDQGSRSIQWFRQDPGKGLTSLFYITTEEKQNGRLRSMINRKERHSSLHITDAQPEDSATYLCAVE
Macropus eugenii V310 trav ABQO010616669.1 1552 ASCQQKVEQNPPFLSVQQGEDITINCTYSDQASRGLQWFRQDPGKGLTLLFFVASGTKEEGRFKSFLNMKDRHSSLHITASQPGDSATYLCAAD
Macropus eugenii V326 ighv ABQO010672177.1 633 VQCDVQLVESGGDVRQSGGSLRLSCKASGFTVSSYWMNWVRQAPGKGLEWVAAISSGSTYYADSVKGRFTISRDDGNSMLHLQMNSLNTGDTALYYCTT
Macropus eugenii V342 trdv ABQO010738940.1 519 WSTAQTITQSPPAVSVQEMEAVTLECVYTTSYTYYFLYWYRLSPNGKLIFILHQFSEDSNEERGRYSTNFNKNAESISLKISPSLLEDSGTYFCV
Macropus eugenii V347 igkv ABQO010747381.1 646 TQAVTVMTQTPASLTVAPGDRVTISCKASTSVYYAISWYQQKPGQSPKLLIYGASNLESGVPARFCGSGSGTDYTFTISGVEAEAVADYYCFQYGSTPF
Macropus eugenii V354 trav ABQO010772951.1 1014 GSCQQKVEQNPPFLSVQQGEDITINCTYSDQSSQGLQWYRQDPGKGLTFLLYLASGTKQEGRFKSMLSRNDRHSSLYISASQPGDSATYLCAAQ
Macropus eugenii V355 trav ABQO010773668.1 1956 TVQGDWIASRQSYMSSEEGKNVILQCSYNSDSQYIYLHWYRLYVGQTLEFILLRGARSRKNIKHDADIAKKRFSSETTSDSTFLSISDLSLKDSAIYYCALEN
Macropus eugenii V361 igkv ABQO010792007.1 722 ARGAIGLTQSPASLPVSAGETVTMSCKATQSISNYLHWYQQKPGQAPRLLIKDASTRPSGIPSRFSGSGSGTDFSLKISNVEAEDVAVYYCQQSNSRP
Macropus eugenii V366 igkv ABQO010821718.1 1436 SKGDLMLTQSPASVSVTPGEKVTITCTANQTVVYSDGYTYLSWFQQKPGQSPQLLIYQASYLESGVPARFSGSGADKDFTLTISSVEPEDGAVYYCFQDSFTP
Macropus eugenii V367 igkv ABQO010831575.1 597 ANGQIVMTQSPTSLSVALGDTVTISCRASQDINKYLAWHQEKHGQSPKSLIYGTSNLHSGTPSWFSGSGSGTDYTLTISSVDAEDAGIYYCMQHKTFP
Macropus eugenii V370 trdv ABQO010833815.1 1924 WSTAQTVTRSPPAVSVQEREAVTLDCVYTTSATYYYLYWYRQSPNGKLTYILQQYSESSNARTGRYSVNFNKNAKSISLKISPSWLEDSGMYFCA
Macropus eugenii V373 igkv ABQO010848205.1 778 SRGENVLTQSPASVSVTPGERVTISCKASQSVKHNNGNIYLYWFQQKPRQSPRGLIYHVSTLGSEVPAWFSGSGAEKDFTLTINSVEPEDVANYYCVQASSY
Macropus eugenii V385 trav ABQO010898064.1 817 TTKAQSVTQPEEQVSVSERSPVELKCTYSYSGAVYLYWYVWYPNQELQVLLRHTSEESNRGFQAKHNKDETSYHLRKLQVQEEDSAVYFCALS
Macropus eugenii V388 iglv ABQO010922791.1 550 SFSQAVLTQSPSMSASLGATAKLTCTLRSQYRSNAIYWIQQSPGKAPRYLMYITSSGSAGKGEGIPDRFSGSSSGANRYLTISNLQPEDEADYYCGTYYSNP
Macropus eugenii V397 iglv ABQO010938624.1 74 TFAQAVVTQEPSLTVIPGGTVTMTCSSSTGAVTSGHYPHWLQQKPGQVPRQLIYNTNNLASGVPARFSGSLLGDKAALTIKGAQAEDEADYYCMLWYNGP
Macropus eugenii V399 trav ABQO010947913.1 2008 GSCQQKVEQTPLFLSVHEGQDITINCTYSNQASDSLQWFRQDPGKGLTLLFYLTSGTKKEGRFKSLLNIKDRHSSLHITSSEPGDSATYLCAAE
Macropus eugenii V402 igkv ABQO010973333.1 313 SKGDIVLTQSPTSVSVTPGERVTISCKASQSVKHSDGNTYLNWIQHKPGQSPQLLLYRVSNLESGIPSRFSGSGAEKDFTLTISSLETEDLAVYYCSQGTSSP
