WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Chinchilla lanigera AGCD00000000.1 (AGCD01) 209 31 34 64 42 20 8 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Chinchilla lanigera V65 trdv AGCD01010533.1 147968 KDTLCDQLTQSPPEQTVASGSETMLLCTYSTGHSNPDLYWYRKVADQSLQFILYRDNSYSRDADFVQGRFSVKHSQTHKTFHLIISPVRTEDRATYYCALE
Chinchilla lanigera V154 igkv AGCD01024165.1 13428 STGDVVMTQTPLSLSISPGEPASISCRSSQSLLHSDGNTYLNWLVHKPGQAPRGMIYLVSNRISGFSDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGIHA
Chinchilla lanigera V155 igkv AGCD01024165.1 29415 VCGDIVMTQSPGSLSVSVGESATIRCKSSQSLLYSNDNKNYLVWYQQKAGQSPKLLIYWASTRASGVPDRFSGSGSGTDFTLTISRVQAEDVASYYCLQSYSTP
Chinchilla lanigera V250 ighv AGCD01042295.1 15975 VLSQVQLQELGPGLVKPSQTLSFTCAISGDSVSSTSATWDWVRQPLGRGLEWLGRTYYRSKWYNEYAPSLQGRVTITPDTSKNQFSLQLSSVSTDDTAVYYCT
Chinchilla lanigera V271 iglv AGCD01045797.1 10546 VVSQTVVTQEPSMSVSSGGTVTLTCGLSSGSVSTGYYPSWYQQNPGQPPYILIYNTNSRPSGVPDRFSGSISGNKAALTIMEAKTEDEADYYCLLYMGSS
Chinchilla lanigera V272 iglv AGCD01045798.1 20611 AESQAVVTQEPPLSTSPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQTPQGLIYSTSNRNPGVPARFSGSLLGDKAALTITGAKAEDEATYYCALWYSNH
Chinchilla lanigera V273 iglv AGCD01045802.1 57411 SFSQPVLTQPPSLSASSGANARLTCTLSSGSVVSGYHISWYQQVSGNHPRFLLRYYSDSDKDQGSGVPSRYSGSKDSSANAGVLLISGLQPEDEASYYCLTYHG
Chinchilla lanigera V274 iglv AGCD01045802.1 71045 AESQAVVTQESPLSTSPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQTPWGLIYHTSNRHSGVPARFSGSLLGDKAALTITGAQPEDEATYYCALWYSNH
Chinchilla lanigera V275 iglv AGCD01045803.1 8929 SWAQAVLTQPPSVSGSPGETVTISCTGSSSNIGGYYVQWYQQLSGVAPKLIIYGNSDRPSGVSDRYSGSKSGNTASLTISGLQSEDEADYYCGSYDSSLGA
Chinchilla lanigera V276 iglv AGCD01045803.1 18300 SLSQAVVTQEPSLSASPGASARLTCTLRSDISVGGKNLYWYQQKPGSPPRFLLYYYSDSDKELGSGIPDRFSGSKDTSANAGVLHISGLKPEDEATYYCMI
Chinchilla lanigera V277 iglv AGCD01045803.1 41609 AESQAVVTQEPPLSTSPGGTVTLTCGSSTGAVTTSNYASWVQQKPYKSPQGLRGGTSNRIPGVPARFSGSLLGDKAALTITGAQPEDEATYYCAMRYSNH
Chinchilla lanigera V278 iglv AGCD01045803.1 52861 AESQAVVTQEPSVSTSPGGAVTLTCGSSTGAVTTSNYASWVQQKPYQTPKGLIYDTSNRHSGVPARFSGSLLGDKAALTITGAQPEDEATYYCALWYSNQ
Chinchilla lanigera V279 iglv AGCD01045803.1 62622 SWAQAVLTQPPSASGSPEETVTISCTGSSTNIGDGYAVQWYQQLSGVAPKLIIYSSTNRPSGVSDRYSGSKSGNTASLTISGLQSEDEADYYCQTYDSSLGA
Chinchilla lanigera V280 iglv AGCD01045804.1 6192 SLSQAVVTQEPSLSASPGASARLTCTLRSDISVGGKSLYWYQQKPGSPPRFLLYYYSDSDKELGSGIPDRFSGSKDTSANAGVLHISGLQPEDEATYYCLI
Chinchilla lanigera V281 iglv AGCD01045804.1 13531 SLSQAVVTQEPSLSASPGASVRLTCTLRSDISVGSQWINWHQQKSGSPPRFLLSYYSDSNKEQGSGIPDRFSGSKHTSANAGVLHISALKPEDEATYYCVI
Chinchilla lanigera V282 iglv AGCD01045805.1 3243 SLSQAVVTQEPSLSASPGASVTLTCTLRSDISVGGKRINWYQQKSGSPPRFLLTYYSESNKEQGSGIPDRFSGSKDTSANAGVLHISGLQPEDEATYYCMI
Chinchilla lanigera V283 iglv AGCD01045808.1 2486 SWAQAVLTQPPSVSGSPGETVTISCTGSSSNIGSGYYAYWYQQLSGVAPKLIIYENSKRPSGVSSRYSGSKSGNTASLTISGLQSEDEADYYCQSYDSSLSA
Chinchilla lanigera V284 iglv AGCD01045809.1 3423 SLSQPVLTQLPSASASLGQTVKLTCTLSSGYSSYWVEWFQQSQGKSPRFVMQVGTSGIVGSKGDGIPDRFSGSGSGLDRYLTIQNVQEEDENVYHCGT
Chinchilla lanigera V285 iglv AGCD01045813.1 2565 AESQAVVTQEPALSTSPGGTVTLTCGSSTGAVTTSNYAAWVQRKPYQTPQGLIGSTTHRVPGVPARFSGSLLGDKAALTITGAQPEDESTYYCALW
Chinchilla lanigera V286 iglv AGCD01045815.1 6096 AESQAVVTQEPSLSTSPGETVTLTCGSSTGAVTTSNYADWVQQKPYQTTRGLIGDTSNRAPGVPARFSGSLLGDKAALTITGAQPEDEATYYCALWYSNH
Chinchilla lanigera V287 iglv AGCD01045816.1 9251 AESQAVVTQEPALSTSPGGTVTLTCGSSTGAVTTSNYAHWVQQKPYQTPKGLIYDTSNRHSGVPARFSGSLLGDKAALTITGAQLEDEATYYCALWYSNH
Chinchilla lanigera V288 iglv AGCD01045824.1 1414 CWAQSALTQPASASGSLGQKVTITCTGTSNDIGNYNYVSWYQQLQGTAPKLLIYNVNSRPSGIPDRFSGSKSGNTASLSISGLQPEDEADYYCGSYAGSSA
Chinchilla lanigera V289 iglv AGCD01045826.1 2643 SWAQSALTQPPSASGSPGGSVTISCDGSSSDIGGYSGVSWYQKHPGTPHKLLVYNVNSRPSGIPDRFSGSKSGNTASLSISGLQPEDEADYYCGSYAGSST
Chinchilla lanigera V290 iglv AGCD01045830.1 2973 SMASSILTQLPSVSVSPGQTATITCSGDNLSEYYTHWYQQKPGQAPALVIYEDSERASGIPDRFSGSNSGNTATLTISGAQPENEADYYCQNAV
Chinchilla lanigera V291 iglv AGCD01045837.1 6037 SMASSILTQLPSVSVAPGQTATITCSGDILSNTIANWYQQKTGQAPALVIYQDSERPSGIPDRFSGSSSGNTVTLTISGAQPEDEADYYCQSYDSNAD
