WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Papio anubis AHZZ00000000.1 (AHZZ01) 301 68 47 78 39 58 6 5
Papio anubis AHZZ00000000.2 (AHZZ02) 300 67 47 78 39 58 6 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Papio anubis V463 trav AHZZ01107544.1 5302 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQFIIDIRSNEHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Papio anubis V464 trav AHZZ01107544.1 27805 VWSQQKVEQSSGPLSVPEGAIASLNCTYSDSGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNRASQYVSLLIRDSQLSDSATYLCAV
Papio anubis V1033 trav AHZZ01093946.1 2532 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFQSLLWYKQEKKAPTFLFTLTSSGIEKKSGRLSSILDKKDFFSILNITATQTRDSAVYLCAVE
Papio anubis V1034 trav AHZZ01093949.1 90845 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGSYFCA
Papio anubis V1035 trav AHZZ01093949.1 79887 TIIDAKTTQPTSMDCAEGRAANLPCNHSTIGGNEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Papio anubis V111 trgv AHZZ01030316.1 38849 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGIYYCATWD
Papio anubis V112 trgv AHZZ01030316.1 43864 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISPGKYDTYGSTRRRNLRLILRNLIENDSGVYYCANWD
Papio anubis V113 trgv AHZZ01030317.1 14582 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCIFYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWD
Papio anubis V114 trgv AHZZ01030318.1 14642 EQFQLSISTEVKKSIDISCKIRSTNFENDVIHWYWQKPNQALEHLIYIISTKSAVHGSMGKRSNKVEARKNSQTLTSILTIKSVEKEDMAIYYCAGWD
Papio anubis V115 trgv AHZZ01030322.1 3053 TCGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Papio anubis V116 trgv AHZZ01030322.1 5059 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLKKTVVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Papio anubis V132 trav AHZZ01035404.1 2193 SGMAQTVTQSQPEMSVREAETMTLSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Papio anubis V133 trav AHZZ01035404.1 11685 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS
Papio anubis V134 trav AHZZ01035404.1 35217 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASNRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Papio anubis V135 trav AHZZ01035404.1 52272 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHIAASQPRDSAIYICAV
Papio anubis V136 trdv AHZZ01035404.1 138009 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Papio anubis V137 trdv AHZZ01035404.1 159241 VMSAVELVPEHQTMIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Papio anubis V157 igkv AHZZ01040804.1 26744 CNGDIVLTQSPASLAVSPGQRATITCRASESVSLLGINFIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAANYYCLQSKDLP
Papio anubis V158 igkv AHZZ01040804.1 44392 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQGNSI
Papio anubis V159 igkv AHZZ01042097.1 3598 SGDIIPNQTPASLTAPPGETVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Papio anubis V160 igkv AHZZ01042100.1 22347 TSGDILLTQTPLSLPVTPAEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYEVSNRASGVPERFSGSGSGTDFTLKISLVEAEDVGVYYCMQT
Papio anubis V161 igkv AHZZ01042101.1 1296 SSGDIVMTQTPLSLPVTLGEPTSISCRSSQSLVYSDGKTYLHWYLQKPGQSLQLLMYLVSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLRSP
Papio anubis V162 igkv AHZZ01042101.1 23304 SSGDIVMTQTPLFLPVTLGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQALEFP
Papio anubis V243 ighv AHZZ01064615.1 3398 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQTPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNAKNSLYLQMNSLRAEAVYYCAR
Papio anubis V244 ighv AHZZ01064617.1 712 AHSQEQLVQSGAEVKKPGASVKVSCKASEYTFTSYVISWLRQAPGQGFEWMGGINPSDGSTSYAQKFQDRVTITADMSTSTVYMELSSLRSEDTAVYYCAR
Papio anubis V245 ighv AHZZ01064625.1 10297 VLSQVQLQESGPAVVKPSQTLSLTCAVSGGSISSGYDWSWIRQSPGKALEWIGYISYSGSTNYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V246 ighv AHZZ01064628.1 244 VLSQVKLQQWGEGLVKLSETLSLTCAVYGGSISGYYYWSWIRQAPGKGLEWIGSIYSSGSSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADSAVYYCAR
Papio anubis V247 ighv AHZZ01064636.1 1270 VLSQVKLQQWGEGLVKPSETLSLTCAVYGGSISGYYYWSWIRQPPGKGLEWIGNIDGNSASTNYNPSLKNRVTISKDTSKNQFSLKLSSVTAADSAVYYCAR
Papio anubis V271 ighv AHZZ01069449.1 25636 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Papio anubis V272 ighv AHZZ01069451.1 7155 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCTT
Papio anubis V273 ighv AHZZ01069453.1 22422 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Papio anubis V274 ighv AHZZ01069455.1 6979 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMYWIRQAPGKGLQWVSAINTGGGSTWYTDSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Papio anubis V275 ighv AHZZ01069455.1 20092 VQCEMQLVESGGGLAQPGGSLRLSCAASGFTFSDHYMHWVRQAPGKGPEWVGFIRNKAKGGTAEYAASVKGRFTISRDDSKNVTYLQMNSLKTEDTAVYYCAR
Papio anubis V276 ighv AHZZ01069455.1 33478 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMCVSWIRQPPGKALEWLARIDWDNDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Papio anubis V277 ighv AHZZ01069455.1 52073 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYWWGWIRQPPGKGLEWIGHIYGSSGSNYLNPSLKSRVTISIDTSKNQLSLKLSSVTAADTAVYYCAR
Papio anubis V278 ighv AHZZ01069456.1 9990 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWARQAPGKGLEWVSAINTGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Papio anubis V371 iglv AHZZ01091080.1 12159 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQQGKAPRYLMWLKSDGSHSKADGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWTTD
Papio anubis V373 ighv AHZZ01091598.1 21925 AHAQVQLVQSGAQIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Papio anubis V374 ighv AHZZ01091599.1 2221 VQCEVQLVESGGGLSKPGGSLRLSCAASGFTFSDYNMDWVRQASGKGLEWVSSINTGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Papio anubis V375 ighv AHZZ01091599.1 13843 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDNYMEWVRQAPGKGLQWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQTSSLNTEDTAVYYCTR
Papio anubis V376 ighv AHZZ01091600.1 4724 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLTTSGMGVGWIRQPPGKALEWLAHIYWDDDKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Papio anubis V377 ighv AHZZ01091603.1 4409 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWNWIRQPPGKGLEWIGRIYGGSGSTDYSPSLKSRVTISTDTSKNQLSLKLSSVTAADTAMYYCAR
Papio anubis V412 iglv AHZZ01097944.1 5375 VDSETVVTQEPSLSVSSGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYRTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYMGSGI
Papio anubis V413 iglv AHZZ01097949.1 49065 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLSA
Papio anubis V414 iglv AHZZ01097949.1 59449 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSKYVQWYQQRPGSAPTTVIYEDNKRPSGVPDRFSGSIDSSSNSASLTISGLNSEDEADYYCQSADGSYN
Papio anubis V415 iglv AHZZ01097950.1 8288 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSLHDLGSGVPRRVSGLMEGWSNKGLLLISDLQPEDEADYYCMT
Papio anubis V416 trav AHZZ01098200.1 877 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQNFMWYRQYSRKGPQLLIYTYSSGNKEEGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Papio anubis V417 trav AHZZ01098200.1 13942 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSTHISDTAEYFCAVS
Papio anubis V418 trav AHZZ01098200.1 25792 GTRAQSVTQPEKILSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHIPRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Papio anubis V419 trav AHZZ01098200.1 35497 VNSQQGEEDPQTLSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLILICSNEREKNSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Papio anubis V420 trav AHZZ01098200.1 47314 RTNGDLVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHDKSDSSFHLEKPSVQLSDSAVYYCVLR
Papio anubis V421 trav AHZZ01098200.1 50541 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRENTYYLFWYKQPPSGELVFLIRRNSFDEQNEMNGRYDSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Papio anubis V422 trav AHZZ01098200.1 85983 LSGEDQVMQSPEALSLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Papio anubis V423 trav AHZZ01098206.1 7996 VRGIQVEQSPPDLILQEGANSTLRCNFSATVNNLQWFHQNPWGQLINLFYIASGTKQNGRLSATTVTTERYSLLHISSSQTTDSGIYFCAVKSQCSP
Papio anubis V428 ighv AHZZ01098942.1 3876 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSFSSNYWSWICQPPGKGLEWIGGIYGSGGSTYYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V429 ighv AHZZ01098950.1 185 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGYIYGNSASTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V433 iglv AHZZ01099970.1 6346 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSKYVQWYQQRPGSAPTTVIYNDDQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSADSSS
Papio anubis V434 iglv AHZZ01099973.1 23728 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPAQFSGSLLGGKAALTLSGAQPEDEAEYYCW
Papio anubis V435 iglv AHZZ01099973.1 33054 SWAQSVLTQPPSVSAAPGQRVTISCSGSSSNIGRYYVSWYQQLPGAAPKLLIYDVNKRPSGVPDRFSGSQSGTSTTLGITGLRPEDEADYYCLAWDNSLS
Papio anubis V436 iglv AHZZ01099973.1 38403 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYYVSWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLS
Papio anubis V437 ighv AHZZ01100290.1 207 VQCEVQLVESGGGLVQPGRFLRLSCAASGFTFSNYYMHWAHQAQGRGLEWVSLMRKKANSYTTEYAVSVKDRFTISRDDSKNTLYLQMNSLKTEDTAVYYCA
Papio anubis V446 igkv AHZZ01104241.1 8111 STGDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSSGNTYLSWFQQKPGQSARRLIYKVSNRDSGVPDRFTGSGAGTDFTLKISRVEAEDVGVYYCMEG
Papio anubis V447 igkv AHZZ01104241.1 24891 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDRSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Papio anubis V448 igkv AHZZ01104241.1 53166 TSGEIVLTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFVVYYCQKYSSSP
Papio anubis V449 igkv AHZZ01104241.1 58626 VRCDIQMTQSPSFLSASVGDRVTITCQASQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Papio anubis V450 igkv AHZZ01104243.1 37859 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLFIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Papio anubis V451 igkv AHZZ01104243.1 54084 VRGDIQMTQSPSSLSASVGDRVTITCRASQSFSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDVASYYCQQYYSYP
Papio anubis V452 igkv AHZZ01104243.1 69229 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Papio anubis V454 ighv AHZZ01104760.1 308 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSDHYMHWVRQAPGKGLEWISAINSGGGSTYYAESVKGRFTISRENAKNTLYLQMDSLRAEDTAVYYCAR
Papio anubis V455 ighv AHZZ01104761.1 4085 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRVTTSRDDSKSITYLQMNNLKTEDTAVYYCAR