Macropus eugenii V417 ighv ABQO011035121.1 765 VQCDVQLVESGGDVRQPGGSLRLSCKTSGFTFSSTWMNWVRQAPGKGLEWVASINPDGSSIYYTDSVKGRFSISRDNGNSILYLQMNSLNTDDTALYYCAS
Macropus eugenii V436 igkv ABQO011117276.1 388 CQAAIVLTQTPSSLSVTPGDRVTINCKASSSISNNMEWYQQKPGQSPKRLIYYASSLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCMQHNSYPF
Macropus eugenii V437 trbv ABQO011118199.1 992 PMDAGITQNLRYLVIGIGRKVTLKCDQNMKHNYMCWYRKDPGLGLRLIYYSNNVNHRDKGEVSDGYSASRTEQPFFLLILESTNKNETSEYYCASSL
Macropus eugenii V446 igkv ABQO011191523.1 507 SRGEIVLTQSPASVSVTPGDRVTISCKASQSVKHSNGYTYLSWLQKKPGQSPQGLIYRVANLYSGVPARFSGSGAEKDFTLTISSVEPEDGTDYYCAQLSFTS
Macropus eugenii V453 igkv ABQO010003155.1 1213 SQAAIVVTQSPASLSVTPGDRVTINCKTSSSVSNDMDWYQQKPGESPKLLIYNANSLNSGVPARFSGSYSGTDFTFTISAVEAKDVAVYYCGQSYSYPF
Macropus eugenii V454 igkv ABQO010003160.1 3193 SQAAIVVTQSPASLSVAPGDRVTINCKTSSSVSNYMNWYQQKPGESPKLLIYDANSLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCMHDYSAPL
Macropus eugenii V455 igkv ABQO010003163.1 2347 SGADIVVTQSPASLSVAPGDRVTISCKTSSSINKWMAWYQQKPGQSPKELIYSASTLQSGVPSSFSGSGSGTDFTFTISAVEAEDVAQYYCMKHNSAPF
Macropus eugenii V456 igkv ABQO010003164.1 4384 SGADIVVTQSPASLSVAPGDRVTINCKTSSSVSNYMAWYQQKLGQSPKQLIYSASTLQSGVPSRFSGSGSGTDFTFTISAVEAEDVADYYCMKHNSAPF
Macropus eugenii V460 trbv ABQO010003828.1 2415 SGLGALISQQPNRAVWKKGSSAQIHCLQIDSELTFMYWYRQLPQESLELIATANQGGQNNYEKGFKASKFPISRPDKKSSALNVTDLDPKDNGIYFCSAS
Macropus eugenii V465 trav ABQO010006084.1 2068 AWGQIKVDQSPQVLRIQEGATATLECNWSSTVTYLQWFKQNPGEGPVSLFYIASGEKQAGRFSSKMNSKDRHSSLHITGSQRGDSASYLCAVL
Macropus eugenii V473 iglv ABQO010015596.1 1561 SFSQPVLTQSPSMSASLGATARLTCTLSSQYNNYAIYWYQQSPGKAPRYVMYVTTSGGGGKGDGIPDRSSGSSSGANRYLSIANIQPEDEADYYCMTSYSGGI
Macropus eugenii V474 iglv ABQO010015922.1 4642 SFSQDVLTQSSSMSASLGATAKLTCTLSSQYKSNIINWIQQSPGKAPRYLMYIRSSGSVSKGEGIPDRFSGSGSGADRYLTISNLQPEDEANYYCAAYYGSGYN
Macropus eugenii V478 igkv ABQO010020492.1 3413 SSGDIVLTQSPASVSVTPGDRVTISCKASQSVKKSNGNTYLRWLQQKPGQSPRGLIYEVSNLYSGVPARFSGSGAETDFTLTISGMEAEDGAVYYCVQVSFTP
Macropus eugenii V480 igkv ABQO010029770.1 5482 YQAAIVLTQTPASLSVAPGDRVSINCKASSSISNYMYWFQQKPGQSPKLLISAASSRPSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCLQWYNAPF
Macropus eugenii V485 igkv ABQO010035704.1 4951 SKGDIVLTQSPTSVSVTPGERVTISCKASQSVKHSNGYTYLYWIQHKPGQSPRRLIYGASSLESGVPARFSGSGAEKDFTLTISSLETEDLAVYYCSQ
Macropus eugenii V486 igkv ABQO010035704.1 1188 SRGEIVLTQSPASVSVAPGQRVTITCKASQSVKDSYGNTYLSWLQQKPGQSPRLLIYQVSNLYSGVPARFSGSGAEKDFTLTISSLETEDGAVYYCSQVTSSP