Chinchilla lanigera V292 iglv AGCD01045839.1 6138 STASAILTQPPSVSVTPGQTATITCSGDNLSENYANWYQQKPGQAPALVIYEDSKRPSGIPDRFSGSNSGSTTTLTISGAQPEDEADYYCQSYDSSAV
Chinchilla lanigera V293 iglv AGCD01045840.1 15663 SVASYVLTQPSSVSVTPGQTARMTCEGDNIGNKYVHWYQQKPDQAPILVIYRDNSRPSGIPDRFSGANSGNTATLTITGIQAEDEADYYCQVWGSSTD
Chinchilla lanigera V294 iglv AGCD01045840.1 31362 SVASYVLTQPSSVSVTPGQTARMTCEGNNIGSRNVQWYQQKPGQAPVLVIYADKNRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVWDSND
Chinchilla lanigera V295 iglv AGCD01045841.1 10282 SVASYVLTQPSSVSATPGQTARMTCEGNNIGSKNVQWYQQKSGQAPVLVIYYSNSRPSGIPDRFSGANSGNTATLTITGAQAEDEADYYCQVWDSND
Chinchilla lanigera V296 iglv AGCD01045846.1 3737 SIASYVLTQPPSVSVAPGQTATITCSGDALPEKYAHWFQQKPGQSPVRVIYKDSERPSGISERFSGSSSGTTATLTISRAQVEDEADYYCLSTDPSDKY
Chinchilla lanigera V297 iglv AGCD01045846.1 17578 SIASYVLTQPPSVSVAPGQRAIITCSGDALPEKFAYWFQQKPGQSPVQIIYDDSKRPSGISERFSGSSSGTTATLTISTAQTEDEADYYCLSADPSNKN
Chinchilla lanigera V298 iglv AGCD01045847.1 5834 SIASYVLTQPSSASVAPGQTATITCSGDALPKRYAYWFQQKPGQTPVLIIYDDSKRPSGISERFSGSSSGTTATLTISRAQVEDEADYYCFSADSSGNH
Chinchilla lanigera V299 iglv AGCD01045848.1 8244 SIASYVLTQPPSVSVALGQTATITCFGDALPKSYAYWFQQKAGQSPVRIIYKDSERPSGISERFSGSSSGTTATLTISTAQTEDEADYYCQSLDSSGTQ
Chinchilla lanigera V300 iglv AGCD01045848.1 31726 STASYVLTQPPSVSVAPGQTATITCSGDALPKQYAHWFQQKPGQSPVQVIYKDSEHPSGISERFSGSSSGTTATLTISTAQAEDEADYYCLSWDSSGTQ
Chinchilla lanigera V301 iglv AGCD01045850.1 9354 SVAFYVLTQPSSVSVTLGQTARMTCEGNNLGNQYVQWYQQKPGQVPMLVIYDNNNQPSGIPDRFSGAKSGNTATRTTTGAQAEDDADYYCQVWDSSSK
Chinchilla lanigera V302 iglv AGCD01045850.1 35649 SVASYVLTQPSSVSVTPGQTARMTCSGNNIGSKIVHWYQQKPSQAPMLVMYFNIRASGIPDRFSGADSGNTATLTITGVHAEDEANYYCQVLDDSSE
Chinchilla lanigera V303 iglv AGCD01045852.1 6447 SMALYKLTQPSSLSVTWGKTARITCQGYNIRGYTVNWYQLKPGQAPVLVIYYDDSKASGVSDRFSGSNKENTATLTISRAQFEDEADYYCQVWDNSEE
Chinchilla lanigera V324 trgv AGCD01048446.1 37518 VSQTSGLQGGMKSITRNPGSYVVITCDIHEEENYIHWYLFKEGQAPHHLLYYNFFTSKAVVDSGFNPGKYHAYEGTERSYEFVLRNVEESDSGVYYCAIWA
Chinchilla lanigera V325 trgv AGCD01048448.1 30806 GLGVTKMEQSQVSVSTEVKKSVDLHCQTWDDQFDTTTIHWYLQKPNQALEHLIQVTTTRTPTRAKNNRVLAKKDPATLSSTLTINYVEKEDEAMYYCAGWD
Chinchilla lanigera V326 trgv AGCD01048449.1 21240 GSQTSSDIERGMITVTKKPGSHLTITCDVRAVKSYIHWYRFQEGQAPQRLLYYDFFSSKAVLDLELRPEKYTAYQATEHSNKFVVRNVEESDSGVYYCAVWT
Chinchilla lanigera V327 trgv AGCD01048449.1 45709 GTQTSSNMEQGMVSITKKPGSHVVFTCDVPAVSSYIHWYRFQEGQTPQRLLYYDISNSKSVLDSGLKPGKCNAYQTAEKINKFVVRNLQESDSGVYYCAVW
Chinchilla lanigera V328 trgv AGCD01048450.1 4744 GSQTSSNMDEGMTVMTRPRGSYVEITCTIHTQSNYIHWYQFQEGRAPRRLLYYDFSKSKAMLDSGVRSGKYDAYVGTGRTSKFVVRNVEESDSGVYYCAVWT
Chinchilla lanigera V329 trgv AGCD01048450.1 56313 GLGQLEQPEIVISRAADTSASIPCKASISGFGSTVIFWYRQKPNEGLTYLLYVRVSTNKVNFGGKKNKFEASKNSGASTSTLKINFLEKGDEARYYCAYWTGS
Chinchilla lanigera V330 trgv AGCD01048450.1 90289 GLGQLQQPEIVISKTTDGSVYIPCKLSNSNFKNIDMHWYRQKSKQAFEHLMYVRTAYNQRPLGGVNKKLEASKNFDTSTSNLKINFLKKEDEATYYCTYWD
Chinchilla lanigera V357 igkv AGCD01052598.1 21625 ARGDIVMTQSPDFLAGVPADTVIMSCKSSENIGRALAWYQQKPGQAPKLLIYSASSRAPGVPDRFIGSGTGTDFTLTISRVQPEDMAGYYCQQYYRRP
Chinchilla lanigera V358 igkv AGCD01052599.1 9171 VCGDIVMTQSPGSLAVSAGESATIRCKSSQSLQSGSSNYLSWYRHKPGQSPKLLIYLASTRASGVPDRFSGSGSGTDFTLTISSVQAEDVASYYCLQSYSTP
Chinchilla lanigera V359 igkv AGCD01052599.1 21092 VCSDIVMTQSPGPLAVSAGESATIHCKSSQSLQSGSSNYLAWYQQKAGQPPKLLIYRASTRVSGIPDRFSGSGSGTDFTLTISSVQAEDVANYYCQQHYERP
Chinchilla lanigera V360 igkv AGCD01052601.1 4279 STGDTVLTQSPASLTVSPGEKATIFCSASESVNKFGIDLMHWYQHKPGQPPKLLIYTVYTRESGVPDRFSGSWAGEDFTLTIHPVEAEDAGNYYCQQGLDVP
Chinchilla lanigera V361 igkv AGCD01052607.1 13179 ARCDIQMTQSPSSLSASPGDKVTTTCQASQGISGYLNWYQQKPGKAPKLLIYEASYLQSGVPPRFSGSGSGTGYTLTISSLETEDVATYYCMQYDEYP
Chinchilla lanigera V362 igkv AGCD01052617.1 7314 AKCDIQLTQSPSILYASPGDRITFTCRASQDISSYLGWYQQKPGKAPRLLIYDSSNLYTGVPARFSGSGSGTDFTLTISNVEPEDFAAYYCQQRKSYP
Chinchilla lanigera V363 igkv AGCD01052617.1 17607 VRCDIQVTQSPSSLSASLGDTVTITCRTSQSISPRLDWYQQRKGESAKPLIYKTNSLQPGVPSRFSGSGPGADFTLTISNLKLEDIATYYCMQCNSFP