Papio anubis V456 ighv AHZZ01104763.1 4376 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMDWVRQAPGKALEWVSGISNTGGSTWYADSVKGRFTISRENAKNTLYLQMSSLRAEDTAVYYCAR
Papio anubis V458 igkv AHZZ01105091.1 459 ARCDIQMNQSPSSLSASVGDTATITCRASQGISNNLAWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYNSLP
Papio anubis V465 trav AHZZ01107544.1 34319 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPTLFWYVQYPNQGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Papio anubis V466 trav AHZZ01107544.1 39875 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTVVQGIKGFEAEFKRSQYSFNLRKHSVHWSDAAEYFCAVG
Papio anubis V467 trav AHZZ01107544.1 53748 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQSIIDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Papio anubis V468 trav AHZZ01107545.1 4986 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGHYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Papio anubis V469 trav AHZZ01107545.1 23301 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKATKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Papio anubis V472 ighv AHZZ01108247.1 746 AHSEVQLVQSGSEVKKPGATVKISCKASGYTFIDYYLHWVRQAPGKGLEWMGGVDPEDGEADYAQKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAR
Papio anubis V475 igkv AHZZ01109397.1 47 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYDATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Papio anubis V476 igkv AHZZ01109397.1 13748 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYDATTLQSGVPSRFRGSGSRTEFTLTISSLQPEDFAAYYCLQHNSYP
Papio anubis V477 igkv AHZZ01109397.1 20178 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLSWYQQKPGKAPKLLLYKASGLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQFSSAL
Papio anubis V478 igkv AHZZ01109398.1 3227 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQSYSWP
Papio anubis V484 ighv AHZZ01110760.1 1678 VLSQVQLQESGPGLVKPSETLSLTCAVSGASISSNWWSWIRQAPGKGLEWIGEINGNSGSTNYNPSLKSRVTISKDASKSQFSLKLSSVTAADTAVYYCAR
Papio anubis V485 ighv AHZZ01111404.1 10611 AQSQVQLVQSGAEVKKPGASVKVSCKASGYTFSTYAISWVRQAPGQGLEWMGGIIPLVGITNYAQKFQGRDTSTSTAYMELSSLRSEDTAVYYCAR
Papio anubis V486 ighv AHZZ01111405.1 9462 AHSQVQLVQSGAEVKQPGSSVKVSCKASGYTFTNSAMQWVRQTPGQGLEWIGWIIIGNGNTNYAQKFQGRVTITRDTSTSTGYMELSSLRSEDTAVYYCAA
Papio anubis V489 ighv AHZZ01113072.1 331 VQCEVQLVESGGGLVQPGVSLRLSCAASGFTFSSTRMNWIRQAPGKKLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCVR
Papio anubis V498 igkv AHZZ01117753.1 3234 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASRLESGVPPRFSGSGSGTEFTLTISSLQPEDFATYYCLQYKSDP
Papio anubis V499 igkv AHZZ01117754.1 5923 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQYNNWN
Papio anubis V500 igkv AHZZ01117754.1 31204 TTGEIVMTQSPATLSLSPGEGATLSCRASQSVGSYLAWYQQKPGQAPKLLIHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLP
Papio anubis V507 ighv AHZZ01123648.1 7377 AQSQVQLVQSGAEVKKPGASVKVSCKASGYTFSTYAISWVRQAPGQGLEWMGGIIPLVGITNYAQKFQGRDTSTSTAYMELSSLRSEDTAVYYCAR
Papio anubis V508 ighv AHZZ01124687.1 305 AHAQVQLVQSGPEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDSGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Papio anubis V512 ighv AHZZ01129142.1 1014 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISSYWWGWIRQPPGKGLEWIGYIYGSGSSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V516 trdv AHZZ01130977.1 3877 FSVAQKVTQAQSSVSMPVGKAVTLNCQYETSWWSYYLLWYKQFPGKEMIFLIRQGSSEQNARNGRYSVNFQKAASSIALTISALQLEDSATYFCALWE
Papio anubis V519 igkv AHZZ01143621.1 14212 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGEAPRLLIYDASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Papio anubis V522 ighv AHZZ01150255.1 7066 VQCEVQLLEYGGGLVQPGRSLRLSCAVSGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGRTEYAASVKGRFTISRDDSKSTASLQMSSLKTEDTAVYYCAT
Papio anubis V524 igkv AHZZ01169213.1 5368 TTGEIVMTQSPATLALSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYFCLQSSNW
Papio anubis V525 igkv AHZZ01176978.1 12155 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLSWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQDSSSP
Papio anubis V554 trav AHZZ01198213.1 10235 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNMDLKRDQRVTVLLNKKDKHLSLRIADTQTEDSAIYFCAES
Papio anubis V555 trav AHZZ01198214.1 2662 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Papio anubis V556 trav AHZZ01198214.1 53658 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Papio anubis V557 trav AHZZ01198216.1 1077 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVY
Papio anubis V558 trav AHZZ01198216.1 6537 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSVSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Papio anubis V573 trav AHZZ01003806.1 12807 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Papio anubis V690 trdv AHZZ01035404.1 206881 RGMLCDKVTQSSLDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSHGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Papio anubis V712 igkv AHZZ01040804.1 60973 TTGQVILTQSPATLSLSPGERATLSCRASQSVSNYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYYSGY
Papio anubis V713 igkv AHZZ01040804.1 52054 ARAETILTQSAAFVSATPGDKVTISCKASQDIDDDMNWYQLEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Papio anubis V714 igkv AHZZ01040805.1 15008 SSGDTVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSHFPGVPDRFTVSGSDTDFTLQISRVKAEDVGVYYCMQCLQL
Papio anubis V715 igkv AHZZ01040807.1 16032 AREETILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDTAYYFCQQRDN
Papio anubis V716 igkv AHZZ01040807.1 4792 AKCDIQMTQSPTFLSASVGDRVTIACRASQSIHKGLAWYQQKPGKAPKLLISYASNLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Papio anubis V717 igkv AHZZ01040808.1 23490 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQTPKLLISWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQHY
Papio anubis V724 igkv AHZZ01042076.1 1432 TRCAIQMTQSPSSLSASVGDRVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKCDSAP
Papio anubis V725 igkv AHZZ01042077.1 400 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLSSNEYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Papio anubis V726 igkv AHZZ01042078.1 36529 ARCDIQMTQSPSSLSASVGDRVTITCRASQNIYSNLAWYQQKPGKAPKPLIYYASSLETGVPSRFRGSGSGTDYTLTISSLQPEDIATYYCQQYNNSP
Papio anubis V727 igkv AHZZ01042078.1 14529 SSGDVVMTQSPLTLPVTPGQPASISCRSSQSLVHSDGNTYLSWYQQKPGQPPRLLIYKVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQGTKVP
Papio anubis V728 igkv AHZZ01042078.1 4166 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQHRALP
Papio anubis V729 igkv AHZZ01042079.1 5408 SSGDVVLTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQGTKAP
Papio anubis V730 igkv AHZZ01042080.1 62803 ARCDIQLTQSPSSLSASVGDRVTISCRTSQNIYSNLAWYQQKPGKTPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHGYGTP
Papio anubis V731 igkv AHZZ01042080.1 47456 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Papio anubis V732 igkv AHZZ01042080.1 42469 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPKLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEVEDVGVYYCVQAIAFP
Papio anubis V733 igkv AHZZ01042080.1 21981 SIGDIVMTQTPLSLPVTTGEPASNSCRCSQSLLHSDGNTYLYWYLQKPGQPPWLLIYRVSDRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQAL
Papio anubis V734 igkv AHZZ01042083.1 13031 ARCDIHMTQSPSSLSASVGDRVTITCRASQGITDDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTEFTLTISSLQLNDSATYYCQHYYSYP
Papio anubis V735 igkv AHZZ01042083.1 515 SRGDIMMTQTPLSLPITPGEPASISCRSSQSLLDSDDGYTYLDWYLQKPGQSPQPLIYFVSSWASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQCIEFI
Papio anubis V736 igkv AHZZ01042084.1 1771 ARCDIQLTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQYGYGI
Papio anubis V737 igkv AHZZ01042085.1 51148 TSGDIVMTQTPLSLPVSPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQG
Papio anubis V738 igkv AHZZ01042085.1 14528 TSGDIVMTQTPLSLPVSPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIREVSNRASGVPDRFSGSGSGTDFTLKISPVEAEDVGVYYCMQGIQLP
Papio anubis V739 igkv AHZZ01042085.1 5028 ARCDIQMTQSPSSLSASVGDRVTITCRASQGITNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHYYSTP
Papio anubis V740 igkv AHZZ01042091.1 3339 TSGDIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Papio anubis V741 igkv AHZZ01042093.1 172638 ARCAIQMTQSPSSPSATVGDRVTTTCRVSQSINNNLAWYQQKPGKTPKLLICEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDVATYFCQHGYSYP
Papio anubis V742 igkv AHZZ01042093.1 139907 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINKELDWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYTTP
Papio anubis V743 igkv AHZZ01042093.1 120782 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLYWYLQKPGQSPQLLMYFASYRASGVPDRFSGSGSGTDFTLEISRVEAEDIGVYYCMQG
Papio anubis V744 igkv AHZZ01042093.1 103223 YSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSVTDFTLKISRVEAEDVGVYYCMQSIEFP
Papio anubis V745 igkv AHZZ01042093.1 72696 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQSTEYP
Papio anubis V746 igkv AHZZ01042093.1 54777 TSGDILLTQTPLSLPVTPGEPASISCRSSQSLLHSNENTYLHWYLQKPGQSPQLLICEVSNRASGVPDRFSGSGSDTDFTLKINLVEAEDVGVYYCMQT
Papio anubis V747 igkv AHZZ01042093.1 49878 SSGDIVMTQTPLSLPVTLGEPTSISCRSSQSLVYSDGKTYLHWYLQKPGQSPQLLMYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLRSP
Papio anubis V748 igkv AHZZ01042093.1 41779 ARCDTQMTQSLSSLFASVGDRVTITCRASQGINNELAWYQQKPGKAPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYTTP
Papio anubis V749 igkv AHZZ01042093.1 33563 SSGDIVMTQTPLSLPVTPGEPSSISCRSSQSLLDSYGYTNLNWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQT
Papio anubis V750 igkv AHZZ01042093.1 23933 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQRYSAP
Papio anubis V751 igkv AHZZ01042093.1 9016 TSGDIVMTQTPLSLPVSPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYEVSNWASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQG
Papio anubis V752 igkv AHZZ01042093.1 1181 ARCDIQMTQSPSALSASVGDRVTISCRASQNIYSGLAWYQQKPGKAPKLLIYDASGLQSGIPSQFSGSGSGTDFTLTISSLQPEDSATYYCQHYYDTP
Papio anubis V753 igkv AHZZ01042094.1 8035 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLFNSDYANTYLDWYLQKPGQSPQLLIYMLSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEYP
Papio anubis V762 trav AHZZ01044060.1 11365 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIENEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Papio anubis V763 trav AHZZ01044061.1 4493 GLRAQLVTQPEDQVTVAERNPLTVKCTYSVSGNPYLFWYVQYPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Papio anubis V764 trav AHZZ01044067.1 47061 MCLVLVTTGQNIDQPTEMTAMEGAIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQVKDSASYLCAVR
Papio anubis V765 trav AHZZ01044070.1 1544 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQRDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Papio anubis V862 trbv AHZZ01067647.1 24860 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHDYMSWYRQDPGLGLRQIYYSSNVELVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYFCASSL
Papio anubis V863 trbv AHZZ01067647.1 19538 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKVNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Papio anubis V864 trbv AHZZ01067647.1 6033 SVFSAVVSQKPSRDVCQRGTSVTIQCQVDSQLTMMFWYRQQPGLSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTNPEDSSIYLCSVE
Papio anubis V865 trbv AHZZ01067648.1 16039 LMEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRIRIEHFPLTLESTSPSHTSQYLCASSE
Papio anubis V866 trbv AHZZ01067649.1 130710 HAEAGVSQDPRHKITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSISTLMIQHTEQGDSAVYLCASSL
Papio anubis V867 trbv AHZZ01067649.1 124243 SVAAGVTQSPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQRDKGSIPDRFSAQQFSDYHSEVNMSSLELGDSAVYLCASSL
Papio anubis V868 trbv AHZZ01067649.1 115819 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEISDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Papio anubis V869 trbv AHZZ01067649.1 104477 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSRFPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Papio anubis V870 trbv AHZZ01067649.1 98722 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHSSLFWYRQSMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPNASFSTLKIQPSEPRDSAMYFCASSL
Papio anubis V871 trbv AHZZ01067649.1 95439 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHTYLFWYRQSMMQGLEFLIYFNDKSPIDDSGMPKDRFSATMPNASFSTLKIQPSEPRDSAVYFCASSL
Papio anubis V872 trbv AHZZ01067649.1 80039 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Papio anubis V873 trbv AHZZ01067649.1 73094 HTEAGVTQFPSHRVIEKGQTVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFMRASVQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Papio anubis V874 trbv AHZZ01067649.1 67986 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Papio anubis V875 trbv AHZZ01067649.1 63012 SPGEEVTQTPKHLVKGEGQKAKLYCDPIKGHSYVFWYQQVLRKEFKFLISFQNKNVFDETGMPKERFSAKCPANSPCSLEIQATKLKDSAVYFCASSQ
Papio anubis V876 trbv AHZZ01067649.1 42601 TVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQNGDIAEGYSVSRDRKESFPLTVTSAQRNPTAFYLCASSI
Papio anubis V877 trbv AHZZ01067649.1 34362 GSGLAAVVSQYPSRFICKRGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNEGSDVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Papio anubis V878 trbv AHZZ01067649.1 24252 SADTKVTQRPRLLVKANEQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDAALYFCASSK
Papio anubis V879 trbv AHZZ01067649.1 15342 SFHAEVTQTPGYLVKGKGQKTKIDCTPEKGHTYVYWYQQNQNKEFTFLISFQDEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Papio anubis V880 trbv AHZZ01067649.1 3167 SMDADVTQTPRNSIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIFYSFDVEDINKGEISDGYSASRQEQAKFSLSLESATPNQTALYFCATSD
Papio anubis V881 trbv AHZZ01067651.1 71496 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFNYEAQQDKSGLPNDRFSADRPEGSVSTLKIQRTEQRDSAVYLCASSL
Papio anubis V882 trbv AHZZ01067651.1 66443 PVDAGVTQSPTHLIKMRGQQVTLRCSPISGHTSVSWYQQALGQGPQLIFEYDRKEERVRGNFLDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Papio anubis V883 trbv AHZZ01067651.1 59840 LFSAGPGNAGVTQTPKFQILKTGQSMTLQCAQDMNHNYMSWYRQDPGVGLRLIHYSVGAGVTDKGEVSNGYNVSRLNTEDFPLSLESAASSQTSVYFCASSY
Papio anubis V884 trbv AHZZ01067651.1 53942 HTGAGVSQFPRYRVTKRGQDVTLRCDPISGHEYLSWYQQAPGQGPEFLTYFQNDAQLDKSGLPSDRFSAARPEGSVSTLKIQRTEQGDSAVYLCASSL
Papio anubis V885 trbv AHZZ01067651.1 45155 PVEPGVTQSPTHLIKTRGQQVILRCSPISGHSSVYWYQQALGQGPQFIFEYCQKEERGRGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Papio anubis V886 trbv AHZZ01067651.1 25238 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGQGPQFIFQYYEKEERERGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Papio anubis V887 trbv AHZZ01067651.1 17942 PVNADVTQTPKFRVLKTGQSMIVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESAALSQTSVYFCASSY
Papio anubis V888 trbv AHZZ01067651.1 13641 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYQAQPDKSGLPNDRFSAERSEGSVSTLTIQRTEQQDSAVYLCASSL
Papio anubis V889 trbv AHZZ01067651.1 4874 PVIAGVAQSPTHLIKTRGQQVTLRCSPISGHNTVYWYQQALGQGPQLIFQYYRGEDRGRGNFPERFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Papio anubis V890 trbv AHZZ01067652.1 62249 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDCMYWYRQDPGMGLRLIHYSVGEGSTDKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY
Papio anubis V891 trbv AHZZ01067652.1 57719 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQAPGQGPEFLTYFQNDAQRDKSGLPNDRFSAERTEGSVSTLKIQRTEQADSAVYLCASSL
Papio anubis V892 trbv AHZZ01067652.1 49809 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGLQFILWYDEEEERGRGTFPHRFSGHQFPNYSSELNVNASEVGDSALYLCASSL
Papio anubis V893 trbv AHZZ01067652.1 38427 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHVALYWYQQALGQGPEFLTYFQNDAQPDKSGLPSDRFSAERPEGSVSTLKIQRTQQGDAAVYLCASSL
Papio anubis V894 trbv AHZZ01067652.1 27943 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEEKERERGNFPDRFSGHQFPNYSSELNVNALEAGDSALYLCASSL
Papio anubis V895 trbv AHZZ01067652.1 24634 LVNAGVTQTPKFQVLKTGQSMTVQCAQDMNYNFMYWYRQDPGVGLRLIHYSGAAGTTDKGEVPSGYNVSRLNTEIFPLRLESAAPSQTSVYICASSY
Papio anubis V896 trbv AHZZ01067652.1 20057 HTGARVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQRTQQWDSAMYLCASSL
Papio anubis V897 trbv AHZZ01067652.1 9757 SVDAGVTQSPTHLIRKRGQQVTLRCSPISGHNTVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Papio anubis V898 trbv AHZZ01067653.1 63381 HTGAGVSQSPSNKVTEKGKDVVLRCDPISGHAVLYWYRQNLGQGLEFLIYFQGKGAVDDSGLCSDRFSATRPEGSASTLKIQHTEQGDSAMYFCASSL
Papio anubis V899 trbv AHZZ01067653.1 58331 SVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQTPGQGPQFIFEYANELRTSEGNFPHRFSGRQFRDYHSEMNVSALELGDSALYLCASSL
Papio anubis V900 trbv AHZZ01067653.1 55658 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSL
Papio anubis V901 trbv AHZZ01067653.1 47649 HRDAEITQSPRHKITETGRKVTLTCHQTWNHNNMFWYQQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSKTEDFPLTLESAASSQTSVYFCASSE
Papio anubis V902 trbv AHZZ01067653.1 38062 FTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQNKGVVDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Papio anubis V903 trbv AHZZ01067653.1 25471 HRDAEITQSPRHKVTETGRQVTLTCHQTWNHNNMFWYRQDLGHGLRLIYYSAGASIIDKGEVPDGYVVSRSKTEDFPLTLESATRSQTSVYFCASSE
Papio anubis V904 trbv AHZZ01067653.1 16362 LTEAGVAQSPRYKVIEKSQAVTFWCNPVSGHATLYWYRQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Papio anubis V905 trbv AHZZ01067655.1 32736 SLDTAVSQTPKYLVTQTGKNESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKEPILNETVPNRFSPKSPDKAHLNLHIKSVELGDSAVYFCASSQ
Papio anubis V906 trbv AHZZ01067655.1 29312 PMDTGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKEPAENNSVPSRFVPECPDSSLFYLHLRALQPEDSALYLCASSQ
Papio anubis V907 trbv AHZZ01067655.1 17438 LVNAGVTQTPKFQVLKTGQNMTLKCAQDMNHDRMYWYRQDPGMGLRLIHYSAGEGSTEKGEVSNGYNASRLNKKDFLLRLESAAPSQTSMYFCASSE
Papio anubis V908 trbv AHZZ01067655.1 14762 LFSAGPVNAGVTQTPKFQILKTGQNMTLKCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPDGYNASRLNPQNFLLRLESAAPSQTSMYFCASSE
Papio anubis V909 trbv AHZZ01067655.1 11007 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Papio anubis V910 trbv AHZZ01067656.1 32611 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFVNDEISDKSEMFDDRFSVGRSDGSNFTLKIKSTKLEDSAMYFCASSE
Papio anubis V911 trbv AHZZ01067656.1 26107 PLDTAVFQTPKYLVTQTGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPDSPDKAHLNLHIKSVELGDSAVYFCASSQ
Papio anubis V912 trbv AHZZ01067656.1 21773 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Papio anubis V913 trbv AHZZ01067656.1 3227 PANADVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSATKDTTDPGEVPDGYSVSRLNKKEFLLKLESAAPSQTSVYFCASSE
Papio anubis V914 trbv AHZZ01067657.1 428 SLDTAVSQTPKYLVTQTGKNESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKELFINETVSNRFSPDSPDKARLILHIKSLELDDSAVYFCASSQ
Papio anubis V915 trbv AHZZ01067659.1 1064 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNGKISEQSEIFDDRFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Papio anubis V921 ighv AHZZ01069458.1 31092 VQCEVQLVESGGGLVQPGASLRLSCEASGFTFGDYAMSWVHQAPGKGLEWVSSISYTGKNIYYADSVKGRFTISRDNAKNSLSLQMNSLKTEDTAVYYCTR
Papio anubis V922 ighv AHZZ01069458.1 25879 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSYISNGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Papio anubis V923 ighv AHZZ01069461.1 39615 VLSQVQLQESGPGLVKPPETLSLTCAVSGGSISDSYYWSWIRQPPGKGLEWIGYIYGGSGSTSYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V977 ighv AHZZ01084887.1 8087 VQCEVQLVESGGGSVQPGASLRLCCAASGFTFSSTRMNWIRQAPGKKLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Papio anubis V978 ighv AHZZ01084887.1 460 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSYWISWVRQMPGKGLEWMGMIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAR
Papio anubis V979 ighv AHZZ01084890.1 35563 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSWMNWVRQAPGKGLEWVARIKSKADGETADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCT
Papio anubis V980 ighv AHZZ01084890.1 16192 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSNYWMYWVRQAPGKGLEWVSAINTGGGSTYYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Papio anubis V981 ighv AHZZ01084892.1 28832 VQCEVKLVESGGGLVQPGGSLRLSCAISGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMNSPRAEDTAVYYCAR
Papio anubis V982 ighv AHZZ01084892.1 19520 VQCEVQLVAYGGGLQQPGGSLRLSCGFTFSDHYMSWIRQAPGKGPEWVGFMRNKANGGTTEYATSVKGRFTISRADSKSMASLQMSSLNTEDTAVYYCAR
Papio anubis V983 ighv AHZZ01084892.1 2863 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMDWVRQAPGKGLEWVSSVSGSSSNTYYPDSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Papio anubis V984 ighv AHZZ01084893.1 8424 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSNYYMDWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Papio anubis V985 ighv AHZZ01084896.1 5045 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTGSWISWVRQMPGKGLEWMGSIYPGDSDTRYNPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAK
Papio anubis V1000 iglv AHZZ01089503.1 23562 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTISSYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGSLRAGKAVLTITGAQPEDEAFYYCALW
Papio anubis V1001 iglv AHZZ01089506.1 87843 SNSQAVVTQEPSMTVFPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPRTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLYYSGA
Papio anubis V1002 iglv AHZZ01089506.1 75450 SWAQSVLTQPPSASEAPGQRVTISCSGSSSNIGSNYVNWYQQLEGKAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLTISGLQSEDEADYYCAAWDNSLNG
Papio anubis V1003 iglv AHZZ01089506.1 62324 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYNTNFKHSWTPARFSGSLVGGKAALILSGAQPEDEAEYYCS
Papio anubis V1004 iglv AHZZ01089506.1 57147 SLSQPVLTQPASLSASPGASARLTCTLSSGINVGSYRIYWYQQKPGSPPRYLLNYYSDSDKDQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Papio anubis V1005 iglv AHZZ01089506.1 46432 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGSKYVSWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSATLAITGLQTGDEADYYCAAWDNSLS
Papio anubis V1006 iglv AHZZ01089506.1 41412 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYYVYWYQQLPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLTITGLQPGDEADYYCGAWDSSLS
Papio anubis V1007 iglv AHZZ01089506.1 35594 SRAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYNVYWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSASLAITGLLPEDEADYYCQSYDSSLS
Papio anubis V1008 iglv AHZZ01089506.1 11530 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Papio anubis V1009 iglv AHZZ01089506.1 6975 SWAQSVLTQPRSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYYNDQRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCTAWDDSLSG
Papio anubis V1010 iglv AHZZ01089507.1 10172 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSGNYPNWFQQKPGQAPRTLIYNTNSKYSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Papio anubis V1011 iglv AHZZ01089507.1 5503 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPPRYLLWYKSDSDKGQGSGVPSRFSGSKDASANTGILRISRLQSEDEADYYCAI
Papio anubis V1012 iglv AHZZ01089507.1 651 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRPEDEADYYCEAWDDSLSG
Papio anubis V1013 iglv AHZZ01089508.1 18975 SLSQPVLTQPPSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNTQEEDESDYHCGA
Papio anubis V1014 iglv AHZZ01089508.1 12173 SLSQPVLTQPTSLSASPGASARLTCTLRSGISVGSYRIFWYQQKPGSPPRYLLWYKSDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCTT
Papio anubis V1015 iglv AHZZ01089508.1 7366 SWAQSVLTQPPSASGAPGQRVTISCSGSSSNIGSNNVYWYQQFPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCAAWDDSLSS
Papio anubis V1018 ighv AHZZ01090491.1 587 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSSISSDSSYIYYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Papio anubis V1019 ighv AHZZ01090492.1 8284 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGEINPKTGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAT
Papio anubis V1020 ighv AHZZ01090492.1 5383 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHCMSWVRQAPGKGPEWVGLIRNKANGGRAEYAASVKGRFTISRDDSKSIASLQMNSLKTGDTAVYYCTR
Papio anubis V1021 ighv AHZZ01090494.1 7922 VLSQVKLQESGPGLVKPSETLSLTCTVSSGSISDSYYWSWIRQAPGKGLEWIGRIYSSGSSTNYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1022 ighv AHZZ01090495.1 14812 AQSQVQLVQSGAEVKKPGASVKLSCKASGFTFISYAISWVRQAPGQGLEWMGEIIPAFGIADYAQKFQGRVTITADTSTSTAYMELSSRRSEDTAVYYCAR
Papio anubis V1032 trav AHZZ01093946.1 7282 VSGQQLNQSPHSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Papio anubis V1036 trav AHZZ01093949.1 70740 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLKKPSAHVSDAAEYFCAAS
Papio anubis V1037 trav AHZZ01093949.1 52928 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLMTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Papio anubis V1038 trav AHZZ01093949.1 33547 VRSQKPVQSPQVVILQEGEDAIINCNSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSRTYFCGAE
Papio anubis V1039 trav AHZZ01093949.1 10156 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQRPSQGPEYVIHGLTSNVNNRIASLTIAEDRKSSTLILHHATLRDAAVYYCILR
Papio anubis V1040 trav AHZZ01093949.1 5440 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLIMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Papio anubis V1041 trav AHZZ01093950.1 3935 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGRVSVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Papio anubis V1042 trdv AHZZ01093953.1 3511 SSVAQKVTQAQSSVSMPVGKAVTLNCQYETSSWSYDLFWYKQPPSKEMIFLIRQGYSEQNARNGRYSVNFQKAASSIALTISALQLEDSATYFCALRE
Papio anubis V1053 ighv AHZZ01096568.1 16312 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSYWNWIRQAPGKGLEWIGRIYSSGSSTNYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1054 ighv AHZZ01096568.1 3200 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSAISSGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Papio anubis V1055 ighv AHZZ01096572.1 1854 VQCEVQLVESGRGLVQPGGSLRLSCAVSGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGRTEYAASVKGRFTISRDDSKSTPSLQMSSLNTEDTAVYYCAR
Papio anubis V1056 ighv AHZZ01096574.1 3144 VQCEVQLVESGGGLAQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGLEWVSSISTGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Papio anubis V1057 ighv AHZZ01096575.1 556 AHSEVQLVQSGAEVRKPGATVKISCKASGYTFTDYYLSWVRQAPGKGLEWMGCVDPEDGEAIYAQKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAR
Papio anubis V1060 trbv AHZZ01097564.1 89021 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Papio anubis V1068 ighv AHZZ01103093.1 20773 VLSQVQLQESGPGLLKPSETLSLTCAISGGSISSSYHYWSWIRQAPGKGLEWIGYISYSGSTNYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1069 ighv AHZZ01103093.1 5884 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYSSGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1070 ighv AHZZ01103094.1 8458 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMGWVRQAPGKGLEWVSAISWSGGSTGYADSVKGRFTISRDNAKNSLYLQMNRLRAEDTALYYCAKD
Papio anubis V1071 ighv AHZZ01103096.1 3262 VLSQVTLKESGPALVKPTQTLTLTCTLSGFSISTSGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTSMDPVDTATYYCARV
Papio anubis V1072 ighv AHZZ01103097.1 8647 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYEMHWVRQAPGKGLEWVSGISTSGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCAKE
Papio anubis V1073 ighv AHZZ01103097.1 4683 VLSQVQLQESGPGVVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYSSGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCA
Papio anubis V1074 ighv AHZZ01103258.1 439 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWNWIRQAPGKGLEWIGSIYSSGSSTNYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1077 igkv AHZZ01104243.1 88093 TTGEIVLTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKSGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISILEPEDVAVYYCQQYYNWN
Papio anubis V1079 iglv AHZZ01105198.1 23882 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Papio anubis V1080 iglv AHZZ01105199.1 18697 SWAQAALTQPPSVSKSLGQSVTISCTGTSNDIGGYNAVSWYQQHPGTAPRLLIYEVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYRSG
Papio anubis V1081 iglv AHZZ01105199.1 6294 SAASYELTQPHSVSVSPGQTARITCGGDNIGSKYVQWYQQKPAQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Papio anubis V1082 iglv AHZZ01105199.1 1811 SVVSSELTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDKSGNH
Papio anubis V1083 iglv AHZZ01105200.1 21871 SVVSSELTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNTNRPSGIPGRFSGSWSGNTGSLTITAAQVEDEADYYCGSWDNSGNH
Papio anubis V1084 iglv AHZZ01105200.1 5471 SAASYELTQPGSVSVSPRQTARITCGGDNIGSKSVHWYQQKPGQAPVLVIYNDSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKY
Papio anubis V1085 iglv AHZZ01105200.1 998 SVVSSELTQSCMSVPGTYSQDDCQGDSLKTYYASWYQQKQARSLCWSSMVTTTGPQGSPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDSSGNH
Papio anubis V1087 iglv AHZZ01105201.1 23307 SVASYELTQPPSVSVSPGQTARITCSGDALPKNYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCYSGDGNS
Papio anubis V1088 iglv AHZZ01105201.1 14136 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Papio anubis V1089 iglv AHZZ01105201.1 1932 SAASYELTQPPSVSVSPGQTARITCGGDNIGSEAVHWYQQKPPQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDISNDH
Papio anubis V1095 igkv AHZZ01106331.1 69142 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYDASNLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Papio anubis V1096 igkv AHZZ01106331.1 63070 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSAP
Papio anubis V1097 igkv AHZZ01106331.1 46098 ARCDIQMTQSPSSLSASAGDRVTITCRASQGISTYLNWYQQKPGKAPTRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSAP
Papio anubis V1098 igkv AHZZ01106331.1 35621 SDTTGETVMTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLVYYASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYYCQKYNDWP
Papio anubis V1101 trbv AHZZ01107345.1 2650 PIDSGITQTPKHLVIGMTNKKSLKCEQHMGHRAVYWYKQKAKKPPEIMFMYNYETLSINESVPSRFSPECSKSSLLHLHLQALQPEDSALYLCASSQ
Papio anubis V1102 trbv AHZZ01107346.1 14046 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVYFYNDNISEKSEIFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Papio anubis V1103 trbv AHZZ01107346.1 7085 SLDTAVSQTPKYLVTQTGKKESLKCEQNLGHDAMYWYKQDSKKLLKIMFSYNNKELIINETVPNRISPDSPDKAHLNLHIKSVELGDSAVYFCASSQ
Papio anubis V1104 igkv AHZZ01107395.1 553 TTGEIVMTQSPATLSLSPGERATLSCRASQSVNSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYFCLQSSNW
Papio anubis V1105 igkv AHZZ01107399.1 688 AKCDIQMTQSPPSLSASVGDRVTITCQASQGISNWLAWYQQKPGEAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSYP
Papio anubis V1108 ighv AHZZ01108758.1 10458 VLSQVQLQESGPGVVKPSETLSLTCAVYGGSVSGSYWSWIRQAPGKGLEWIGEINGNSGSTSYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCA
Papio anubis V1112 igkv AHZZ01110488.1 897 ARCDIQMTQSPSSLSASVGDKVTITCHASQSISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYDSNH
Papio anubis V1114 igkv AHZZ01111138.1 20318 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLSWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSSP
Papio anubis V1115 igkv AHZZ01111138.1 18238 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGEAPRLLIYDASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Papio anubis V1116 igkv AHZZ01111138.1 7553 ARCDIQMTQSPPSLSASVGDRVTITCQASQSISNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQRHNSYP
Papio anubis V1120 igkv AHZZ01111367.1 14916 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLSWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSSP
Papio anubis V1121 igkv AHZZ01111367.1 12836 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGEAPRLLIYDASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Papio anubis V1122 igkv AHZZ01111367.1 2024 ARCDIQMTQSPPSLSASVGDRVTITCQASQGISNYLAWYQQKPGKAPKLLIYAASTLQSGVASRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSYP
Papio anubis V1123 ighv AHZZ01112481.1 392 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISSSYWSWIRQPPGKGLEWIGYIYGGGSTNYNPSLKSRVTMSADTSKNQLSLKLSSVTAADTAVYYCAR
Papio anubis V1133 ighv AHZZ01125719.1 27532 VQCEVQLVESGGGLVQPGGSLRVSCAASGFTFSNHYMQWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCAR
Papio anubis V1134 ighv AHZZ01125719.1 10058 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSSYEMHWVRQAPGKGLESVSVISGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Papio anubis V1135 ighv AHZZ01125719.1 3778 AHAQVQLVQSGPEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDSGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Papio anubis V1144 ighv AHZZ01181503.1 5011 AHAQVQLVQSGPEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDSGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Papio anubis V1146 igkv AHZZ01185532.1 369 TTGETVVTQSPATLSLSPGERATISCRTSQSVGSRLAWYQQKPGQAPRLLIYGASNRATGIPDRFSGSGSGTDFTLTISSLKPEDAAVYYCQQDNDWK
Papio anubis V1152 igkv AHZZ01189918.1 15257 ARCDIQMTQSPSSRSASVGDTVTITCQASQGISDYLAWYQQKPGKAPKLLIYAASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYDSDP
Papio anubis V1153 igkv AHZZ01189922.1 6953 TTGEIVMTQSPATLSLSLGETATISCRTSQSVGSKLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQETSNLS
Papio anubis V1154 igkv AHZZ01189923.1 14669 ARCDIQMTLSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYYATSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFKSYP
Papio anubis V1181 iglv AHZZ01198546.1 38609 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPQYIMKVNSDGTHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Papio anubis V1182 iglv AHZZ01198547.1 1493 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYTIEWYQQRPGRSPRYIMKVNSDGTHSKGDEIPDRFLGSSSGVDRYLTISNLQSDDEAEYYCGE
Papio anubis V1183 iglv AHZZ01198550.1 34339 SVASYELTQPLSVSVALGQMARITCGGNNIGRKNVYWYQQKPVQAPVPVIYEDSKRPSGIPKRFSGSNSGNTATLTIDGAQAGDEADYYCQVWDS
Papio anubis V1184 iglv AHZZ01198550.1 30975 SWAQAALTQPHSVSGSPGQSVTISCTGTSSDIGGYDRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Papio anubis V1185 iglv AHZZ01198550.1 6642 SWAQSALIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYRQQPGTTTKLMMYNVNTRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Papio anubis V1186 iglv AHZZ01198551.1 25704 SWAQSAPTQPPSVSGSPGQSVTISCTGTSSDIGYYNAVSWYQQHPGTAPKLMIYRVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Papio anubis V1187 iglv AHZZ01198551.1 2187 SAASYELTQPPSVSVSPGQMARITCSGDALPEKYADWYQQKPGQSPVLIIYEDSKWPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Papio anubis V1188 iglv AHZZ01198553.1 64071 SVVSSELTQDPAVSVALGQTVRITCQGDSLSSYYASWYQQKPGQAPVLVIYGNNNRPSGIPERFSVSWSGNTGSLTITGAQVEDEADYYCGSWDSSGNH
Papio anubis V1189 iglv AHZZ01198553.1 45581 SWAQAALTQPPSVSKSLGQSVTISCAGTSSGIASYSDVSWYQQHPGTAPRLLIYSVSNRPSGVSDRFSGFKSGSTASLTISGLQAEDEAIYYCCSYRSG
Papio anubis V1190 iglv AHZZ01198553.1 37743 SEASYELIQPPSVSVSPGQTARITCSGDALPDYYAYWYQQKSGQAPMLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGNH
Papio anubis V1191 iglv AHZZ01198553.1 20640 SATSYELTQPPSVSAASGQTARITCGGDSIGSKNVQWYQQKPAQAPVLVIYADSKRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKH
Papio anubis V1192 iglv AHZZ01198553.1 8508 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYASS
Papio anubis V509 trav AHZZ02031769.1 27807 VWSQQKVEQSSGPLSVPEGAIASLNCTYSDSGSQSFFWYRQYSGQSPELLMSTYSSGDKEDGRFTAQLNRASQYVSLLIRDSQLSDSATYLCAV
Papio anubis V10 iglv AHZZ02000944.1 5375 VDSETVVTQEPSLSVSSGGTVTLTCGLSSGSVSTSNYPSWYQQTPGQAPRTLIYRTNTRPSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYMGSGI
Papio anubis V11 iglv AHZZ02000946.1 77680 PVVQAGLTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLSA
Papio anubis V12 iglv AHZZ02000946.1 88064 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSKYVQWYQQRPGSAPTTVIYEDNKRPSGVPDRFSGSIDSSSNSASLTISGLNSEDEADYYCQSADGSYN
Papio anubis V13 iglv AHZZ02000946.1 128338 SLSQPVLTQPPSLSASQGASARLSCTLSSGFSADLYWIYWYQHKPGSPPRYLLSLYQNSLHDLGSGVPRRVSGLMEGWSNKGLLLISDLQPEDEADYYCMT
Papio anubis V14 iglv AHZZ02000949.1 12158 SLSQPVLTQSPSASASLGASVKLTCTLSSGHSSYTIAWHQQQQGKAPRYLMWLKSDGSHSKADGIPDRFSGSSSGAERYLTISNLQSEDEADYYCQTWTTD
Papio anubis V15 iglv AHZZ02000958.1 6346 SWAEVVFTQPHSVSGSPGQTVTISCTRSSGSIDSKYVQWYQQRPGSAPTTVIYNDDQRPSGVPDRFSGSIDSSSNSASLTISGLKSEDEADYYCQSADSSS
Papio anubis V16 iglv AHZZ02000960.1 23725 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYDTSNKLSWTPAQFSGSLLGGKAALTLSGAQPEDEAEYYCW
Papio anubis V17 iglv AHZZ02000960.1 33051 SWAQSVLTQPPSVSAAPGQRVTISCSGSSSNIGRYYVSWYQQLPGAAPKLLIYDVNKRPSGVPDRFSGSQSGTSTTLGITGLRPEDEADYYCLAWDNSLS
Papio anubis V18 iglv AHZZ02000960.1 38400 SWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYYVSWYQQLPGTAPKLLIYENNKRPSGVSDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLS
Papio anubis V19 iglv AHZZ02000961.1 5642 SLSQPVLTQPPSASASLGASVTLTCTLSSGYSNYAVDWHQQRPGKGPQFVMRVGTGGIVGSKGDGIPDRFSGSGSGLNRYLTIKNTQEEDESDYHCGA
Papio anubis V20 iglv AHZZ02000961.1 12441 SLSQPVLTQPTSLSASPGASARLTCTLRSGISVGSYRIFWYQQKPGSPPRYLLWYKSDSDKHQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCTT
Papio anubis V21 iglv AHZZ02000961.1 17248 SWAQSVLTQPPSASGAPGQRVTISCSGSSSNIGSNNVYWYQQFPGTAPKLLIYYSNQRPSGVPDRFSGSKSGTSASLAITGLRSEDEADYYCAAWDDSLSS
Papio anubis V22 iglv AHZZ02000961.1 30634 SNSQAVVTQEPSMTVSPGGTVTLTCASSTGAVTSGNYPNWFQQKPGQAPRTLIYNTNSKYSWTPARFSGSLAGGKAALTLSGAQPEDEAEYYCLLYYSGA
Papio anubis V23 iglv AHZZ02000961.1 35303 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPPRYLLWYKSDSDKGQGSGVPSRFSGSKDASANTGILRISRLQSEDEADYYCAI
Papio anubis V24 iglv AHZZ02000961.1 40155 SWAQSVLTQPPSASGAPGQSVTISCSGSSSNIRGNGVHWYQQLSGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAITGLRPEDEADYYCEAWDDSLSG
Papio anubis V25 iglv AHZZ02000961.1 49196 SNSQAVVTQEPSMTVFPGGTVTLTCASSTGAVTSGHSPHWFQQKPGQAPRTLIYNTNYKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCWLYYSGA
Papio anubis V26 iglv AHZZ02000961.1 56757 SVSQPVLTQPTSLSASPGASVRLTCTLRSGISVGGYNIHWYQQKPGSPPRYLLYYYSDSNKGQGSGVPSRFSGSKDASANAGILLISGFQSEDEADYYCTT
Papio anubis V27 iglv AHZZ02000961.1 61587 SWAQSVLTQPPSASEAPGQRVTISCSGSSSNIGSNYVNWYQQLEGKAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLTISGLQSEDEADYYCAAWDNSLNG
Papio anubis V28 iglv AHZZ02000961.1 74713 SNSQAVVTQEPSLTVSPGGTVTLTCGSSAGAVTGSHYPYWFQQKPGQAPRTLIYNTNFKHSWTPARFSGSLVGGKAALILSGAQPEDEAEYYCS
Papio anubis V29 iglv AHZZ02000961.1 79893 SLSQPVLTQPASLSASPGASARLTCTLSSGINVGSYRIYWYQQKPGSPPRYLLNYYSDSDKDQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCAI
Papio anubis V30 iglv AHZZ02000961.1 90597 SWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGSKYVSWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSATLAITGLQTGDEADYYCAAWDNSLS
Papio anubis V31 iglv AHZZ02000961.1 95617 SWAQSVLTQPPSVSGDPGQRVTISCTGSSSNIGGYYVYWYQQLPGTAPKLLIYDNNKRPSGVSDRFSGSKSGTSASLTITGLQPGDEADYYCGAWDSSLS
Papio anubis V32 iglv AHZZ02000961.1 101435 SRAQSVLTQPPSVSGAPGQKVTISCTGSSSNIGGYNVYWYQQLPGTAPKLLIYDNNKRPSGISDRFSGSKSGTSASLAITGLLPEDEADYYCQSYDSSLS
Papio anubis V33 iglv AHZZ02000961.1 125493 SLSQPVLTQPASLSASPGASASLTCTFSGGINVAGYYIYWYQQKPGSPPRYLLRYKSDSDKGQGSGVPSRFSGSKDASANTGILRISGLQSEDEADYYCAI
Papio anubis V34 iglv AHZZ02000961.1 130048 SWAQSVLTQPRSASEAARKSVTISCSGSSSNIGSNSVSWYQQLPGTAPKLLIYYNDQRASGVSDRFSGSKSGTSASLAISGLQTEDEADYYCTAWDDSLSG
Papio anubis V35 iglv AHZZ02000961.1 183451 LTSQAEVIQETSRTTNPGETITLTCGSSAGAVTISSYADWFQQKPNQVPRGLIGDNTYRNPNVPERFSGSLRAGKAVLTITGAQPEDEAFYYCALW
Papio anubis V36 iglv AHZZ02000963.1 13431 SVVSSELTQDPAVSVALGQTVRITCQGDSLSSYYASWYQQKPGQAPVLVIYGNNNRPSGIPERFSVSWSGNTGSLTITGAQVEDEADYYCGSWDSSGNH
Papio anubis V37 iglv AHZZ02000963.1 31919 SWAQAALTQPPSVSKSLGQSVTISCAGTSSGIASYSDVSWYQQHPGTAPRLLIYSVSNRPSGVSDRFSGFKSGSTASLTISGLQAEDEAIYYCCSYRSG
Papio anubis V38 iglv AHZZ02000963.1 39757 SEASYELIQPPSVSVSPGQTARITCSGDALPDYYAYWYQQKSGQAPMLVIYKDSERPSGIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSADSSGNH
Papio anubis V39 iglv AHZZ02000963.1 56862 SATSYELTQPPSVSAASGQTARITCGGDSIGSKNVQWYQQKPAQAPVLVIYADSKRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKH
Papio anubis V40 iglv AHZZ02000963.1 68994 SWAQAALTQPPSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYASS
Papio anubis V41 iglv AHZZ02000964.1 10420 SWAQSAPTQPPSVSGSPGQSVTISCTGTSSDIGYYNAVSWYQQHPGTAPKLMIYRVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Papio anubis V42 iglv AHZZ02000964.1 33936 SAASYELTQPPSVSVSPGQMARITCSGDALPEKYADWYQQKPGQSPVLIIYEDSKWPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH
Papio anubis V43 iglv AHZZ02000965.1 4767 SVASYELTQPLSVSVALGQMARITCGGNNIGRKNVYWYQQKPVQAPVPVIYEDSKRPSGIPKRFSGSNSGNTATLTIDGAQAGDEADYYCQVWDS
Papio anubis V44 iglv AHZZ02000965.1 8131 SWAQAALTQPHSVSGSPGQSVTISCTGTSSDIGGYDRVSWYQQHPGKAPKLMIYEVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Papio anubis V45 iglv AHZZ02000965.1 32465 SWAQSALIQSPSVSGSLGQSVTISCTGTSSDIGRYNYVSWYRQQPGTTTKLMMYNVNTRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYEAS
Papio anubis V46 iglv AHZZ02000966.1 471 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYTIEWYQQRPGRSPRYIMKVNSDGTHSKGDEIPDRFLGSSSGVDRYLTISNLQSDDEAEYYCGE
Papio anubis V47 iglv AHZZ02000967.1 10652 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIIWYQQRPGRSPQYIMKVNSDGTHSKGDGIPDRFLGSSSGADRYLTISNLQSDDEAEYYCGE
Papio anubis V115 igkv AHZZ02005852.1 94409 ACGDIVMTQSPDSLAVSLGERVTINCKSSQSLLYSSNNKNYLAWYQQKPGQTPKLLISWASTRESGVPNRFSGSGSGTDFTLTISGLQAEDVAVYYCQQHYSSP
Papio anubis V116 igkv AHZZ02005852.1 146674 AREETILTQSPAFVSATPGDKVTISCRAGQDIDDDMNWYQQEPGEAPKLIIKDATTLVSGIPPQFSGSGYGIDFTLTINSMKSEDTAYYFCQQRDN
Papio anubis V117 igkv AHZZ02005852.1 157914 AKCDIQMTQSPTFLSASVGDRVTIACRASQSIHKGLAWYQQKPGKAPKLLISYASNLYTGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCFQYNSYP
Papio anubis V118 igkv AHZZ02005852.1 186272 SSGDTVMTQTPLSLPVTGPASISCRSSQSLPYGNGVNYLNWYLQKPDQPPQLLIYLGSSHFPGVPDRFTVSGSDTDFTLQISRVKAEDVGVYYCMQCLQL
Papio anubis V119 igkv AHZZ02005852.1 204679 TTGQVILTQSPATLSLSPGERATLSCRASQSVSNYLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYHCYQYYSGY
Papio anubis V120 igkv AHZZ02005852.1 213599 ARAETILTQSAAFVSATPGDKVTISCKASQDIDDDMNWYQLEPGEAPKLIIKDATTLVSGIPPRFSGSGYGTDFTLTINNVESEDAAYYFCLQHDNFP