Macropus eugenii V487 igkv ABQO010035705.1 5216 SRGEIVLTQSPASVSVAPGQRVTITCKASQSVKDSYGNTYLSWLQQKPGQSPRLLIYKVSNLYSGVPARFSGSGAEKDFTLTISSLEPEDGAHYYCAQGSFDP
Macropus eugenii V495 trav ABQO010044627.1 2262 PTETQSVTQPEDQASVSEGSPVELKCTYSYSGSPYLFWYVWYPNQELQVLLRHTSRESNKGFQANFSKAETSYHLWKPHVQEEDSAVYFCALS
Macropus eugenii V496 trav ABQO010045644.1 1029 GSCQQKVEQSPPFLSVQQGKDITINCTYSVQGSQNLQWYRQDPGKGITLVFYLTSGTKEEGRFKSLWNRNDRHSSLHITASQPGDSATYLCATD
Macropus eugenii V499 iglv ABQO010050720.1 2120 TIAQAVVTQEPRLTVIPGGTVTMTCSSRTREVTTGHYSHWLQQKSGQVPRLLIHDTNNLASGVPARFSGSILGDKAALTIKGAQAEDEGDYYCALQYNGS
Macropus eugenii V512 iglv ABQO010070160.1 2002 TFAQAVVTQEPSLTVNPGGTVTMTCSSSTGAVTSGHYPDWLQQKSGQGPRLLMYNTNNLASGVPSRFSGSLLGDKYVLTIKGAQAEDEADYYCALWYSDA
Macropus eugenii V522 trgv ABQO010086364.1 3746 HLSSAHLEQEISVVGIQGGSVILTCRLFGLVSTMVHWYRLQDGRPPKRFLYFSWQSGTSKFDRGFDENKFQVHKDEFNQNSLILLIKKLEVRDTGMYYCAVWD
Macropus eugenii V525 igkv ABQO010092825.1 1126 SRTNTVLTQTPDLLPVSPGQTATITCKASKDIDDLQWYQKKPEQSPRLLIKDVSTLLEGVPAQFSGSGYGTDFTLTIKGVEAEDAGDYYCQQHDT
Macropus eugenii V527 trav ABQO010094207.1 3126 GSCQQKVEQNPSFLSVQEGDDITINCTYSNQAFGNLQWFRQDPGKSLTLLFYLASGTKKEGRFKSMFNRNDRHSSLHITSSQLGDSATYLCAIL
Macropus eugenii V528 trav ABQO010097234.1 412 GSCQQKVEQNPPFLSVQEREDITINCTYSDQTSSSVQWYRQDPGKGLTLLFYLVSGTKEEGRLKSLLNMKDRHSSLHIASSEPGDSATYLCAAD
Macropus eugenii V530 trav ABQO010097532.1 1767 VSSQKVEQSTLPVMVQEDERCSLSCSFTSTISYLQWYRQDPGKGLVFLILIRSNEKEKVSEKFTATLDTSTRNSSLHLSVCKPEDSAIYFCAVD
Macropus eugenii V531 iglv ABQO010097719.1 1417 SFSQDVLTQSSSMSASLGATAKLTCTLSSQYRSNTVSWIQQSPGKAPRYLMYITNIGSASKGEGIPDRFSGSGSGTNRYLTISNLQPEDEADYYCGIYYGNN
Macropus eugenii V532 iglv ABQO010097720.1 3816 SFSQDVLTQSSSMSASLGATAKLTCTLSNQYRSNYVSWIQQNPGKAPRHLMYISSSGSVSKSEGIPDRFSGSGSGADRYLTISNLQPEDEADYYCDTYYGSGNN
Macropus eugenii V534 iglv ABQO010099776.1 708 SGASYVLTQPPSFSKSLGETASISCNGDGISSYCIHWYQQKHNQASKLVIYYDNSRPSGIPDRFSGSKSGNTATLSISGLQAEDEADYYCHVGDDDTD
Macropus eugenii V551 iglv ABQO010132565.1 379 SGVSYVLTQPPSVSKSLGETASISCAGDGISSSSVQWYQQKSGQAPKLLIYWTNRRPSGIPERFSGSKSGNTATLSISGLQAEDEADYYCQVWDSNV
Macropus eugenii V557 trav ABQO010138331.1 3605 VSCLQKVEQSPQSLRIQEGENTSINCNFTEYSQGLQWFRQDAGKGLTLLFYLASGMKEEGRFQAVFNSKELHSSLHITASQPGDSATYHCGVR
Macropus eugenii V560 iglv ABQO010141482.1 1279 TIAQAVVTQEPSLTVNPGGTVTMTCSSSTGAVTSGHYPDWFQQKSGQVPRMLIYDTNNRVSGVPARFSGSLLGDKAALTINGAQAENEADYYCTLWYNDH
Macropus eugenii V563 igkv ABQO010144136.1 1549 ARGAILLTQSPASLSVSAGETLTMSCKATQSISNDLHWYQQKPGQAPRLLIKDASTHPSGIPSRFSGSGSGTDFSLKISSVEAEDVAVYYCHQSYNWP