Chinchilla lanigera V427 trbv AGCD01061390.1 12410 ARAQTVHQWPATKVQPVGSPFSLECTVKGKSNINLYWYRQVAGGALQLLFYSITVGEVTSEAALNFSASRPQDGQFILSSKKLLLSDSGFYLCAWS
Chinchilla lanigera V497 trav AGCD01072623.1 15394 AARQSVEQPTELMAVEGASVQVNCTFQTSGFNGLSWYQQHDGGAPVFVSYNVLDGFQNRSRLSTFLRRSDGYSSLFLRELQMKDSASYFCAVR
Chinchilla lanigera V498 trav AGCD01072631.1 14152 TGSLAKTTQPFSVDSYEGQEVNLSCTHPNIATNEYIFWYRQAHHQGPRFIIQGYKTNVANEVASLFIPEDRKSSILSLPQAALRDTAVYYCIMGG
Chinchilla lanigera V499 trav AGCD01072634.1 2988 VVGGGQVEQRPSSLSVLEGDSSVIDCTYTNGAFSYFYWYKQEPGTGLQLLIHIFGNMDNKQDRRFTVSLNKKDKHLSLNISAARPGDAATYFCAV
Chinchilla lanigera V500 trav AGCD01072635.1 5325 RNNGNLVTQTKGQMTLSEGTSLTMNCSYDRTQYPSLHWYVQYPGEGPQLLLKATKDKEKGSNKGFEATYDKAASSFHLEKASVEASDSAVYYCALG
Chinchilla lanigera V501 trav AGCD01072635.1 14786 ALGEQVEQHPSTLRVQEGDSSVINCTYSDSASSYFPWYKQEAGKGPQLIIDIRSNVGRNQKQRLLVLMDKAARHVSLHITAARPADSAVYFCAAG
Chinchilla lanigera V502 trav AGCD01072635.1 25825 RTYADSVTQTEGQITVPEEAVLTINCTYTTSGYPTLFWYVQYPGEGLHLLLKATKDKEKGSNKGFEATYDKAASSFHLEKASVEASDSAVYYCALR
Chinchilla lanigera V503 trav AGCD01072636.1 4730 RNTGDSVAQTEGQVTLSEKDSLTVRCTYESSVYPTLFWYVQYPGKGPQLLFRVSKANDKGSNKGFEAMYDKESSSFHLEKASVEASDSAVYYCALG
Chinchilla lanigera V504 trav AGCD01072636.1 22686 RVSGDSVTQTEGQVTLFERGSLTVNCSYETQQYASLFWYVQYPGEGPQLLLKAITANEQARNRGFEATYDKAASSFHLEKASVEASDSAVYYCALG
Chinchilla lanigera V506 trav AGCD01072638.1 421 VSSQQNEVKQSPESLSVAEGASTLLNCTYSNSGSQNFMWYRLYPGRGPELLMSMYSSGDKEEGRFTARLNTGSRHFSLHIQNSQHSDSATYLCAV
Chinchilla lanigera V507 trav AGCD01072639.1 6163 VNSQQGREIPQALSIQEGENATMNCNYTASILNPKWYRQDSGGGPVLLILIRSNEREKHSGRLRATLDTATKTSSLSITAAWAAEAAAYFCATE
Chinchilla lanigera V508 trav AGCD01072639.1 11371 TSMAQKVVQAQTEISLLEKKAVTIDCVYETREPSYSLFWYKQPPSGEMIFLIRQDSYSEHNATEGRYSLSFQKAAKSIRLTITASQLADSAVYFCAGRE
Chinchilla lanigera V509 trav AGCD01072639.1 17799 WSHGDSVTQTEGPVILSERAPLTLNCTYETTYSASFLCWYVQYSHAAPRLLLRSATENQRAENQGFQATLVKSQRSFHLQKASLQLSDSALYYCALE
Chinchilla lanigera V510 trav AGCD01072639.1 41112 GGSSLRVLGQSPSFLSVQEGTLAVLNCTTQERTLLNFHWFRQHPGKGLVPLTSIQSGQKEQMGNTFKDQLGKNKFYSILSIPGSKPGDSAVYFCAL
Chinchilla lanigera V511 trav AGCD01072641.1 4067 ISGQQKEVEQSPESLSVPEGAIISLNCTYRDSTSDNFRWYRQYPGKGPKMLIAIYSNGDQEDGRFRAHLNRANRYVSLHIRDSQSLDSATYFCAVS
Chinchilla lanigera V512 trav AGCD01072644.1 1663 VSGQQKEVEQSPESLSVPEGAIASLNCTYGVSNSQYIWWYRQYPEKGPELLMSVYSRGDEEKGRFRAHLNRANRYVSLHIRDSQSLDSATYFCAVS
Chinchilla lanigera V513 trav AGCD01072645.1 923 VRGQQKEVEQSPEFLSVPEGAIASLNCTYRDSASDTFRWYRQYPGKGPELLMSLYSNGDQEEGRFRAHLNKANRYVSLNIRDSQSLDSATYFCAVS
Chinchilla lanigera V522 ighv AGCD01074564.1 16139 AAGGVRGRSGGLVKPGGSLRLSCAASGFAFSGYWMSWIRQAPGKGLEWISYISGDSSSINYADSVKGRFTTSRDNSKNTLYLQMDDLRTEDTAMYYCTR
Chinchilla lanigera V523 ighv AGCD01074573.1 7965 VLSAQQLEESGPSLVKPSEPLTLTCTVSGVSITTSYYYWSWIRQPPGKSLEWMGYIRYSGGTSYNPSLQSRISISRHTAENQFWLQLNSVTTADTATYYCAG
Chinchilla lanigera V524 ighv AGCD01074573.1 13919 VQAEVQLVESGRGLVQPEGSLRLTCAASGFTFSDYYMDWIRQAPGKGLEWVGFIRNKANSHTTEYATSVKGRFTISRDDSKSTVYLQMTKLKTEDTAMYYCAR
Chinchilla lanigera V525 ighv AGCD01074573.1 30053 VLSAVQLQESGPSLVKPSQPLTLTCTVSGYSITSGYAWSWIRQPPGKSLEWMGYISYGGSTSYNPSLQSRISISRNTAENQFSLQLNSVTTADTATYYCAR
Chinchilla lanigera V526 ighv AGCD01074573.1 44610 VLSAVQLEESGPSLVKPSQPLTLTCTVSDFSITTSYYYWSWIRQPPGKSLEWMGYISYSGGTSYNPSLKSSISISKNTDENQFSLQLNSVTTADTATYYCAR
Chinchilla lanigera V527 ighv AGCD01074573.1 50075 VRAEVQLVESGGGLVQPEGSLRLTCAASGFTFSDYYMSWIRQAPGKGLEWVGFIRNKANGNTAEYATSVKGRFTISRDDAKSTMYLQMTKLKTEDTALYYCAR
Chinchilla lanigera V528 ighv AGCD01074576.1 19379 VLSAVQLEESGPSLVKPSETLTLTCTVSGYSITSGYRWSWIRQPPGKSLEWMGYISSSGSTSYNPSLKSPISISRNTDENQFSLQLNSVTTADTATYYCAR
Chinchilla lanigera V529 ighv AGCD01074582.1 2779 LVQPETSLRLSCVSSGFTFSDYCMDWFRQAPGTGLEWVGFIRNKANSHTTENAASVKGRFTISRDDSKITVYLQMTKLKTEDTAVYYCTRDAV
Chinchilla lanigera V530 ighv AGCD01074589.1 1407 VLSVQLEESGPSLVKPTETLTLTCTVSDFSITTSGYWWSWIRQPPGKSLEWMGYISYSGSTSYNPSLQSRISISRITASNKFSLQLNSVTTADTATYYCAR