Papio anubis V121 igkv AHZZ02005879.1 7683 TTGEIVLTQSPATLSLSPGERATLSCRASQSVSSSLAWYQQKSGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISILEPEDVAVYYCQQYYNWN
Papio anubis V122 igkv AHZZ02006119.1 111354 TSGDIVMTQTPLSLPVTPGEPASISCRSSQSLFNSDYANTYLDWYLQKPGQSPQLLIYMLSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIEYP
Papio anubis V123 igkv AHZZ02006120.1 2612 ARCAIQMTQSPSSPSATVGDRVTTTCRVSQSINNNLAWYQQKPGKTPKLLICEASSLQSGIPSRFSGSGSGTDFTLTISSLQSEDVATYFCQHGYSYP
Papio anubis V124 igkv AHZZ02006120.1 35344 ARCDIQMTQSPSSLSASVGDRVTITCRASQGINKELDWYQQKPGKAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYTTP
Papio anubis V331 trgv AHZZ02022743.1 133516 SQKSSNLEGKTKSITGPTGSPAEITCDLPGVSTLYIHWYLHQEGKAPQRLLYYEPYYFTVVLESGISPGKYDTASTRKSWNLRLQNLIENDSGIYYCATWD
Papio anubis V332 trgv AHZZ02022743.1 138535 SQKSSNLEGRTKSVTRPTGSSAEITCDLPEVSSFYIHWYLHQEGKAPQRLLYYDSSNSRVVLESGISPGKYDTYGSTRRRNLRLILRNLIENDSGVYYCANWD
Papio anubis V333 trgv AHZZ02022744.1 14582 HLEQPQISSTKMLSKTARLECVVSGVTISETSIYWYRERPGEVIQFLVCIFYDGTVKKESSIPSGKFEVDRIPKTSTSTLTIHNVEKQDIATYYCALWD
Papio anubis V334 trgv AHZZ02022745.1 14641 EQFQLSISTEVKKSIDISCKIRSTNFENDVIHWYWQKPNQALEHLIYIISTKSAVHGSMGKRSNKVEARKNSQTLTSILTIKSVEKEDMAIYYCAGWD
Papio anubis V335 trgv AHZZ02022747.1 11846 TCGDNLITQLVTSVTKKKGNTAFLECQIKSSTFKKNVCIHWYHQKPDQPLKRILYISSNENVVHEQGVSEERYEARKWQSDLSSSLRIHRVAEEDAGIYYCACW
Papio anubis V336 trgv AHZZ02022747.1 13852 GDTKMRISQDQLSSTRRQDRTVHIRCKLSGVLLKKTVVHWYQQKEGKPLRRILYGSAKNYKQDRPNPRLEADDKHDGIFYLIINNVAKLDEATYYCACWD
Papio anubis V344 trbv AHZZ02023761.1 166569 HTEPEVTQTPSHQVTQMGQEVILRCVPIPNHLNFYWYRQILGQKVEFLVYFYNDNISEKSEIFDDRFSVERPDGSNFTLKIKSTKLEDSAMYFCASSE
Papio anubis V345 trbv AHZZ02023761.1 173528 SLDTAVSQTPKYLVTQTGKKESLKCEQNLGHDAMYWYKQDSKKLLKIMFSYNNKELIINETVPNRISPDSPDKAHLNLHIKSVELGDSAVYFCASSQ
Papio anubis V346 trbv AHZZ02023762.1 268 PIDSGITQTPKHLVIGMTNKKSLKCEQHMGHRAVYWYKQKAKKPPEIMFMYNYETLSINESVPSRFSPECSKSSLLHLHLQALQPEDSALYLCASSQ
Papio anubis V347 trbv AHZZ02023765.1 1936 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNGKISEQSEIFDDRFSVGRSDGVHFTLKIKSTKLEDSAMYFCASSE
Papio anubis V348 trbv AHZZ02023765.1 9517 SLDTAVSQTPKYLVTQTGKNESLKCEQNLGHDTMYWYKQDSKKLLKIMFSYNNKELFINETVSNRFSPDSPDKARLILHIKSLELDDSAVYFCASSQ
Papio anubis V349 trbv AHZZ02023765.1 18058 HTEPEVTQTPSHQVTQMGQEVILRCVPISNHFYFYWYRQILGQKVEFLVSFVNDEISDKSEMFDDRFSVGRSDGSNFTLKIKSTKLEDSAMYFCASSE
Papio anubis V350 trbv AHZZ02023765.1 24562 PLDTAVFQTPKYLVTQTGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYSNKEPILNETVPNRFSPDSPDKAHLNLHIKSVELGDSAVYFCASSQ
Papio anubis V351 trbv AHZZ02023765.1 28895 PTDTGVTQTPKHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNYEKLSINESVPSRFSPECSKSSLLYLHLRALQPEDSALYLCASSQ
Papio anubis V352 trbv AHZZ02023765.1 47444 PANADVTQSPKFQILKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIHYSATKDTTDPGEVPDGYSVSRLNKKEFLLKLESAAPSQTSVYFCASSE
Papio anubis V353 trbv AHZZ02023765.1 61676 SLDTAVSQTPKYVVTQTGKNESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKEPILNETVPNRFSPKSPDKAHLNLHIKSVELGDSAVYFCASSQ
Papio anubis V354 trbv AHZZ02023765.1 65100 PMDTGVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQKAKKPPELMFIYNFKEPAENNSVPSRFVPECPDSSLFYLHLRALQPEDSALYLCASSQ
Papio anubis V355 trbv AHZZ02023765.1 76974 LVNAGVTQTPKFQVLKTGQNMTLKCAQDMNHDRMYWYRQDPGMGLRLIHYSAGEGSTEKGEVSNGYNASRLNKKDFLLRLESAAPSQTSMYFCASSE
Papio anubis V356 trbv AHZZ02023765.1 79650 LFSAGPVNAGVTQTPKFQILKTGQNMTLKCAQDMNHNYMYWYRQDPGMGLRLIHYSAGEGSTEKGEVPDGYNASRLNPQNFLLRLESAAPSQTSMYFCASSE
Papio anubis V357 trbv AHZZ02023765.1 83406 HTGAGVSQSPRNKVTEEGKDVVLRCDPISGHTALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSGRFSAERTEGSVSTLKIQRTEQGDSAVYLCASSL
Papio anubis V358 trbv AHZZ02023766.1 5342 HTGAGVSQSPSNKVTEKGKDVVLRCDPISGHAVLYWYRQNLGQGLEFLIYFQGKGAVDDSGLCSDRFSATRPEGSASTLKIQHTEQGDSAMYFCASSL
Papio anubis V359 trbv AHZZ02023766.1 10392 SVDTGVTQSPTHLIKTRGQQVTLRCSPISGHNTVSWYQQTPGQGPQFIFEYANELRTSEGNFPHRFSGRQFRDYHSEMNVSALELGDSALYLCASSL
Papio anubis V360 trbv AHZZ02023766.1 13065 SVDCGVTQTPKHLITAIGQQVTLRCSPRSGDLSVYWYQQSLGQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSL
Papio anubis V361 trbv AHZZ02023766.1 21071 HRDAEITQSPRHKITETGRKVTLTCHQTWNHNNMFWYQQDLGHGLRLIHYSYGVPDTNKGEVPDGYSVSRSKTEDFPLTLESAASSQTSVYFCASSE
Papio anubis V362 trbv AHZZ02023766.1 30651 FTEAGVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVRFQNKGVVDDSQLPKDRFSAERLKGVDSTLRIQPAELGDSAVYLCASSL
Papio anubis V363 trbv AHZZ02023766.1 43242 HRDAEITQSPRHKVTETGRQVTLTCHQTWNHNNMFWYRQDLGHGLRLIYYSAGASIIDKGEVPDGYVVSRSKTEDFPLTLESATRSQTSVYFCASSE
Papio anubis V364 trbv AHZZ02023766.1 52352 LTEAGVAQSPRYKVIEKSQAVTFWCNPVSGHATLYWYRQILGQGPELLVQFRNNDVVDDSQLPKDRFSAERLKGVNSTLKIQPAELGDSAVYLCASSL
Papio anubis V365 trbv AHZZ02023766.1 69575 PVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDCMYWYRQDPGMGLRLIHYSVGEGSTDKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSY
Papio anubis V366 trbv AHZZ02023766.1 74105 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQAPGQGPEFLTYFQNDAQRDKSGLPNDRFSAERTEGSVSTLKIQRTEQADSAVYLCASSL
Papio anubis V367 trbv AHZZ02023766.1 82015 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGLQFILWYDEEEERGRGTFPHRFSGHQFPNYSSELNVNASEVGDSALYLCASSL
Papio anubis V368 trbv AHZZ02023766.1 93397 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHVALYWYQQALGQGPEFLTYFQNDAQPDKSGLPSDRFSAERPEGSVSTLKIQRTQQGDAAVYLCASSL
Papio anubis V369 trbv AHZZ02023766.1 103883 SVDGGVTQSPRHLIKTTGQQVTLRCSPISGHTSVSWYQQALGQGPQFIFEYYEEKERERGNFPDRFSGHQFPNYSSELNVNALEAGDSALYLCASSL
Papio anubis V370 trbv AHZZ02023766.1 107192 LVNAGVTQTPKFQVLKTGQSMTVQCAQDMNYNFMYWYRQDPGVGLRLIHYSGAAGTTDKGEVPSGYNVSRLNTEIFPLRLESAAPSQTSVYICASSY
Papio anubis V371 trbv AHZZ02023766.1 111769 HTGARVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFSYEAQQDKSGLPSDRFSAERPEGSVSTLKIQRTQQWDSAMYLCASSL
Papio anubis V372 trbv AHZZ02023766.1 122069 SVDAGVTQSPTHLIRKRGQQVTLRCSPISGHNTVSWYQQALGQGPQFIFQYYEKEERGRGNFPDRFSGHQFPNYSSELNVNASEMGDSALYLCASSL
Papio anubis V373 trbv AHZZ02023766.1 133636 HTGAGVSQSPRYKVTKRGQDVALRCDPISGHDYLYWYQQALGQGPELLTYFNYEAQQDKSGLPNDRFSADRPEGSVSTLKIQRTEQRDSAVYLCASSL
Papio anubis V374 trbv AHZZ02023766.1 138689 PVDAGVTQSPTHLIKMRGQQVTLRCSPISGHTSVSWYQQALGQGPQLIFEYDRKEERVRGNFLDRFSGRQFPNYSSELNVNASEMGDSALYLCASSL
Papio anubis V375 trbv AHZZ02023766.1 145299 LFSAGPGNAGVTQTPKFQILKTGQSMTLQCAQDMNHNYMSWYRQDPGVGLRLIHYSVGAGVTDKGEVSNGYNVSRLNTEDFPLSLESAASSQTSVYFCASSY
Papio anubis V376 trbv AHZZ02023766.1 151197 HTGAGVSQFPRYRVTKRGQDVTLRCDPISGHEYLSWYQQAPGQGPEFLTYFQNDAQLDKSGLPSDRFSAARPEGSVSTLKIQRTEQGDSAVYLCASSL
Papio anubis V377 trbv AHZZ02023766.1 159984 PVEPGVTQSPTHLIKTRGQQVILRCSPISGHSSVYWYQQALGQGPQFIFEYCQKEERGRGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Papio anubis V378 trbv AHZZ02023766.1 179903 PVDAGVTQSPTHLIKTRGQQVTLRCSPISGHTSVYWYQQALGQGPQFIFQYYEKEERERGNFPDRFSGRQFPNYSSELNVSALLLGDSALYLCASSL
Papio anubis V379 trbv AHZZ02023766.1 187199 PVNADVTQTPKFRVLKTGQSMIVQCAQDMKHDYMFWYRQDPGMGLRLIYYSVTAGITTKGEVPNGYNVSRINTEDFLLRLESAALSQTSVYFCASSY
Papio anubis V380 trbv AHZZ02023766.1 191500 HTGAGVSQSPRYKVIKKGQDVALRCDPISGHAALYWYQQALGQGPEFLTYFNYQAQPDKSGLPNDRFSAERSEGSVSTLTIQRTEQQDSAVYLCASSL
Papio anubis V381 trbv AHZZ02023766.1 200267 PVIAGVAQSPTHLIKTRGQQVTLRCSPISGHNTVYWYQQALGQGPQLIFQYYRGEDRGRGNFPERFSGHQFPNYSSELNVSALLLGDSALYLCASSL
Papio anubis V382 trbv AHZZ02023766.1 209239 HAEAGVSQDPRHKITKTGQNVSFKCVPISEHNRLYWYRQTLGQGPEFLTYFQNEAQQDRSGLFSDRFSAERPEGSISTLMIQHTEQGDSAVYLCASSL
Papio anubis V383 trbv AHZZ02023766.1 215706 SVAAGVTQSPRHLIKEKRETATLQCYPIPEHDTVYWYQQGPGQGPQFLISFYEKMQRDKGSIPDRFSAQQFSDYHSEVNMSSLELGDSAVYLCASSL
Papio anubis V384 trbv AHZZ02023766.1 224128 HMDAGITQSPRHKITETGTPVTLRCHQTENHRYMYWYRQDLGNGLRLIHYSYGVEDTDKVEISDGYSVSRSKTEDFLLTLESATRSQTSVYFCASSE
Papio anubis V385 trbv AHZZ02023766.1 235470 LTEAGVTQSPRYKITEKKQPVAFWCNPISGHNTLYWYRQNLGQGPELLIRYENEEAVDDSRFPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL
Papio anubis V386 trbv AHZZ02023766.1 241225 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHSSLFWYRQSMMRGLEFLIYFNNKSPIDDSGMPKDRFSATMPNASFSTLKIQPSEPRDSAMYFCASSL
Papio anubis V387 trbv AHZZ02023766.1 244508 HTDAGVIQSPRHEVTEMGKEVTLRCEPISGHTYLFWYRQSMMQGLEFLIYFNDKSPIDDSGMPKDRFSATMPNASFSTLKIQPSEPRDSAVYFCASSL
Papio anubis V388 trbv AHZZ02023766.1 259908 LIDAGVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTVMQGLELLVYLRNKASLDDSGMPKDRFSAEMPDASLATLKIQPSEPRDSAVYLCASGL
Papio anubis V389 trbv AHZZ02023766.1 266853 HTEAGVTQFPSHRVIEKGQTVTLRCDPISGHDYLYWYRRVMGKEIKFLIYFMRASVQDESGMPNKRFSAERTGGTYSTLKVQPAELEDSGVYFCASSQ
Papio anubis V390 trbv AHZZ02023766.1 271961 HGDVMVIQNPRYQVTQLEKPVTLSCSQNLNHKVMYWYQQKPSQAPKLLFHYYDKDFNNEADTPDNFQSRRPNTSFCFLDIRSPGLEDAAVYLCASSK
Papio anubis V391 trbv AHZZ02023766.1 276935 SPGEEVTQTPKHLVKGEGQKAKLYCDPIKGHSYVFWYQQVLRKEFKFLISFQNKNVFDETGMPKERFSAKCPANSPCSLEIQATKLKDSAVYFCASSQ
Papio anubis V392 trbv AHZZ02023766.1 297346 TVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDIQNGDIAEGYSVSRDRKESFPLTVTSAQRNPTAFYLCASSI
Papio anubis V393 trbv AHZZ02023766.1 305585 GSGLAAVVSQYPSRFICKRGTSVKIECRCLDFQATTMFWYRQFQKQSLILMATSNEGSDVTYEQGVKQDKFPINHPNLTFSTLTVTNAHPEDSSFYICSAR
Papio anubis V394 trbv AHZZ02023766.1 315693 SADTKVTQRPRLLVKANEQKAKMDCVPVKGHSYVYWYRKKLDEELKFLVYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDAALYFCASSK
Papio anubis V395 trbv AHZZ02023766.1 324602 SFHAEVTQTPGYLVKGKGQKTKIDCTPEKGHTYVYWYQQNQNKEFTFLISFQDEQVLQETELHKKRFSSQCPKNLPCSLEIPSSEPGDTALYLCASSQ
Papio anubis V396 trbv AHZZ02023766.1 336777 SMDADVTQTPRNSIAKTGKRIMLECSQTKGHDQMYWYRQDPGLGLRLIFYSFDVEDINKGEISDGYSASRQEQAKFSLSLESATPNQTALYFCATSD
Papio anubis V397 trbv AHZZ02023767.1 4312 LMEADIYQNPRHRVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTERGDFSSESTVSRIRIEHFPLTLESTSPSHTSQYLCASSE
Papio anubis V398 trbv AHZZ02023767.1 40354 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHDYMSWYRQDPGLGLRQIYYSSNVELVDKGDIPEGYNVSRKEKRNFPLILESPSPSQTSLYFCASSL
Papio anubis V399 trbv AHZZ02023767.1 45676 LVDVKVTQSSRYLIKRTGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDVKVNEKGDIPEGYSVSREKKERFSLILGSASTNQTSMYLCASSL
Papio anubis V400 trbv AHZZ02023767.1 59181 SVFSAVVSQKPSRDVCQRGTSVTIQCQVDSQLTMMFWYRQQPGLSMTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNTNPEDSSIYLCSVE
Papio anubis V499 trav AHZZ02031760.1 1453 TAGQSLEQPSEVTAVEGAIVQINCTYQTSRFDGLSWYQQRDGGAPTFLSYNALDGLEERGHFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR
Papio anubis V500 trav AHZZ02031760.1 18845 MCLVLVTTGQNIDQPTEMTAMEGAIVQINCTYQTSGFNGLSWYQQHDGEAPTLLSYNVLDGLEEKGRFSSFLSNSKRYSYLLLKELQVKDSASYLCAVR