Macropus eugenii V564 trav ABQO010144702.1 465 GANGDSIAQTEGPVIISEGKSVTLNCTFKTTSIPFPFWYVQYPNKALQLLLRQSKENEEKVRNDFWDKKDREEKSFPLKMDFIQMKDTAVYYCAMN
Macropus eugenii V567 trav ABQO010155298.1 673 VTCLAKVEQSPQALKILEGEIAIINCTCTETINQGMQWFRQDPGKGIISLFVITVEKKQKGRLRAMINRNERHGSLYITDAKPEDSATYLCAVR
Macropus eugenii V568 igkv ABQO010155882.1 607 SKGDIVLTQSPTSVSVTPGERVVITCKDSQSVKHSDGNTYLYWIQHKPGQSPRRLIYGASFLESGIPTRFSGSGAEKDFTLTISSLETEDLAVYYCSQGTSP
Macropus eugenii V572 igkv ABQO010165331.1 2520 ARGAIELTQSPASLSMTTGQKVTMSCKASQSISNSLHWYQQKPGQAPRLLIQYASTRPSGIPSKFSGSGSGTDFSLKISNVEAEDVAVYYCQHSYNLP
Macropus eugenii V574 igkv ABQO010167975.1 2557 ARGAVGLTQSPASLPVSAGETVTMSCRASQSISNYLHWYQQKPGQAPRLLIKDASTRPSGIPSRFSGSGSGTDFSLKISNVEAEDAVVYYCHQSNYLP
Macropus eugenii V577 iglv ABQO010170842.1 3973 TIAQAVVSQEASLTVIPGGTVTMTCSSSTGAVTSGHYPHWFQQKSGQVPRLLIYSTNNLASGVPARFSESLTGDKASLTIKGAQAEDEADYYCML
Macropus eugenii V580 iglv ABQO010175039.1 4210 SGASYVLTQPPSVSKNLRETASISCAGNGISSKDVQWYQQKPGQAPKLLIYYTNSRPSGIPDRFSGSKSGNTATLSISGLQAEDEADYYCQVWDSSAT
Macropus eugenii V581 iglv ABQO010175644.1 4885 SGTSYVLTQPPSVSKSLGEMASISCVGDGIGGKYVKWFQQKPGQAPKLVIYTDSHRPSGIPDRFSGSNSGNMASLSISGRQAEDEADYYCLASSGIA
Macropus eugenii V583 trav ABQO010179606.1 409 WSTAQTVTQSPPTVSVQEMEAVTLECVYTTSDTYYDLYWYRQSPNGKLIYILRQDSEYSNAETGRYSVNFIKEAKSISLKISHSLLEYSGTYFCGI
Macropus eugenii V587 trbv ABQO010197041.1 814 LLDDGITQTPKYLVTRKGAKVIFSCDPMKGHTWVYWYQQLLEQEITFLVYFQGSNPVDKSGMEKPGFSAQCPKNLPCELSIETSEPGDSGIYFCASSE
Macropus eugenii V588 trav ABQO010201782.1 984 VRGQDRLEQSPSTLSIQERENISLNCSYSVGTFNSLLWYRQYPGEGLALLFQLFSNGVVKNEGREKATLDKSKAHSSLFIMASQPGDSATYFCAIK
Macropus eugenii V592 trgv ABQO010213916.1 2007 HLSSAHLEQETSVVGIQGGSVILTCRFFGSDSTMVHWYRLQDGRPLERFLYFSLQLGTSTFGRVFDENKFRVHKDEFNEGSSILLIKKLEVSDTGIYYCGVWD
Macropus eugenii V595 igkv ABQO010220340.1 2094 SRGEIVLTQSPASVSVAPGERVTITCKASQSLKDSDGNTYLYWLQHKPGQSPRRLIYKVSNLGTGVPARFSGSGAEKDFTLTISSLEPEDGAVYYCSQLTSFP
Macropus eugenii V596 igkv ABQO010220342.1 3159 SRGEIVLTQSPASVSVAPGQRVTITCKASQSLKDSDGITYLYWLQQKPGQSPRPLIYLVSNLNAGVPARFSGSGAAKDFTLTISSLEPEDGAVYYCLQGISVP
Macropus eugenii V598 trdv ABQO010222967.1 2102 WSTAQRVTQSPPAVSVQEMEFVTLDCVYTTSYTRYDLYWYRQSPNGKLTYILQQYSENSNAKTGRYSVNFNKNAKSISLKISPSQLEDSGTYFCGI
Macropus eugenii V606 trgv ABQO010243336.1 1770 ASMEPIVTQRIPSNTKRSGNTAFLECQVNVTLFGYAYIHWYRQKPGGRLERILYLSSNENVIHEDGVSEERYEAKKRESDFSASLRIHQVTEADGGLYYCACWD