Chinchilla lanigera V531 ighv AGCD01074594.1 1055 VLSAVQLEESGPSLVNPSETLTLTCTVSGVSITTRYYYWSCIRQPPGKSLEWMGYINYGGSTSYNPSLQSRISISTASNKFSLQLNSVTTADTATYYCAG
Chinchilla lanigera V532 ighv AGCD01074606.1 10265 VLAHVQLQESGPGLVKPSQTLSLTCSISGFSIPSSGYYWSWICQSPGKSLEWMGDITYRGSTVYSPSLKSRISISRDTAKNQLSLQLNSVTMDDTATYYCAR
Chinchilla lanigera V534 ighv AGCD01074643.1 3613 VLSQVQLKESGPGLITPSQTLSLTCSVSGFSITDSGYCWHWIRQHSGKGLVWIGGICSGGSTNYSPTFKSRISITRDTSKNEFSLHLGSVTTEDTALYYCA
Chinchilla lanigera V535 ighv AGCD01074689.1 524 VLSDPTLRESGLSLVKPGETLSLTCTVTGGSVTSSYWWSWIRQSPGKAPQWMGYWSGSSYYNPAFQGRISITADTAKNQFSLQLNSMTSEDTTVYYCA
Chinchilla lanigera V543 ighv AGCD01077721.1 1981 VHSQVQLLQSGPELKKPGESVKVSCKGSGHMFTSYSIFWVKQVPGKGLQYMGWINTKTAKPIYAEGFTGRFVFSLDASVSTAYLQISSLQAGDTAMYYCA
Chinchilla lanigera V544 ighv AGCD01077722.1 7019 VVSQITLKESGPGLVTPTQTLRLTCSFSGFSLSTTYTGVGWIRQPPGKGLEWLAHIWWDDDKYYSPALKSLLSISKDTSKNQVILTTTSAVPADTATYYCARR
Chinchilla lanigera V545 ighv AGCD01077723.1 5204 VLSLVQLQESGPGLVKPSETLSLTCAISGFSLTSYHMHWVRQAPAKGLEWIGAIWDSGSTYYNSALQSRVRISRDTSKSQVSLTLSILRTEDTAVYYCAR
Chinchilla lanigera V546 ighv AGCD01077723.1 13831 AHGQVQLVQSGAELRRPGASVKVSCKASGSSINWISWVRQGPGQGLQWMGSIDVRDGETKYDQKFQGKATFTAVKSSSTAYMELSSLTSEDTAVYYCA
Chinchilla lanigera V547 ighv AGCD01077723.1 26620 AHAQEQLVQSGAELRRPGASVKVSCKASGYSFSSYWMNWVRQSPGQGLEWIGDIYPGDGDTDYAQKFQARVTLTSDKSSSTAYMALSSLTSENTAVYYCA
Chinchilla lanigera V548 ighv AGCD01077723.1 32656 VRCEVQLVESGGGLVQAGGSLRLSCAASGFTFSNYWMDWVRQAPGKGLDWVGRINHNSGTTNYAGSVKGRFTISRDNAKNTLYLQMTQLKTEDTAVYYCT
Chinchilla lanigera V550 igkv AGCD01078108.1 1557 STGDVVMTQTPLLSISPGETASISCRSSQSLLYSDGNTYLHWMVHKPGQAPRGMIYQVSKKNSGIPDRFSGSGSGTEFTLTISRVEAEDAGVYYCVQSTYAP
Chinchilla lanigera V551 ighv AGCD01078624.1 107 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKNPEWVGVIRNKANSHTTDYATSVKGRFTISRDDSKSTMYLQVIQLKTEDAAVYYCTR
Chinchilla lanigera V552 ighv AGCD01078624.1 5666 AHGQVQLVQSGAELRRPGASVKVSCKASGYTFTEYFMHWVRQGPGQGLEWIGRLNPYNGDTIYEQKFQGRVTLTRDTLSSTAYMELNSLRTEDTAVYYCA
Chinchilla lanigera V553 iglv AGCD01078746.1 538 SVASYVLTQPSSVSMTLEQTARMTCLGNNIGNKDVQWYQQKPGQAPILVIYYDNGRPSGIPDRFSGANSGNTATLTITGAQAEDDADYYCQVLDDSSK
Chinchilla lanigera V555 ighv AGCD01080243.1 2315 VQCEEQLVESGGGLVQPGGSLRPSCVASGFTLSSYHMDWICRAPGKGLEWISCNSSGGSTYYADAVKGRFTISRDNGKNMLYLQMSQLKTEDSTVYYCA
Chinchilla lanigera V558 ighv AGCD01081031.1 431 AAGGEWGGLVQPGGSLRLSCVASGFTFSDYYMYWIRQAPGKGLEWVGLIRNKANSHTTEYATSVKGRFTVSRDDSKSALYLQMTQLKTEDTALYYCV
Chinchilla lanigera V624 trdv AGCD01010536.1 17516 SSNAQHQPTDIVNAQEGKSVTIDCKITVSFDYYWMYWYQQPPSGKMIRLIQLYSANRSSREGRYSVVFQKPVLKLTISALKFSDSAVYFCAVAEA
Chinchilla lanigera V625 trdv AGCD01010543.1 2149 SSSAQHQPTDVVYTQEGESVTIDCKITVSFSYYMMYWYQQPPSGKMIHIIRLYSENRSSREGRYSVAFQKPVLKLTISALTLSDTAVYFCAVKEY
Chinchilla lanigera V626 trdv AGCD01010547.1 48508 VSVAQKITQSQPDISIQEATTATLDCIYDTTDSNYYLFWYKQPPSGQMIFIIRQEAYKQQNATEGRFSVNFQKAAKSFSLKISDSELGDAATYFCALM
Chinchilla lanigera V627 trav AGCD01010549.1 7156 VSMAQKVTQSQPEISIQEATTATLDCTYDTTDSNYYLFWYKQPPSGQMIFIIRQEAYKQQNATEGRFSVNFQKAAKSFSLKISDSELGDAATYFCALV
Chinchilla lanigera V628 trav AGCD01010551.1 52541 SSGQEKAVVQSVSILNIWERETAVINCSYTDVTFTYFPWYKKEEGKGLMLLVDIRSVVDKKQEGRFIVLLNKNAQQVSLHITETRPGDSALYFCAAS
Chinchilla lanigera V629 trdv AGCD01010551.1 49964 PSITQKITSHHSNNAGRANLDCIFETRWNIYILHWYKQPPSGQMLSLIHQEYSKTNVKQDCYSAYLEMAKKVVKLSISSLELANSAKYFCVL
Chinchilla lanigera V630 trav AGCD01010557.1 33547 MNGQQLKQIPQSWHTWKGQNFTTYCNSSGILNNLQWYKQKPGGRPVLLMMLVKGGEVKKQERLTAEFGERRQDSSLHITATQTTDAGTYFCAA
Chinchilla lanigera V631 trav AGCD01010557.1 24546 RSGAQSVAQPDPRVTVTEGDPLLLKCNYTYGATPSLFWYVQRPGQGLQLVLKYISGPSMVTDSRGFKAEFKKSESSFHLEKASAHWSDAALYFCAL
Chinchilla lanigera V632 trav AGCD01010557.1 1963 IKAQIKVEQSPQVHIIQEKRNSSLTCNYSTSVNSVQWFQQNLEGRLISLFYIASGVQQKGRLRATINFKERYSQLNVRDTQPGDSASYLCAVE
Chinchilla lanigera V633 trav AGCD01010558.1 1955 VNSQQEEIPQALNIQEGENASVSCSYKSMTTNVGWYRQDSGGSLALLILMRSNEREKHSGRLRATLDTTTKTSSLSITAARAVDAATYFCATE
Chinchilla lanigera V634 trav AGCD01010559.1 30656 SSIAQKVTQAQTVASVQETEAAVLNCTYETSYGDYGLLWYKQPNSGEMVFLIGQDSYNQQNAAEGRYSVHFQKASKSIQLVISASQMEDSALYFCALTE