Macropus eugenii V610 trbv ABQO010256164.1 1111 PMDAKDARITQSPRHIVTRMGQKVILKCEQNLDHNAMYWYRQDQGQGRQLIYYSAVQGGIQKGDIPEGYNVTRKEKELFPLILNSCRTSQTSLYLCASSR
Macropus eugenii V611 trbv ABQO010256165.1 2907 PMDAKDARITQSPRHIVTRMGQKVILKCEQNLDHNAMYWYRQDQGQGLQLIYYSAIKGDIQDGDILEGYNVTRKEKEFFPLILNSSRTSQTSLYLCASSR
Macropus eugenii V616 igkv ABQO010262474.1 2881 YQANIVSTQTPVSLSVAPRDRATINCKASSSILNYMDWYQQKPRHSTKLLIYDASSLQSGVPARFSGSGSGTDFTFTISASEAEDVADYYCFQWDSYPF
Macropus eugenii V617 iglv ABQO010264553.1 2222 SGASYVLTQPPSVSKNLGATASISCAGDGISSGYVSWYQQKHGQAPMLLIYLDDLKASGIPDRFSGSKSGNTATLSISGLQAEDEADYYCQVGDYSTG
Macropus eugenii V625 igkv ABQO010292293.1 441 SQAAIVLTQTPSSLSVTPGDRVTISCKASSSVSNYINWYQQKPGQPIKLLIYRASSLQSGVPTRFSGSGSGTDFTLTISAMEAEDAATYFCYQWSSSPF
Macropus eugenii V628 trbv ABQO010301574.1 1881 PTEAEITQTPRFLVKRVKQETTLSCHQDFNHDAMYWYQQEPQKEPKLMFYYYYQKMNLNESVPQRFNATSPGKNQLKLLIQGVETEDSATYFCSSSK
Macropus eugenii V630 iglv ABQO010304834.1 2315 SFSQAMLTQSPSMSASLGATTRLTCTLSSQHSTNPIVWVQQSPGKSPRSIVAIASTGDATRNDGIPERFSGSGSGADRYLSISNIQSEDEADYYCLTAY
Macropus eugenii V633 ighv ABQO010310134.1 4125 VECEVQLLETGGDVRQPGGSLRLSCKTSGFTFSNYYMSWIRQAPRKGLEWIAIIRNPANGLTTEHAESVKGRFTISRDDSSNTVFLQMNNMKNEDTAMYYCSR
Macropus eugenii V644 igkv ABQO010338340.1 2574 ASGQIAVTQSPTSLSVTPGDTVTISCKASQDISKYLEWHQQKPGQSPKFLIYYTSNLHSGIPSRFRGSGSGTDYTLTISPVEADDAGVYYCLQYKNWL
Macropus eugenii V650 trav ABQO010350751.1 1658 ATRAQTVTQPEDRVTISERGSLELRCTASYTGSPEFFWYVQYPRQSLQLLLKYISGNTLVRGSRDFEAEFNKSNKSFNLRKSSVEVSDAAVYFCAVS
Macropus eugenii V652 igkv ABQO010356229.1 3342 CQAAIVLTQTPSSLSVTPGDRVTINCKASSSVSSYMNWYQQKPGQSPKRLIYGASSLESGVPARFSGSGSGTAFTLTISAVEAEGVADYYCMQSNSYPF
Macropus eugenii V654 iglv ABQO010359674.1 5293 TIAQVVVTQESSLSVIPGGTISMTCRSSTGAVKSGQSAHWFQQKSGQVPRLLIYNTKSLLPGVPARFSGALTGDQAALTISGVQLEDEADYFCALQYDGS
Macropus eugenii V671 trav ABQO010392347.1 1973 GSCQQKVEQNPAFLSVQEGDDITINCTYSDKNSQGLRWYRQDPGKGLTLLFYLASGTKQEGRFKAIWSRTDRHSSLHIPASQPGDSATYLCAVE
Macropus eugenii V677 iglv ABQO010405247.1 1682 TIAQAVVTQELSLTAIPGGTVTMTCSSSTGAVTSGHYPHWFQQKSGQVPRVLIYDTNNLVSGVPARFSGSLLGDKAALTIKGAQVEDEADYYCLLWYNNV
Macropus eugenii V678 ighv ABQO010407699.1 1937 VHCDVQLIESGGDVKQPGGSIQLSCKGSGFTFSSYAMCWVRQAPGKGLEWVSYISSNGASTNYADSVKGRFTISRDNSNSMLKLQMNSLKPEDTALYYCTT
Macropus eugenii V684 iglv ABQO010426773.1 1595 SFSQPVLTQSPSMSASLGATAKLTCTLSSQHSSYTIVWFQQSPGKAPQYLMYVTSSGSVGKGEGIPDRFSGSSSGADRYLSISNLQLEDEADYYCGTYYGPSDA