Chinchilla lanigera V635 trav AGCD01010559.1 26612 RTHGDSVTQMGGQVTLSEQAVLTINCTYTASGYPTLFWYVQYSGEGPQLLLKATKDKEKGSNKGFEATYDKAASSFHLEKASVDASDSAVYYCALG
Chinchilla lanigera V636 trav AGCD01010559.1 18969 VSGQQKEVEQSPETLSVPAGAIASLNCTYRESASNNFMWYRQYPGRGPELLLSMYSSGDREEGRFTARLNTASRHFSLHIRNSQHGDSATYLCAVS
Chinchilla lanigera V637 trav AGCD01010560.1 185695 VSGQQLNQSPQSITIQEGKDVSMNCSSSSTFNSFFWYKQSPGEGPVLLLTLYKSGELMRNGKLTAQIGATRKDSVLSIPASTPDDVGTYFCAG
Chinchilla lanigera V638 trav AGCD01010560.1 170741 GSSGDSVTQTEGQVTLSEQAVLTINCTYTASGYPTLFWYVQYPGEGPQLLLKATKDKEKGSNKGFEATYDKAASSFHLEKASVEASDSAVYYCVLG
Chinchilla lanigera V639 trdv AGCD01010560.1 162705 CSVAQKVTQVQSPISRPEGEPVTLDCAYETSWTSYYIFWYQQLLSGEMVFLIRQSSAATDGKSGRYSVRKATNSMSLTIAAVQRGDSGKYFCALWE
Chinchilla lanigera V640 trav AGCD01010560.1 147043 VRGMQVEQSPSTLSVQEGDSPTMRCSFSTFMNTVHWFWQNSGGSLVSLFFITLRANWTERLASTFTFKEHYSTLQITASELGDSGSYLCAVEPQ
Chinchilla lanigera V641 trav AGCD01010560.1 139110 SSIAQKVTQAQSAVSVQETEAVILPCTHDSGATNYDLFWYKQSRREEMVFLIHQSSLELQNAAGGRYSVHFQRASKSIQLVISASRLEDSAVYFCALKS
Chinchilla lanigera V642 trav AGCD01010560.1 131572 VTGKPVVEQSSRSLTVLQGENCSLQCEYTVNPSNNVRWYRQDPGRGPVSIIIIPSSKSKASEGRYTVTLDATAKHSSLHITGSRLSDSASYICVVG
Chinchilla lanigera V643 trav AGCD01010560.1 123424 VSGQQKEVEQSPETLSVPEGASVSLNCTYRDSAFLNFIWYRQYPGRGPELLMSMYSSGEKEEGRFTVQLNTASQHFPLHIKGSQHSDSATYLCAA
Chinchilla lanigera V644 trdv AGCD01010560.1 118850 HTATQKVTQVQTALSRPEGKAATLDCSYETSVALYDLFWYQQLLSGEMVLLIHQSYSGNNANTGRYSGNFQKRAKTIVLTISALQMEDFATYFCALWE
Chinchilla lanigera V645 trav AGCD01010560.1 102148 VNSQQGEEIPWALSIQEGENATVSCSYQTAITNLCWYRQEAGGGPTPLILIRSNEREKHSGRLRATLDTATKTSSLSITAARDTDAAAYFCATE
Chinchilla lanigera V646 trav AGCD01010560.1 95909 TGMAEKVSQTQTAISALEKEDVTMHCVYETSDPRYSLFWYKQPPTGEMIFLIRQDSYSEHNATEGRYSLNFQKAAKSIKFTITASQLVDSAVYFCALME
Chinchilla lanigera V647 trav AGCD01010560.1 90780 RNRGDSVTQTEGPVTLTEGDLLMLNCTYQTTYLSPVLFWYIQYMDKAPQLLLRSAIENQQTESQGFQATLVKSQRSFHLHKGSLQLSDSAVYYCALL
Chinchilla lanigera V648 trav AGCD01010560.1 74509 MNGQQLKQSPESWHTWEGENFTTYCNSSGILSNLQWYKQKPGGRPVLLMMLGKGGEVKKQERLTAEFGERRQDSSLHITATQTTDAGTYFCAA
Chinchilla lanigera V649 trav AGCD01010560.1 60009 GSGAQSVAQPDRQVTITEGDPLLLKCNYTYGATPYLFWYVQRPGQGLQLVLKYISGPSLVTDNSGFKAEFKKSESSFHLQKDSAQWSDAALYFCALS
Chinchilla lanigera V650 trav AGCD01010560.1 50776 KEKNDQQQVKQNPQSLIVQEGEISILNCTYENSAFDYFPWYRQLPGKGLELLIAIRSVDYEKEDGRIKVFFRKQDKELSLHIRTSQPGDSATYFCAAS
Chinchilla lanigera V651 trdv AGCD01010560.1 41052 PSVAQKVTQVQPATSGREGEAVTLDCEYEQQWSTNYLLWYKQPPSGEMMFLVLTASGQTKKTGRYSVKFPKANSMNLVISGLQMEDSAKYFCAIEE
Chinchilla lanigera V652 trdv AGCD01010560.1 30525 SSVAQTVTQAQSAISKREGEAVTLDCSYDTSLTSYMLYWYKQLPSGAMIFLINQHSSGSSVQKGRYFLNFQKEAKVISLIIFAVQLGDASKYFCAFR
Chinchilla lanigera V654 trav AGCD01010560.1 15840 RIQTGYGQSVTQMGGQLTTTEGALLTINCTYTASGYPALFWYVQYPGGGPELLLKAMTANEKGRSKGFEATYDKAASSFHLEKASVEASDSAVYYCAVS
Chinchilla lanigera V655 trav AGCD01010560.1 4187 VSSQQKEVEQSPEILSVPEGAIASLNCTYRDSASRYFMWYRQYPGRGPELLLSMYSSGDREEGRFTARLNTASRHFSLHIQNSQHGDSATYFCAVS
Chinchilla lanigera V656 trav AGCD01010561.1 21793 GSSGDSVTQTEGQVTLFERTSLTVNCSYTTTQYPVLFWYVQYPGEGPQLLLKATKDKEKGSNKGFEATYDKAASSFHLEKASVDASDSAVYYCVVG
Chinchilla lanigera V657 trav AGCD01010561.1 3658 GSSAQSVAQPDRQVAILEGGRVLLRCNYTYSGAPYLFWYVQHPGQGLQLLLRYMSGAPVVTGIRGFKAEFKKSETSFHLEKASAHPSDTATYYCAVS
Chinchilla lanigera V658 trav AGCD01010569.1 861 VSGQQKDVEQSPESLSVPEGAIASLNCTYRDSGSQYISWYQQYPGKGPKMLIAVYSNGDQEEGRFRAHFNRANRYVSLHIRDSCSLDSATYFCAVS
Chinchilla lanigera V674 trdv AGCD01013012.1 95901 ALTQVVQVNDSMYGFIGTDVVLHCSFANPMPSVKITQVTWQKATNGTKQNVAIYNPAMGVSVLAPYRERVQFLRPSFTDGTIRLSRLELEDEGVYICEF
Chinchilla lanigera V888 igkv AGCD01052598.1 39390 STGDIVMTQTPLSLSVSPGETASITCKSSESLVHSDGKTYLNWLVHKPGQAPQRMIYEVSNRDSWVPDRFSGSGSGTDFTLTISRVEAEDTGVYYCCQGTNLL
Chinchilla lanigera V889 igkv AGCD01052598.1 30852 STGDVVMTQTPLLSISPGEMASISCRSSQSLLYSDGNTYLHWMVHKPGQAPRGMIYQVSNRNSGISDRFSGSGSGTEFTLTISRVEAEDAGVYYCWQG
Chinchilla lanigera V890 igkv AGCD01052598.1 12606 STGDIVMTQTPLSLSISPGKTASISCRSSQSLLHSNGNTYLHWVVQKPGQAPQGMIYQVSNLISGVSDRFSGSGSGTEFTLTISRVEAEDAGVYYCLQGLYAP
Chinchilla lanigera V891 igkv AGCD01052601.1 40403 ARCDIQVTQSPSSLSAAAGDKVTITCRASENIGYSLNWYQQKPGKAPKLLIYGADSLESGVPPRFSGSRSGTDFTLTISGLESDDVGTYYCQQYSNYP
Chinchilla lanigera V892 igkv AGCD01052601.1 28377 ARSDIHVTQSPASFSAAVGDTVTITCRANEYISTDLNWYQQKPGKAPKLLIYGTDVLDSEAPFRFSGRGSDIDFTLTISILQPEDIAAYFCQQYYDDPP
Chinchilla lanigera V893 igkv AGCD01052605.1 4429 SNGQIVLTQSPASLAASVGQTVTISCTASSSVGTSYLHWYQQKPRDSPKLLIYRTSNRASGVPARFSGSGSGTSYSLTISGVEAEDVAAYYCQQGSSN
Chinchilla lanigera V894 igkv AGCD01052607.1 2361 SNGQIVLTQSPASLPASLGQTVTISCTASSSVSTSYLHWYQQKPRDSPKLLIYGTSNRASGVPARFSGSGSGTSYSLTISGVEAEDVAAYYCQQGSSIP
Chinchilla lanigera V895 igkv AGCD01052608.1 24451 GRCDIQLTQSPSVSASLGEKVTITCRASQGISNNLHWHQQKPGQAPKLLIRYATTVHSGVPPRFSGSGSGTDFTLTISSLQPEDVATYYCLQTNSLP
Chinchilla lanigera V896 igkv AGCD01052609.1 122193 VRCDIQVTQSPPLLAASVGDTVTITCRASQGVSSYLNWFQQKPGKAPTLLIYNANNLHSGVPSRFSGSGSGTDFTLTIRNLQPEDIATYYCMQHNSSP
Chinchilla lanigera V897 igkv AGCD01052609.1 111364 VRCDIQVTQSPSSLAGSVGDTVTINCRASQNIYSSLNWYQRKPGKAPRLLIYGASSLQAGVPSRFSGSGYGTDFTLTISSLQPEDVATYYCQQGYSWP
Chinchilla lanigera V898 igkv AGCD01052609.1 100382 VRCDIQVTQPPPSLAASVGDTVTITCRASQGVSSYVNWYQQKPGKAPTLLIYNANNLHSGVLSRFSGSGSGTDFTLTIRNLQPEDIATYYCMQHNSSP
Chinchilla lanigera V899 igkv AGCD01052609.1 88041 VRCDIQMTQTPSSLAASLGDRVTINCRASQNIYNALNWYQQKPGKAPRLLIYAASNLQSGVPSRFSGSGSGTDYTLTISSLQPEDVATYYCQQGSSYP
Chinchilla lanigera V900 igkv AGCD01052609.1 74593 NSLAETILTQSPPLLSVAAGDKATMGCKASTDMNDTNWHPQKPGEAPKLLIRGATTLISGIPSWFSGSGYRPDFTVKCEDSAYYFCQQDANWP
Chinchilla lanigera V901 igkv AGCD01052609.1 66525 GRCDIQVTQSPSSLAASVGDTVTINCRASQNIYNALNWYQQKPGKAPRLLIYAASNLQSGVPSRFSGSGYGTDFTLTISSLQPEDVATYYCLQYQSSP
Chinchilla lanigera V902 igkv AGCD01052609.1 51479 VRCDIQMTQAPSSLSAALGDTVTIRCQASQGIGTELDWYQQKPGKAPTLLIYHVSNLHSGVPSRFRGSGSGSDFTLTINSLQPEDVATYYCQQDYSTP
Chinchilla lanigera V903 igkv AGCD01052609.1 37084 VRCDIQVTQPPPSLAASLGDTVTISCRASQGVSMNLDWFQQKPGKAPTLLIYNAKNLHSGVPSRFSGSGSGTDFTLTIRNLQPEDFATYFCMQHNSNP
Chinchilla lanigera V904 igkv AGCD01052609.1 30819 VRCDIQVTQSPSSLAASVGDTVTINCRASQNIYNALNWYQQKPGKAPRLLIYGASNLASGVPSRFSGSGYGTDFTLTISSLQPEDVATYYCQQTYDTP
Chinchilla lanigera V905 igkv AGCD01052609.1 12779 SRGDVVLTQTPLSQSIAPEQPASISCRSSQSLLHSNGHTYLHWYLQKPGQSPQLLIYRVSNRASGVSDRFSGSGSGTDFTLKISRVQAEDAGVYYCMQS
Chinchilla lanigera V906 igkv AGCD01052609.1 3983 GRCDIQLTQSPSVSASLGEKITITCQASQGISDDLHWHQQKPGQAPKFLIAYATTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYSSP
Chinchilla lanigera V907 igkv AGCD01052614.1 136352 ARCDILMTQSPSTLSASLQDSVTINCRASQGISNYLAWYQQKPGQAPKLLIYYASNLASGVPSRFSGSGSGTDYTLTISNLQPEDVATYYCQQYDEYP
Chinchilla lanigera V908 igkv AGCD01052614.1 121948 VRCDIQVTQPPPSLAASLGDTVTLTCRASQGISKNLDWYQEKPGRPPTLLMHHTKDLHSGVPSRFSGSGSGTDFTLTIRNLQPEDIATYYCMQHNSSP
Chinchilla lanigera V909 igkv AGCD01052614.1 109133 SGVRCDIQVTQSPSSLAASVGDTVTINCRASQNIYNALNWYQQKPGKAPRLLIYFASNLQSGVPSRFSGSGYGTDFTLTISSLQPEDVATYYCLQYQSSP
Chinchilla lanigera V910 igkv AGCD01052614.1 92867 SSGDVVMTQTPLSLSIAPGQPASISCRSSQSLLHSNGDTYLDWYLQKPGQSPQLLIYEVSNRASGVSDRFSGSGSGTDFTLKISRVQAEDAGVYYCMQA
Chinchilla lanigera V911 igkv AGCD01052614.1 84014 GRCDIQLTQSPSVPASLGERVTITCQASQGISSSLHWFQKKSGEAPKLLIAYATDMASGVPSRFSGSGSGTDFTLTISSLQPEDLATYYCLQTNSFP
Chinchilla lanigera V912 igkv AGCD01052614.1 66092 ARCDILMTQSPSTLSASLQGSVTINCQASQGISNYLAWYQQKPGQAPKLLIYYATNLASGVPSRFSGSGSGTDFTLTISNLQPEDVATYYCQQ
Chinchilla lanigera V913 igkv AGCD01052614.1 58830 DSLAETILTQSPALLSMAVGDKAIITCRASTNIDDDMQWYQQKPGEAPKLLIKAATTLISGIPSRFSGSGYGTDFTLTIDDLKPEDAAYYFCQQDDNLP
Chinchilla lanigera V914 igkv AGCD01052614.1 41720 GRCDIQLTQSPSVSASLGEKVTITCQASQGISNYLHWYQQKPGQAPKLLIRYATTVQSGVPPRFSGSGSGTDFTLTISSLQPEDVATYYCLQSYNTP
Chinchilla lanigera V915 igkv AGCD01052614.1 36703 IRCDIQITQSPSSLSASLGDTVTIKCQASQDISDDINWYQQKPGKAPTCLIYDASYLHSGVPSRFSGSVSGRDFTLTISSLKPEDTGTYYCQQDYSSP
Chinchilla lanigera V916 igkv AGCD01052614.1 21985 SGVRCDIQVTQTPSSLAASVGDTVTISCRASQSVSSYVNWYQQKLGKSPTLLIYNAKNLQSGVPSRFSGSGSGTDFTLTIRNLQPEDFATYYCMQHNSSP