Macropus eugenii V699 igkv ABQO010457544.1 2552 SQAGVVLTQSPDSLSVAPGDRVTISCKASSSINKWMAWYQQKPGLSPKLLIYEASKMQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCYQYSSAPF
Macropus eugenii V704 iglv ABQO010464055.1 1439 AWAQYVLTQPVSVSGSLGQSVTVSCTRSSGNIGSNNVEWYQQHQGQAPNLIIHGYSNRPSGIPERFSGTKDTSTNSASLTISGLQPEDEADYYCQSAYYNSGY
Macropus eugenii V707 trav ABQO010466458.1 5721 GTGAQSVTQPEDQVTVSEGDPLELKCTYSYELTVYLYWYVQYPDQGLQLILKYISGNTVVKGIKGFEAEFNKSKTSFHLKKFSAQGSDSARYFCAVS
Macropus eugenii V708 trav ABQO010466458.1 1411 GTGAQSVTQPEDQVTVSERDPLELKCTYSYGGTVYLFWYVQYPDQGLHLILKYISGSTLVKGIKGFEAEFNKSKTSFHLKKFSAQGSDSARYFCAVS
Macropus eugenii V709 ighv ABQO010468203.1 438 VHCDVQLVESGGDVRQPGGSLRLSCKASGFTFSNYYMYWIRQAPEKGLEWLSYISSSGGSTNYADSVKGRFTISRDNSNNMLYLQMNSLKVEDTAMYYCAR
Macropus eugenii V710 ighv ABQO010468204.1 2916 VHCDIQLVESGGDVRQPGGSLRLSCKASGFTFRDYSMDWVRQAPGKGLEWLSYIRYDGGSTNYADSVKGRFTISRDNSNNVLYLQMNSLKAEDSGTYYCAR
Macropus eugenii V721 trav ABQO010488716.1 1673 VSCVQKVEQSPHSLKIQEGESTTINCSYTETTDQGLQWFRQDPGKGITSLFYITIQEKQSGRLRSMISRKERHSSLHIAGAQPEDSATYLCAVG
Macropus eugenii V722 igkv ABQO010498269.1 1527 QAAIVMTQTPSSLSVAPGDRVTIKCKASSSISNYMVWFQQKPGQSPKCLIYAASTLQSGVPARFSGSGSGTDFTFTISAVEAEDVADYYCLQWYNAPF
Macropus eugenii V726 iglv ABQO010506201.1 772 SFSQPVVTQSPSMSASLGGTVKLTCTLSSQHSTYTIAWFQQSPGKSPRYIMYVGSSGGGNKGDGIPDRFSGSSSGADRYLSISNIQPEDEADYYCGYGYSNA
Macropus eugenii V732 igkv ABQO010521345.1 4567 CQAAIVLTQTPDSLSVATGDRVTINCKASSSISNYMYWFQQKPGQSPTFLIYAASSRPSGVPARFSGSYSGTDFTFTISAVEAEDVADYYCMQDYSAPF
Macropus eugenii V733 igkv ABQO010530154.1 684 ASGQIVMTQSPTSLSVTPGDTVTISCKASQDISKYLAWHQQKHGQSPKSLIYYTSTLHSGIPSRFKGSGSGTDYTLTISPVEVDDAGVYYCMQYKNWP
Macropus eugenii V743 trav ABQO010552686.1 1550 GSCQQKVEQNPPFLSVQEGEDIIINCTYSDKGSQNVQWYRQDPGKGPTLLFYLASGTKEEGRFKCLLNRNDRHSSLQITASQLGDSATYLCAAD
Macropus eugenii V744 ighv ABQO010554697.1 549 VHCDVQLVESGGDVRQPGGSLRLSCKGSGFTFSNAYMSWIRQAPGKGLEWIAAISANSGSTSYADSVKGRFTISRDNSNNMLYLQMNSLKAEDSGTYYCAR
Macropus eugenii V749 iglv ABQO010563461.1 1411 SGASNVLTQPPSVSKSLGQTASISCAGVGTSTYYVSWYQQKPGQAPKLVIYYDNSRPSGIPDRFSGAKSGNTATLSISGLQAEDEADYYCGQWSSSGA
Macropus eugenii V753 trdv ABQO010567590.1 567 WSTAQTVTQSPPAVSVQEMEAVTLDCVYTTSDTYYYLYWYRQSPNGKLILILRQYSEDSNEETGRYYVNFKKEAKSISLNISPSRLEESGTYFCGYRS
Macropus eugenii V762 iglv ABQO010585748.1 3704 TWAQFVLSQPASASGSLGQTVTVSCTRSSGNIGSNSVYWYQQHQGQALKLIIYDWNQRPSGIPERFSGSKDTSTNSASLTISGLQAEDEADYYCQSYVSGSN
Macropus eugenii V766 trdv ABQO010590667.1 2438 VSTAQKVTQEQSTMSGQEGKTVTLNCKYETSEPGYALFWYKQYLSGKMILLIRQDSYSQENTWMGRYSLNFQKTKKYINLTISASQVGDSAMYFCAFG