Chinchilla lanigera V917 igkv AGCD01052616.1 47934 STGDVVMTQSPLPLPITPGESTSISCRSSQSLLHSNGYTYLFWFLQKPGQSPRRLIYLVSHRDSGVPERFSGSGSGTDFTLKISRVEAEDAGVYYCMQA
Chinchilla lanigera V918 igkv AGCD01052616.1 32783 CSGEAVLTQSPPALLISPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVSNRDSGIPDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQSTKI
Chinchilla lanigera V919 igkv AGCD01052616.1 26394 TRCDIQTTQSPSSLSASPGDTVTITCRASQNIYSGLNWYQQKPGKAPKLLIYAASNLVSGVPSRFSGSGSGTSYTLTISSLQPEDVATYYCEQGYSTP
Chinchilla lanigera V920 igkv AGCD01052616.1 15574 ARCDIQMTQSPSSLSKSQGDRVTITCKASQNIYSNLAWYQQKPGKAPRLLIYAASSLQTGVPSRFSGSGSGTDFTLTISSLEPDDVAIYYCQQYSSSP
Chinchilla lanigera V921 igkv AGCD01052616.1 9621 ARCDIQMTQSPSSLFKSQGDRVTITCKASQNIYSALAWYQQKPGKAPRLLIYDASDLQSGVPSRFSGSGSGTDYTLTISSLEPDDVATYYCQQYTNFP
Chinchilla lanigera V922 igkv AGCD01052618.1 52298 ARCDIQLTQPPSLSASAGDRVTIFCQTSQSVNKWLNWYQQKPGQAPKLLIYYATSLQSGVPSRFSGSESGTDFTLTISSLQPEDVATYYCQQEYSYP
Chinchilla lanigera V923 igkv AGCD01052618.1 47432 STGQILLTQSPASLALSPGETATLSCKASQSVSSYLAWYQQKPFQAPRLLCYGASSMAPGIPDRFSCSGSGTDFTLTISSLEPEDLATYYCQQGYRNP
Chinchilla lanigera V924 igkv AGCD01052618.1 16599 STGQILLTQTPASLALSPGETATLSCTASQGVSNYLAWYQQKPRQAPRLLIYGASSRATGIPARFSGSGSGTGFTLTISSLEPEDVGTYYCQQGYM
Chinchilla lanigera V925 igkv AGCD01052618.1 11436 STGQILLTQTSASLALSPGETATLSCKASQSVSNALAWYQQKPRQAPRLLIYGASSRAPGIPDRFSGSGSGTGFTLTISSLLPEDVGTYYCQQGYSSP
Chinchilla lanigera V926 igkv AGCD01052618.1 6369 SSGEALLTLSPASLAVSPGGTATLSCTANQGISSSLAWYQQKPGQAPRLLIYDASSRATGIPARFSGSGSGTGFTLTISSLEPEDVAAYYCYQYYSGF
Chinchilla lanigera V927 igkv AGCD01052620.1 14320 ARCDIQLTQPPSLSASVGDTVTISCQTSQSVNKWLNWYQQKPGQAPKLLIYYATSLQSGVPSRFSGSESGTDFTLTISSLQPEDVATYYCQQEYSYP
Chinchilla lanigera V928 igkv AGCD01052620.1 9163 STGQTLLTQSPASLALSPGETATLSCTASQSVSSALAWYQQKAGQAPRLLIYGASSRAPGIPDRFSGSRSGTDFTLTISTLEPEDVATYYCLQTWS
Chinchilla lanigera V929 igkv AGCD01052620.1 4137 SIGEALLTQSPASLALSLGETATLSCKASQGISNSLDWYQQKPGQAPRLFIYGASSRATGIRARFSGSRSGTGFTLTISSLEPEDVAAYYCYQYYSGF
Chinchilla lanigera V930 igkv AGCD01052623.1 24605 ARCDTQMTQSPSSLSASIGGTVTISCRESEDVIQWLSWYQQEPGKALKPLIYDATNLQSGVPSRFSGSGSGTGYSLTIGSTHAEDVATYYCLQSRSK
Chinchilla lanigera V931 igkv AGCD01052623.1 13766 ARCDIQLTQPPSLPASVGDRVTISCQTSQSVNKFLNWYQQKPGQASKLLIYYATNLASGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQYNSSP
Chinchilla lanigera V932 igkv AGCD01052623.1 8649 STGQTLLTQSPASLALSPGETATLSCKASQSVSSYLAWYQQKPGQAPRLLIYRASSRAPGIPDRFSGSGSGTDFTLTISSLEPEDVATYYCLQTWS
Chinchilla lanigera V933 igkv AGCD01052623.1 3739 STGQTLLTQSPASQALSPGETATLTCKASQGISNWLAWYQQKPGQPPRLLVYGASSRATGIPARFSGSGSGTGFTLTISSLEPEDVVTYYCLQTW
Chinchilla lanigera V934 igkv AGCD01052624.1 89947 VNADIILTQTPASLSASPGETISISCQASADVHSEMSWIRIKLGQRLEPLISHVTTLAPGVRARFSSKGSGTSYVLRISPVEPGHSGEYYCMHDCGW
Chinchilla lanigera V935 igkv AGCD01052624.1 78644 TSGSAALTQSPGFLRATPGESISIICRANESVSDYLTWYQQKPGQVPRILIYDADNRYPGVSNRFTGTQDGTEFTFKISSVEVGDSGTYYCQQDYAVP
Chinchilla lanigera V937 igkv AGCD01052624.1 66537 ARCDVQMTQTPSSLSASVGDTVTLTCRTSEDISNGLNWYQQKPGKPPKPLIYGASYLESGVPQRFSGSGFGTDFTVTISSLEPEDVATYYCHQSNSFP
Chinchilla lanigera V938 igkv AGCD01052624.1 52350 ARCDIQLTQPPSLPASVGDRVTISCQTSQSVNKYLNWYQQKPGQAPKLLIYDATNLASGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQSSSWP
Chinchilla lanigera V939 igkv AGCD01052624.1 47449 STGQILLTQSPTSLALSLGETATLSCTASQNVYSYLAWYQQKPGQAPRLLIYDASSRATGIPARFSGSGSGTGFTLTISSLEPEDVATYYCQQYGSGF
Chinchilla lanigera V940 igkv AGCD01052624.1 28912 ARCDIQLTQPPSLPASEGDTVTISCQASQSVNKYLNWYQQKPGQAPKLLIYGATNLASGVPSRFSGSRSGTDFTLTISSLQPEDVATYYCQQDNSTP
Chinchilla lanigera V941 igkv AGCD01052624.1 17007 STGQTLLTQSPASLALSPGETATLRCKASQGVSNWLDWYQQKPGQAPRLLIYAASSRAPGIPARFSGSGSGTDFTLTISNLEPEDIATYYCYQYYSGF
Chinchilla lanigera V990 ighv AGCD01059204.1 26368 VHAEVHLLESRGGLVKPGGSLRLSCAASGFTFSSYYMQWISQSPGKGLEWISYSSNDGGTTYYPDSMKGRFTISRDNGKNTLYLQMDNLRTEDTALYYCT
Chinchilla lanigera V991 ighv AGCD01059204.1 18731 VHAEVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMHWIRQSPGKGLEWLSYISGDSSDINYADSVKDRFTISRDNGKNTLYLQMDSLRTEDTALYYCSA
Chinchilla lanigera V1001 trbv AGCD01061391.1 87106 HTNAGVIQTPRHEVTKRGQAVTLKCEPVLGHNDLYWYRQTMVQSLELLTSFRSQSLLNEGGMPKDRFTAQMPDASLSTLKIQPVEPSDSAVYLCASSS
Chinchilla lanigera V1002 trbv AGCD01061391.1 73995 FLDEEVSQTPRHLVRGIGQKVKMYCTPKEGHSYVFWYQHILGKEFKFLISFQTNNVFDDSGMPKKRFSAKCPENSPCNLEIQPAELQDSAWYLCASSE
Chinchilla lanigera V1003 trbv AGCD01061391.1 59187 TVDSGVTQTPKFRFVEKGQDVTLECEQNLNHDNMYWYRQDPGQGLRLIYFSLMTDDVQDGDITEGYTVSRKKKEFFPLTMKSTQKNQTAVYFCASSL
Chinchilla lanigera V1004 trbv AGCD01061391.1 49444 GSGLGALVLQQPRRAICKSGSSVKMECHCLDFQATAVTWYRQFPKQGITRMAISTGGSDVTYEQGFSQTKFPISHSNLNYSTLTVTTTHPEDSGFYFCGES
Chinchilla lanigera V1005 trbv AGCD01061391.1 43607 SGLGALVLQQPRRAVCKSGSSVKIECRYVDIQASTVFWYRQFPKQGFVLMATSNTGSSGSHEQGFTPAKFPISHPNLTYSTLTVTTTHPEDSGLYFCGAS
Chinchilla lanigera V1006 trbv AGCD01061391.1 25254 FSDDEVTQTPRHLIKWKGQLAKMSCVPKKGHTALYWYQQKQNEGLKFLAYFGNKEILDQTDMFKDRFSAEYPQDSPCSLEIKSSELEDSALYLCASSQ
Chinchilla lanigera V1007 trbv AGCD01061391.1 21140 FSDDEVTQIPRHLIKWKGQKAEMSCVPKKGHNALYWYQQKQNEGLKFLVYFQNRDILHQTDNFKDQFSAEYPQDSPCSLEIKSSEPEDSALYLCASSE
Chinchilla lanigera V1008 trbv AGCD01061391.1 16961 FSDDEVTQMPRHLVKRKGQQAKMTCVPKKGHNGLYWYQQKQNEGLKFLIYFWNREATDQIDKFKDRFSVDYPQDSPCSLEIKSSEPEDSALYLCASSE
Chinchilla lanigera V1009 trbv AGCD01061391.1 14799 FSDDDVVQMPRHLVQWKGQQAKMTCVPKKGHNVLYWYRQKQNDGLKLLIYFQNREVVDQIDNFKDQFLAEYPQDSPCSLEIKSSELEDSALYLCASSE
Chinchilla lanigera V1010 trbv AGCD01061391.1 8432 SMDSGVHQTPRNRITQTGTNIVLECSQTKGHDQMFWYRQDPGQGLRLIYYSIDVNDINPGEISDGYNVSRKEQAKFSLFIKTATPTQTALYFCASSY
Chinchilla lanigera V1011 trbv AGCD01061391.1 2355 INITFSSSDADVSQIPRHCITGVGKKIILECSQTMGHNKMYWYRQDPGRELQLIHYSYGVNVTEKGELSSESTVSRERTEHFPLTLESSSPPHTSQYFCASS
Chinchilla lanigera V1012 trbv AGCD01061392.1 50989 PVYSGVTQIPKHLVTVMGTNRTLKCEQNLGHGAMFWYRQNAKNPIKLMFYYSYSNLLQNETVPSRFTPDNSDSSRLYLHIAFLEMEDSGVYLCASS
Chinchilla lanigera V1013 trbv AGCD01061392.1 49747 HTEPGVIQIPSHQVTKMGEMVTLSCDPISSHLYFYWYRQILGQRMEFLVSFSMGKVLEKSETFEDDYSVEKPDGSYFILKIHPTRLEHSAVYFCASKL
Chinchilla lanigera V1014 trbv AGCD01061392.1 41768 PTNTRVTQTPRHLVMGTTNKKSLKCEQNLGHNAMYWYKQNAKKGPELMFVCNYQNLAQNETVPSRFSPNCSDKSQVYLDLTALRPEDSAVYLCASSQ
Chinchilla lanigera V1015 trbv AGCD01061392.1 39929 HMEPGVRQTPSHKITEKGQNVTLRCDPISDPQYIYWYRQTVEKGIEFMVYFYDNNPVEKAEFFRDRFSAEMPEDLYSILKIQHLQLGDSAMYLCAGLA
Chinchilla lanigera V1017 trbv AGCD01061392.1 27814 PGNAGITQTPKFQVLKTGQRMTLSCAQDLKHDRMHWYRQDPGLGLRLLYYSYDVNITEKGDIPDGYSVSRSSREHFPLTLESASPSQTSVYFCASS
Chinchilla lanigera V1018 trbv AGCD01061392.1 24556 HTEAGVSQSPSYRVIKKGQNVAFRCDPISGHSFLYWYQQTLGQGPKFLMYFQDERPADTSGMPPERFTAERPEATFSNLKIEGAQQGDSAVYLCAS
Chinchilla lanigera V1019 trbv AGCD01061392.1 6757 LLEGEVTQSPRHLIKAKGGKSTLKCYPVSGHVSVSWYQQAPGQGPQFLIEYYETSQRAKGNMPGRFSAQQFSDYHSELNMSALELGDTAVYLCAGS
Chinchilla lanigera V1020 trbv AGCD01061392.1 4546 HIEAGITQSPRYKVIKTKEKVTLKCHQTDNHDYMYWYRQDPGHGLRLIYYSYGVKNLERGDVSDGYNVSRENTEDFPLTLDSVTLSQASMYFCASSF
Chinchilla lanigera V1131 ighv AGCD01077893.1 10756 VQGEVQLVESGGGLVQLGGSLRLSCAASGFTFSSSWMNWIRQAPGKGLEWLGEIRGNSGTINYAGSVKGRFTISRDNAKNTLYLQMTQLKTEDTAIYYCA
Chinchilla lanigera V1132 ighv AGCD01077896.1 2862 VLSQELQESGPGLVKPSETLSLTCAVSGFSLTDYSVHWVRQPPGKGLEWIGVIAYNGNTYYNSALQSRVGISRNTAISQVSLTLSSLRTEDTAVYYCAR
Chinchilla lanigera V1133 ighv AGCD01078283.1 952 VLSQEQLQESGPGLVKPSETLSLTCTVSGFTLTSYGVCWIRQAPGKGLEWIGCISSDGSTYYNSALQCTISRVTSKSQVSLTLSSLRTEDTAVYYCAR
Chinchilla lanigera V1136 ighv AGCD01078588.1 2577 VLSDLTLRESGPSLVKPGETLSLTCSVTGGSVSSSYALSWIRQPPGKALQWMGIWAGGTIYNPAFQGRISITANTAKNQFSLQLNSVTTEDTAVYYCAR
Chinchilla lanigera V1138 ighv AGCD01079449.1 2231 VLSQVQLQESGPGLVKPSETLSLTCAVSGFSLTSDAVSWFRQAPGKGLEWIGIIWRGGGTNYNSALQSRVGISRDTSKSQVSLTLSSLRTEDTAVYYCAG
Chinchilla lanigera V1140 trgv AGCD01079711.1 764 DTQISSNMEQGMVSITRKPGSYLTIPCDMRAVRSYIHWYRFQEGQAPQRLLYYDFSNSKTVLESGLRPGKYNAYQATQHSNKFVVHNLEESDSGMYYCAVWT
Chinchilla lanigera V1141 igkv AGCD01079887.1 1106 STGDVVMTQTPLTLSVSPGETASISCTSSQSLVHSDGKTYLNWLVHKPGQAPRGMIYQVSKKYSWVPDRFSGSGSGTEFTLTISRVEAEDAGVYYCMQGLYVP