Macropus eugenii V779 trdv ABQO010616596.1 958 ASTGEDIIQAQASTSVQEGETVTLNCKYETTQTSVTFFWYKQSPSGEMVLLIRQDSYNQKNAKMDRYSVILDKTEKSINLSISDSQLGDSAMYFCVLSD
Macropus eugenii V780 trav ABQO010617056.1 941 GSCQQKVEQNPPFLSVQEGDDITINCSYSDKNSQYVQWFRQDPGKGPTLLFYLTSATKEEGRFKSLWSRNDRHSSLHIRASQPGDSATYLCAAD
Macropus eugenii V781 trbv ABQO010618828.1 755 VHLDNRVIQHPRYLLSRTGHLVTLECDPISGQKSAYWYRQIRDQGPEMLFYFFDNTKSEEGNVSARFEANQENNLHFTLNISSLEKGDSALYLCASSK
Macropus eugenii V782 trbv ABQO010618829.1 2619 VHLDSRVVQHPRYLLSRTAHLVTLECDPISGHRGAYWYRQIPDQGPEMLFYFYGNRESEKGNVSAKFKANQENNLHFTLNISSLEKGDSALYLCASSK
Macropus eugenii V791 trdv ABQO010642840.1 747 WSTAQTVTQSPPAVSVQEMEAVNLDCVYTTSYTYYALYWYRQSPNGQLIFVLRQYSEYGNTETGRFSVNFNKNAKSISLKISPSLLEDSGTYFCGI
Macropus eugenii V804 trav ABQO010698344.1 576 DSTAEEVIQPQPVASGWEKETVTLNCKYDVSDRDYALFWYKQSPSGQLNFLIHQESYNSQSARKDRYSVSFQKSDKFINLTVSALQLGDSAMYFCALQE
Macropus eugenii V807 iglv ABQO010707652.1 2408 SLASYVLTQPPSKSVSLGQTASLTCAGDQLDKKYAYWFQQKWGQPPVLIIYKDKERPEGVSDRFSGSSSNNVATLTISRVQAEDEADYYCESEDDNTK
Macropus eugenii V809 trdv ABQO010720475.1 520 WSTAQTDTQSPPVVSVQEMGHVTLDCVYTTSYTTYYLYWYRQSPNGKLIYILHQYSESRNAKTGRYSVNLNKNAKSISLKISPSRLEDSGTYFCGYRT
Macropus eugenii V815 trav ABQO010731869.1 4148 GSCQQKVEQNPPFLSVQEREDITINCTYSDQASGNLQWFRQDPGKGLTLLFYLASGTKKEGRFKSVFNRNDRHSSLLISSSQLGDSATYLCAAD
Macropus eugenii V816 trav ABQO010734372.1 844 VRSQEQVSQSPQSLTVQKGQHVSMNCTYKNSAFSYFPWYKQDSGKGPELLMDIRSNMNRKENGRVTILLNKGDQHLSLHITDAQPEDSGTYFCAAS
Macropus eugenii V818 ighv ABQO010740591.1 1504 VHCDVQLIESGGDVRQPGGSLRLSCKASGFTFSNYHMIWVRQAPGKGLEWISFISSNGGSTSYADSVKGRFTISRDNSNSMLHLQMNSLKTEDTAMYYCTT
Macropus eugenii V828 trbv ABQO010772948.1 1469 QMDAGVTQNLRYLIIGSGREVTLRCDQDLGHDYMYWYRQDPGLGLQLISYSLMDDSPKIEVPYGYSASREEKSFFLLIMKSTHMNQTSEYFCASS
Macropus eugenii V832 iglv ABQO010784278.1 695 SFSQDVLTQSSSMSASLGATAKLTCTLSSQYRSNTISWIQQSPGKAPGYLMYITSSGGVGKGQGIPDRFSGSSSGADRYLTISNLQPEDEADYYCNTYYGSGSN
Macropus eugenii V833 iglv ABQO010788789.1 1371 SGASYVVTQPPSVSKSLRETASISCSGDGISDKYVNWYQQKPGQAQKLVIYSDNNRPSGIPDRSSGSNSGNTATLSISGLQAEDEADYYCLAWDSSSIA
Macropus eugenii V834 trbv ABQO010791131.1 364 HMDTGVIQNPNFLVKGSGETVMLSCHPIKGHDYIYWYQQPMNKEFKFLIQRRTNQIIDDSGLLKERYSVEWSEGSPSILNIKTLKSEDSALYLCASSL
Macropus eugenii V839 ighv ABQO010811690.1 357 VHCDDQLVESGGDVRQPGGSLRLSCKASGITFSSYVYMSWIRQAPGKGLEWLSYISGNGGNANYADSVKGRFTISVDSSNNMVYLQMNSLKAEDSGTYYCAR
Macropus eugenii V843 trbv ABQO010837468.1 2329 ACLGVLITQKPSRGIWRSGVSVKIHCEQNGQLSEMLWYLQPPQQSLQLIGIANQGFPATYEKEFGETKFLMNRSGLKVSTLTVTGVNPGDSGLYFCSAS
Macropus eugenii V851 igkv ABQO010883710.1 1822 ASGQIVMTRSPTSLSVTPGDTVTISCRASQDIRKYLAWHQQKPGQSPKSLIYYTSNLFPGIPLRFRGSGSGTDYTLTIGPVEADDAEVYYCMQYKNWP
Macropus eugenii V858 trgv ABQO010923347.1 411 IELTQPEVSITKVLRRTARVTCQVSGSTDFASEYIHWYQQKPNQSLKHLLSVQSTRASTKMSLGDVSNKFVAGKNEDRRTSFLEINSITHEDEATYYCACWV
Macropus eugenii V859 igkv ABQO010926381.1 1076 SRGDIVLTQSPASVSVTPGERVTINCKASQSVKKSDGNTYLRWLQQKPGQSPRGLIYEVSNLYSGVPARFNGSGAEKDFTLTISGMEAEDGAVYFCVQIPFTP
Macropus eugenii V861 trav ABQO010930530.1 761 PGMAQKVTQTPPVISVQEGKAVTLDCKYSTGDTNYYLFWYKQSSSGEMIFLIRQDSFNLQNASDGRYSVNFQKASTSIGLVISDSQLGDSSVYFCALRE
Macropus eugenii V873 iglv ABQO010960821.1 742 TFSQDVLTQSSSISASLGTTVKLTCTLSSQHRSNYISWIQQSPGKAPRYIMEVSSSGSVSKGAGIPDRFSGSSSGADRYLSISNLQPEDEANYYCGTYGNN
Macropus eugenii V886 trav ABQO010998791.1 3218 VSSQDEVKQSLLSLRVLAGESTTLNCSYKVGNFRGLQWYRQYPGKGPEFFFTLFSPGDEKRQGRLKASLNKKESFSSLHINDIQPEDLATYFCAVE
Macropus eugenii V895 trav ABQO011035383.1 687 GTFGDSVTQTEGPIILPEGEPLTLNCSYQTSGLNFLFWYVQYPGEALKILVHEESGKHQEKENNGFWTKKIRETSSFHLEKTSFQVGDSSVYYCVLR
Macropus eugenii V896 igkv ABQO011036820.1 1122 TVMTQTPSSLSVAPGDRVTISCKAASSIGNAIFWFQHKPGQSPKILIYDASYLQSGVPARFSGSGSETDFTFIISAVEAEDLADYYCMEYDSYPF
Macropus eugenii V909 igkv ABQO011107263.1 394 ANGQIVMTQSPTSLSVTPGDTVTISCRASQDISKYLAWYQQKPGQSPKSLIYGTSNLYPGIPSRFKGSGSGTDYTLTISPVEADDVGVYYCIQQSNWP
Macropus eugenii V910 igkv ABQO011117413.1 433 ASGQNVMTQSPTSLSVTPGDTVTISCKASQDISKYLEWYQQKSGQSPKLLIYYTSTLHSGIPSRFRGSGSGTDYTLTISPVEADDAGVYYCTQQSKWP
Macropus eugenii V911 trav ABQO011132704.1 1610 VSCIQKVEQNPQFLSVQEGDNITINCTYTEYASNGLQWFLQDSRGSLVFLFMLTTGTKGKGRLSVSLNTKDQVSFFHITNSKAADSGTYLCAAS
Macropus eugenii V916 ighv ABQO011169234.1 1234 VQCDVQLVESGGDVRQPECSLCLSCKVSGFTFSNYYMHWVCHAPGKELECVPRISTSGSSTYYEDSVKDQFIISRDNGHSMLYLQMNSFNIDDTTLYYCT
Macropus eugenii V919 trav ABQO011192137.1 580 ATRAQTVTQPEDRVTISERESLELRCTASYSGSPRFFWYVQYPRQSLQLLLKYFSGNTLVRGSRDFEAEFNRSNKSFNLRKSSVEVSDAAVYFCAVS
Macropus eugenii V920 trav ABQO011192138.1 580 ATRAQSVTQPEDRVTISERESLELRCTASYTGSPRFFWYVQYPRQSLQLLLKYFSGNTLVRGSRDFEAEFNKSNKSFNLRKSSVEVSDAAVYFCAVS
Macropus eugenii V921 trdv ABQO011194382.1 837 WSTAQTVTQSPPAVSVQEMEAVTLDCVYTTSATYYDLYWYRQSPSAKLIYILSQDSESRNAKTGRYSVNFNKEAKSISLKISPSWLEDSGTYFCGYKL
Macropus eugenii V924 trav ABQO011208648.1 483 HLCRARFTQLSDKVAEEGADVELQCQHNIFGGDYDSVYWYLQKTNQKLIYVLHGFQDITEVGHYQINVDRKKRSSILVIRNVQISDMAVYYCAL