Papio anubis V501 trav AHZZ02031766.1 5490 GLRAQLVTQPEDQVTVAERNPLTVKCTYSVSGNPYLFWYVQYPNQGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVR
Papio anubis V502 trav AHZZ02031766.1 17828 TLSLAKTTQPISMDSYEGQEVNITCNHNDIATSDYIMWYQQFPNQGPRFIIQGYKANIENEVASLFIPTDRKSSTLSLPRVALSDTAVYYCLVG
Papio anubis V503 trav AHZZ02031767.1 10233 MSRGEDVEQSLFLSVREGDISVINCTYTDSSSTYLYWYKQEPGAGLQLLTYILSNMDLKRDQRVTVLLNKKDKHLSLRIADTQTEDSAIYFCAES
Papio anubis V504 trav AHZZ02031767.1 20142 VKSQKIEQNSEALNIQEGKTATLTCNYTNYSPSYLQWYRQDPGRGPVFLLLIRENEKEKWKERLKVTFDTTLKQSLFHITASQPADSATYLCAL
Papio anubis V505 trav AHZZ02031767.1 71139 GSGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGKGPISLTIMTFSENTKSNGRYTATLDADTKQSSLHITAAQLSDSASYICVVS
Papio anubis V506 trav AHZZ02031767.1 86814 VWSQQKEVEQDPGPFSVPEGATVTFNCTYSNSASQSFFWYRQDSRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSQLSDSATYLCAVY
Papio anubis V507 trav AHZZ02031767.1 92274 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSVSPYLFWYVQYPNQGLQLLLKYTSGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Papio anubis V508 trav AHZZ02031769.1 5302 VNGENVEQHPSTLSVQEGDSSVIKCTYSDSASNYFPWYKQELGKGPQFIIDIRSNEHEKKDQRITVLLNKTAKHFSLHITETQPGDSAVYFCAAS
Papio anubis V510 trav AHZZ02031769.1 34322 GTRAQSVTQLDSQVSVSEGVPVLLRCNYSSSFSPTLFWYVQYPNQGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKASAHVSDAAEYFCAVN
Papio anubis V511 trav AHZZ02031769.1 39878 TARAQSVTQPDIHITVSEGASLELRCNYSYGATPSLFWYVQSPGQGLQLLLKYFSGDTVVQGIKGFEAEFKRSQYSFNLRKHSVHWSDAAEYFCAVG
Papio anubis V512 trav AHZZ02031769.1 53750 VSRGESVGLHLPTVSVQEGDNSVINCTYSDSASDYFLWYKQESGKGPQSIIDIRSNMAKRQGQRLTVLLNKTMKHLSLQIAATEPGDSAVYFCAEN
Papio anubis V513 trav AHZZ02031769.1 59636 SGIAQKITQTQPAMFVQEKEAVTLDCTYDTSDQNYGLFWYKQPSSGEMIFLILQMSYDKQNATEGHYSLNFQKARKSVNLVISASQVGDSATYFCAMR
Papio anubis V514 trav AHZZ02031769.1 77956 RTRGDSVTQMEGPVTLSERAFLTINCTYTATGYPSLFWYVQYPGEGPQLLLKATKTDEKGSNKGFEATYRKETTSFHLKKDSVQESDSAVYFCALS
Papio anubis V515 trav AHZZ02031770.1 12538 VWSQQKEVEQNPGPLSVPEGATASLNCTYSNSAFQNFMWYRQYSRKGPQLLIYTYSSGNKEEGRFTAQVDKSSKYISLFIRDSQPSDSATYFCAMS
Papio anubis V516 trav AHZZ02031770.1 25603 GTRAQSVTQLDSQVPVFEEAPVLLRCNYSSSSVSVYLFWYVQYPNQGLQLLLKYLSGPTLVKGINGFEAEFKKSETSFHLRKPSTHISDTAEYFCAVS
Papio anubis V517 trav AHZZ02031770.1 37454 GTRAQSVTQPEKILSVFKGAPVELKCYYSYSGSPNLFWYVQYPKQRLQLLLRHIPRESIKGFTADLNKSDTSFHLKKLFAQEEDSATYYCALS
Papio anubis V518 trav AHZZ02031770.1 47159 VNSQQGEEDPQTLSIQEGENATMNCSYKTSINNLQWYRQDSGRSLVQLILICSNEREKNSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD
Papio anubis V519 trav AHZZ02031770.1 58976 RTNGDLVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPNKEPELLLKSSENQETNSRGFQASHDKSDSSFHLEKPSVQLSDSAVYYCVLR
Papio anubis V520 trav AHZZ02031770.1 62203 SSMAQKVTQAQTEISVVEKEDVTLDCVYETRENTYYLFWYKQPPSGELVFLIRRNSFDEQNEMNGRYDSNFQKSTSSFNLTITASQVVDSAVYFCALNE
Papio anubis V521 trav AHZZ02031770.1 97642 LSGEDQVMQSPEALSLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFSLYSAGEEKEKERLKATLTKKESFLHITGPKPEDSATYLCAVQ
Papio anubis V522 trav AHZZ02031775.1 7993 VRGIQVEQSPPDLILQEGANSTLRCNFSATVNNLQWFHQNPWGQLINLFYIASGTKQNGRLSATTVTTERYSLLHISSSQTTDSGIYFCAVKSQCSP
Papio anubis V523 trdv AHZZ02031779.1 7509 SSVAQKVTQAQSSVSMPVGKAVTLNCQYETSSWSYDLFWYKQPPSKEMIFLIRQGYSEQNARNGRYSVNFQKAASSIALTISALQLEDSATYFCALRE
Papio anubis V524 trav AHZZ02031781.1 2278 VSSILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKIPKALFVMTLNGDEKKKGRVSVTLNTKEGYSYLYIKGSQPEDSATYLCAF
Papio anubis V525 trav AHZZ02031782.1 3895 VNGQQIMQIPQYQHVQEGEDFTTYCNSSTTLNNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGSYFCA
Papio anubis V526 trav AHZZ02031782.1 14853 TIIDAKTTQPTSMDCAEGRAANLPCNHSTIGGNEYIHWYRQIHSQGPQYVIHGLKNNETNAMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Papio anubis V527 trav AHZZ02031782.1 24000 GTRAQSVTQLDGHIIVSERDPLELKCNYSYSGIPSLFWYVQYPSQSLELLLKDLSGATQVKGIKGFEAEFKKSETSFYLKKPSAHVSDAAEYFCAAS
Papio anubis V528 trav AHZZ02031782.1 41812 VSTQQLEQSPRFLSIQEGENFTAYCNSSSVFTSLQWYRQDPGEGPVLLMTLVTRGEMKKQKRLTFQFGDARKDSSLHITATQPGDTGLYLCAG
Papio anubis V529 trav AHZZ02031782.1 61192 VRSQKPVQSPQVVILQEGEDAIINCNSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSRTYFCGAE
Papio anubis V530 trav AHZZ02031782.1 84580 IRGDAKTTQPNSMESNEEEPVHLPCNHSTISGADYIYWYRQRPSQGPEYVIHGLTSNVNNRIASLTIAEDRKSSTLILHHATLRDAAVYYCILR
Papio anubis V531 trav AHZZ02031782.1 89296 VSSQELEQSPQSLIVQEGKNLTINCTSSKTLYGLHWYKQKYGEGLIFLIMLQQGGEEKSHEKITAKLDEKKQQSFLHITASQPSHAGIYLCGGD
Papio anubis V532 trav AHZZ02031785.1 7606 VSGQQLNQSPHSLSVQEREDVSMNCTSSSTFNTFLWYKQDPGEGPVLLMALFKPGELTSNGRLSAQFGITRKDSFLNISASVPSDVGTYFCAG
Papio anubis V533 trav AHZZ02031785.1 12356 VSSEDKVMQNPLSLVVHEGDTVTLNCSYEVVNFQSLLWYKQEKKAPTFLFTLTSSGIEKKSGRLSSILDKKDFFSILNITATQTRDSAVYLCAVE
Papio anubis V534 trav AHZZ02031788.1 2193 SGMAQTVTQSQPEMSVREAETMTLSCTYDTSESNYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAFM
Papio anubis V535 trav AHZZ02031788.1 11687 SGMAQTVTQSQPEMSVQEAETVTLSCTYDTSDSDYYLFWYKQPPSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS
Papio anubis V536 trav AHZZ02031788.1 35218 LSGELKVGQNPLFLSTQEGKNYTIYCNYSTASNRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSSLHITAALQDLSATYFCAV
Papio anubis V537 trav AHZZ02031788.1 52269 VSAAKNEVEQSPQDLTAQEGEFITINCSYSIGINSLHWLQQHPGGGIVSLFMLSSEKKKNGRLIATINIQERHSSLHIAASQPRDSAIYICAV
Papio anubis V538 trdv AHZZ02031788.1 138016 VSLDIILKPDTKALTVLIGEAATFRCSVTGGDLKNYQISWYKKSEDNSLILISKLSNNSNDNLGNNFKVKIDTLKSQFMLDIQKATTQDVGTYYCASD
Papio anubis V539 trdv AHZZ02031788.1 159248 VMSAVELVPEHQTMIVSVGDPATLKCSMKGEAISNYYINWYRKTQGNTMTFIYREKGIYGPGFKDNFQGDIDTEENQAVLKILAPSERDEGSYYCASD
Papio anubis V606 ighv AHZZ02042152.1 7377 AQSQVQLVQSGAEVKKPGASVKVSCKASGYTFSTYAISWVRQAPGQGLEWMGGIIPLVGITNYAQKFQGRDTSTSTAYMELSSLRSEDTAVYYCAR
Papio anubis V607 ighv AHZZ02043097.1 305 AHAQVQLVQSGPEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDSGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Papio anubis V610 ighv AHZZ02047323.1 1014 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISSYWWGWIRQPPGKGLEWIGYIYGSGSSTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V612 trdv AHZZ02049059.1 3877 FSVAQKVTQAQSSVSMPVGKAVTLNCQYETSWWSYYLLWYKQFPGKEMIFLIRQGSSEQNARNGRYSVNFQKAASSIALTISALQLEDSATYFCALWE
Papio anubis V615 ighv AHZZ02055956.1 3398 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMQWVHQTPGKGLEWVSAIGPGGDTYYADAVKGRFTISRDNAKNSLYLQMNSLRAEAVYYCAR
Papio anubis V616 ighv AHZZ02055958.1 712 AHSQEQLVQSGAEVKKPGASVKVSCKASEYTFTSYVISWLRQAPGQGFEWMGGINPSDGSTSYAQKFQDRVTITADMSTSTVYMELSSLRSEDTAVYYCAR
Papio anubis V617 ighv AHZZ02055966.1 10296 VLSQVQLQESGPAVVKPSQTLSLTCAVSGGSISSGYDWSWIRQSPGKALEWIGYISYSGSTNYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V618 ighv AHZZ02055969.1 244 VLSQVKLQQWGEGLVKLSETLSLTCAVYGGSISGYYYWSWIRQAPGKGLEWIGSIYSSGSSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADSAVYYCAR
Papio anubis V619 ighv AHZZ02055977.1 1269 VLSQVKLQQWGEGLVKPSETLSLTCAVYGGSISGYYYWSWIRQPPGKGLEWIGNIDGNSASTNYNPSLKNRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V622 ighv AHZZ02058929.1 25598 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVGFIKNKADGGTAAYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTR
Papio anubis V623 ighv AHZZ02058931.1 7148 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCTT
Papio anubis V624 ighv AHZZ02058933.1 22430 VFSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Papio anubis V625 ighv AHZZ02058935.1 6967 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMYWIRQAPGKGLQWVSAINTGGGSTWYTDSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Papio anubis V626 ighv AHZZ02058935.1 20080 VQCEMQLVESGGGLAQPGGSLRLSCAASGFTFSDHYMHWVRQAPGKGPEWVGFIRNKAKGGTAEYAASVKGRFTISRDDSKNVTYLQMNSLKTEDTAVYYCAR
Papio anubis V627 ighv AHZZ02058935.1 33467 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMCVSWIRQPPGKALEWLARIDWDNDKYYSTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARV
Papio anubis V628 ighv AHZZ02058935.1 52062 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSYWWGWIRQPPGKGLEWIGHIYGSSGSNYLNPSLKSRVTISIDTSKNQLSLKLSSVTAADTAVYYCAR
Papio anubis V629 ighv AHZZ02058936.1 9978 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWARQAPGKGLEWVSAINTGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Papio anubis V631 igkv AHZZ02062137.1 14214 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGEAPRLLIYDASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Papio anubis V636 ighv AHZZ02069345.1 7063 VQCEVQLLEYGGGLVQPGRSLRLSCAVSGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGRTEYAASVKGRFTISRDDSKSTASLQMSSLKTEDTAVYYCAT
Papio anubis V643 ighv AHZZ02087795.1 3876 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSFSSNYWSWICQPPGKGLEWIGGIYGSGGSTYYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V644 ighv AHZZ02087803.1 185 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGYIYGNSASTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V645 ighv AHZZ02089918.1 207 VQCEVQLVESGGGLVQPGRFLRLSCAASGFTFSNYYMHWAHQAQGRGLEWVSLMRKKANSYTTEYAVSVKDRFTISRDDSKNTLYLQMNSLKTEDTAVYYCA
Papio anubis V646 igkv AHZZ02090198.1 5368 TTGEIVMTQSPATLALSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYFCLQSSNW
Papio anubis V647 ighv AHZZ02098026.1 308 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSDHYMHWVRQAPGKGLEWISAINSGGGSTYYAESVKGRFTISRENAKNTLYLQMDSLRAEDTAVYYCAR
Papio anubis V648 ighv AHZZ02098027.1 4085 VKCEAQLMESGGGLVQPGGSLRLSCAASGFTFSDHYMQWVRQAPGKGLEWVGLIRNKADGETTDYAASVKGRVTTSRDDSKSITYLQMNNLKTEDTAVYYCAR
Papio anubis V649 ighv AHZZ02098029.1 4376 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYYMDWVRQAPGKALEWVSGISNTGGSTWYADSVKGRFTISRENAKNTLYLQMSSLRAEDTAVYYCAR
Papio anubis V650 igkv AHZZ02099098.1 12155 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLSWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQDSSSP
Papio anubis V651 ighv AHZZ02111939.1 1678 VLSQVQLQESGPGLVKPSETLSLTCAVSGASISSNWWSWIRQAPGKGLEWIGEINGNSGSTNYNPSLKSRVTISKDASKSQFSLKLSSVTAADTAVYYCAR
Papio anubis V652 ighv AHZZ02113099.1 10611 AQSQVQLVQSGAEVKKPGASVKVSCKASGYTFSTYAISWVRQAPGQGLEWMGGIIPLVGITNYAQKFQGRDTSTSTAYMELSSLRSEDTAVYYCAR
Papio anubis V653 ighv AHZZ02113100.1 9463 AHSQVQLVQSGAEVKQPGSSVKVSCKASGYTFTNSAMQWVRQTPGQGLEWIGWIIIGNGNTNYAQKFQGRVTITRDTSTSTGYMELSSLRSEDTAVYYCAA
Papio anubis V655 ighv AHZZ02113912.1 331 VQCEVQLVESGGGLVQPGVSLRLSCAASGFTFSSTRMNWIRQAPGKKLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCVR
Papio anubis V671 trav AHZZ02000520.1 204815 TSDEEFQVNQPQTLVSVNPGDVLTLACNMSALSPEGPVLWFKSTGPGQQLIYSFNGSHFPRVTPVENTMVDQTDYSIRIRDVLPEDAGTYYCVKLRV
Papio anubis V713 igkv AHZZ02003765.1 295123 TSGDIVMTQTPLSLPVSPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQG
Papio anubis V714 igkv AHZZ02003765.1 258503 TSGDIVMTQTPLSLPVSPGEPASISCRSSQSLLHSGGKTYLYWYLQKPGQSPQLLIREVSNRASGVPDRFSGSGSGTDFTLKISPVEAEDVGVYYCMQGIQLP
Papio anubis V715 igkv AHZZ02003765.1 249001 ARCDIQMTQSPSSLSASVGDRVTITCRASQGITNDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHYYSTP
Papio anubis V716 igkv AHZZ02003765.1 215029 ARCDIQLTQSPSSLSASVGDRVTITCQASQGISNNLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQYGYGI
Papio anubis V717 igkv AHZZ02003765.1 193903 ARCDIHMTQSPSSLSASVGDRVTITCRASQGITDDLAWYQQKPGETPKLLIYEASSLQSGIPSRFSGSGSGTEFTLTISSLQLNDSATYYCQHYYSYP
Papio anubis V718 igkv AHZZ02003765.1 181387 SRGDIMMTQTPLSLPITPGEPASISCRSSQSLLDSDDGYTYLDWYLQKPGQSPQPLIYFVSSWASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQCIEFI
Papio anubis V719 igkv AHZZ02003765.1 168046 ARCDIQLTQSPSSLSASVGDRVTISCRTSQNIYSNLAWYQQKPGKTPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDVATYYCQHGYGTP
Papio anubis V720 igkv AHZZ02003765.1 152697 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLYWYLQKPGQPPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQNP
Papio anubis V721 igkv AHZZ02003765.1 147710 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPKLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEVEDVGVYYCVQAIAFP
Papio anubis V722 igkv AHZZ02003765.1 127221 SIGDIVMTQTPLSLPVTTGEPASNSCRCSQSLLHSDGNTYLYWYLQKPGQPPWLLIYRVSDRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQAL
Papio anubis V723 igkv AHZZ02003765.1 99186 SSGDVVLTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLDWYLQKPGQSPRLLIYKVTNRESGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCMQGTKAP
Papio anubis V724 igkv AHZZ02003765.1 80214 ARCDIQMTQSPSSLSASVGDRVTITCRASQNIYSNLAWYQQKPGKAPKPLIYYASSLETGVPSRFRGSGSGTDYTLTISSLQPEDIATYYCQQYNNSP
Papio anubis V725 igkv AHZZ02003765.1 58214 SSGDVVMTQSPLTLPVTPGQPASISCRSSQSLVHSDGNTYLSWYQQKPGQPPRLLIYKVSNRYSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQGTKVP
Papio anubis V726 igkv AHZZ02003765.1 47851 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYGGSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQHRALP
Papio anubis V727 igkv AHZZ02003765.1 40175 SSGDIVMTQTPLSLPVTLGEPASISCRSSQSLLSSNEYNYLNWYLQKPGQSPQLLIYYGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Papio anubis V728 igkv AHZZ02003765.1 31845 TRCAIQMTQSPSSLSASVGDRVTITCRASQSIGSNLAWYQQKPGKVPKLLIYAASTLQSEVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKCDSAP
Papio anubis V729 igkv AHZZ02003768.1 144253 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGYTYLYWYLQKPGQSPQLLMYFASYRASGVPDRFSGSGSGTDFTLEISRVEAEDIGVYYCMQG
Papio anubis V730 igkv AHZZ02003768.1 126694 YSGDIVMTQTPLSLPVIPGEPASISCRSSQSLLDSDGYTCLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSVTDFTLKISRVEAEDVGVYYCMQSIEFP
Papio anubis V731 igkv AHZZ02003768.1 96167 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQSTEYP
Papio anubis V732 igkv AHZZ02003768.1 78247 TSGDILLTQTPLSLPVTPGEPASISCRSSQSLLHSNENTYLHWYLQKPGQSPQLLICEVSNRASGVPDRFSGSGSDTDFTLKINLVEAEDVGVYYCMQT
Papio anubis V733 igkv AHZZ02003768.1 73343 SSGDIVMTQTPLSLPVTLGEPTSISCRSSQSLVYSDGKTYLHWYLQKPGQSPQLLMYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLRSP
Papio anubis V734 igkv AHZZ02003768.1 65244 ARCDTQMTQSLSSLFASVGDRVTITCRASQGINNELAWYQQKPGKAPTLLLYSGSSLHTGVPSQFSGSGSGTDFTLTISSLQPEDVATYYCRQDYTTP
Papio anubis V735 igkv AHZZ02003768.1 57028 SSGDIVMTQTPLSLPVTPGEPSSISCRSSQSLLDSYGYTNLNWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQT
Papio anubis V736 igkv AHZZ02003768.1 47398 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISNNLNWYQQKPGKTPKLLIYAASSLQSGIPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQRYSAP
Papio anubis V737 igkv AHZZ02003768.1 32480 TSGDIVMTQTPLSLPVSPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYEVSNWASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQG
Papio anubis V738 igkv AHZZ02003768.1 24645 ARCDIQMTQSPSALSASVGDRVTISCRASQNIYSGLAWYQQKPGKAPKLLIYDASGLQSGIPSQFSGSGSGTDFTLTISSLQPEDSATYYCQHYYDTP
Papio anubis V739 igkv AHZZ02003768.1 6027 TSGDIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIQLP
Papio anubis V779 igkv AHZZ02005852.1 238910 CNGDIVLTQSPASLAVSPGQRATITCRASESVSLLGINFIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGTDFTLTINPVEADDAANYYCLQSKDLP
Papio anubis V780 igkv AHZZ02005852.1 221261 SNGEIVLTQSPTSMAVSQGERVTISCTASSSVSTSYLHWYQQKPGFPPRLLVYRTSSLASGVPARFSGSGSGTSYTLTISSMEAEDAANYYCQQGNSI
Papio anubis V781 igkv AHZZ02005860.1 14347 ARCDIQMNQSPSSLSASVGDTATITCRASQGISNNLAWYQQKPGKAPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYNSLP
Papio anubis V782 igkv AHZZ02005867.1 48667 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLNWYQQKPGKAPKLLIYDATTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Papio anubis V783 igkv AHZZ02005867.1 34962 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISSYLNWFQQKPGKAPKLLIYDATTLQSGVPSRFRGSGSRTEFTLTISSLQPEDFAAYYCLQHNSYP
Papio anubis V784 igkv AHZZ02005867.1 28532 ARCDIQMTQSPSSLSASVGDRVTITCQASQGISSWLSWYQQKPGKAPKLLLYKASGLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQFSSAL
Papio anubis V785 igkv AHZZ02005867.1 11951 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQSYSWP
Papio anubis V786 igkv AHZZ02005869.1 15257 ARCDIQMTQSPSSRSASVGDTVTITCQASQGISDYLAWYQQKPGKAPKLLIYAASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYDSDP
Papio anubis V787 igkv AHZZ02005872.1 6956 TTGEIVMTQSPATLSLSLGETATISCRTSQSVGSKLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQETSNLS
Papio anubis V788 igkv AHZZ02005873.1 14749 ARCDIQMTLSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYYATSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFKSYP
Papio anubis V789 igkv AHZZ02005874.1 78312 ARCDIQLTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYDASNLQSGVPSRFSGSGSGTEFTLTISSLQPEDFAVYYCQQRNSYP
Papio anubis V790 igkv AHZZ02005874.1 72239 AKCDIQMTQSPSSLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKPLIYYASNLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNSAP
Papio anubis V791 igkv AHZZ02005874.1 55264 ARCDIQMTQSPSSLSASAGDRVTITCRASQGISTYLNWYQQKPGKAPTRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYNSAP
Papio anubis V792 igkv AHZZ02005874.1 44764 SDTTGETVMTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLVYYASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVGVYYCQKYNDWP
Papio anubis V793 igkv AHZZ02005878.1 58936 ARCDIQMTQSPSSLSASVGDRVTITCRASQGISTYLNWYQQKPGKAPKLLIYAASRLESGVPPRFSGSGSGTEFTLTISSLQPEDFATYYCLQYKSDP
Papio anubis V794 igkv AHZZ02005878.1 46499 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDVGVYYCQQYNNWN
Papio anubis V795 igkv AHZZ02005878.1 21218 TTGEIVMTQSPATLSLSPGEGATLSCRASQSVGSYLAWYQQKPGQAPKLLIHSAYFRATGIPDRFSGSGSRTEFTLTISSLEPEDVGVYHCQQYNDLP
Papio anubis V796 igkv AHZZ02005879.1 171278 STGDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSSGNTYLSWFQQKPGQSARRLIYKVSNRDSGVPDRFTGSGAGTDFTLKISRVEAEDVGVYYCMEG
Papio anubis V797 igkv AHZZ02005879.1 154498 SKGEIVLTQSPAFRSVTLKEKVTITCQASQSIGSSLHWYQQKPDRSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSSSL
Papio anubis V798 igkv AHZZ02005879.1 126223 TSGEIVLTQSPATLSLSPGERATLSCRASQSVGSSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTEFTLTISSLEPEDFVVYYCQKYSSSP
Papio anubis V799 igkv AHZZ02005879.1 120762 VRCDIQMTQSPSFLSASVGDRVTITCQASQSISNDLAWYQQKPGKSPTLLIYDATNLHTGVPSRFSGSGSGADYSLTISSLELEDFAAYYCQQEYSYP
Papio anubis V800 igkv AHZZ02005879.1 57922 SRGDIVMTQSPAFVSVTPGEKVTITCQASEGISNYLHWYQQKPDQAPKLFIQYASQSISGVPSRFTGSGSGTDFTFTISSLEVEDAATYYCQQGN
Papio anubis V801 igkv AHZZ02005879.1 41697 VRGDIQMTQSPSSLSASVGDRVTITCRASQSFSSLAWYQQKPGKAPKLLIYSASSLQSGVPSRFSGSKSGTDFTLTISSLQPEDVASYYCQQYYSYP
Papio anubis V802 igkv AHZZ02005879.1 26552 AKCDIQMTQSPSSLSASVGDRVTITCRASQTISSYLAWYQQKPGKVPKLLIYAASSLESGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHN
Papio anubis V804 igkv AHZZ02006118.1 102022 SSGDIVMTQTPLSLPVTLGEPTSISCRSSQSLVYSDGKTYLHWYLQKPGQSLQLLMYLVSKRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLRSP
Papio anubis V805 igkv AHZZ02006118.1 80014 SSGDIVMTQTPLFLPVTLGEPASISCRSSQSLLDSEDGNTYLDWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSDTDFTLKISRVEAEDVGVYYCMQALEFP
Papio anubis V806 igkv AHZZ02006119.1 61034 SGDIIPNQTPASLTAPPGETVSISCQASADVHGEISWIRIKLGQRLEPLISHVTTLAPGVPARYSSKGSGTSYVFSISDLQPGDSGEYYCMHDYGWP
Papio anubis V807 igkv AHZZ02006119.1 4130 TSGDILLTQTPLSLPVTPAEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYEVSNRASGVPERFSGSGSGTDFTLKISLVEAEDVGVYYCMQT
Papio anubis V987 trbv AHZZ02023776.1 89015 VRSQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSIGVDQISSEVPQNLSASRPQDRRFILSSKKLLLSDSGFYLCAWS
Papio anubis V1059 trdv AHZZ02031788.1 206889 RGMLCDKVTQSSLDQMVASGSEVVLLCTYDSTYSDPGLFWYRIRPDYNFQFVFYGDKSRSHGSYFAKGRFSVKHLLTQKAFHLVISPVSTEDSATYYCAM
Papio anubis V1074 ighv AHZZ02032796.1 6228 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWNWIRQPPGKGLEWIGRIYGGSGSTDYSPSLKSRVTISTDTSKNQLSLKLSSVTAADTAMYYCAR
Papio anubis V1075 ighv AHZZ02032798.1 34101 VQCEVQLVESGGGLSKPGGSLRLSCAASGFTFSDYNMDWVRQASGKGLEWVSSINTGGGSTWYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Papio anubis V1076 ighv AHZZ02032798.1 22479 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDNYMEWVRQAPGKGLQWVGQINPNGGTTFLMDSVKGRFTISRDNAKNTLYLQTSSLNTEDTAVYYCTR
Papio anubis V1077 ighv AHZZ02032798.1 8637 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLTTSGMGVGWIRQPPGKALEWLAHIYWDDDKRYSPSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARR
Papio anubis V1078 ighv AHZZ02032799.1 4782 AHAQVQLVQSGAQIKQPGASVKLSCKASGYTFTSYYMHWVRQAPGQGLEWIGLISPYNGNKGYAQNFQGRVTITTDTSTSTGYMELSSLRSEDTAVYYCTR
Papio anubis V1140 ighv AHZZ02044097.1 27533 VQCEVQLVESGGGLVQPGGSLRVSCAASGFTFSNHYMQWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCAR
Papio anubis V1141 ighv AHZZ02044097.1 10058 VQCEVQLAESGGGLVQPGGSLRLSCAASGFTFSSYEMHWVRQAPGKGLESVSVISGDSSYTHYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Papio anubis V1148 ighv AHZZ02058938.1 31089 VQCEVQLVESGGGLVQPGASLRLSCEASGFTFGDYAMSWVHQAPGKGLEWVSSISYTGKNIYYADSVKGRFTISRDNAKNSLSLQMNSLKTEDTAVYYCTR
Papio anubis V1149 ighv AHZZ02058938.1 25876 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSYISNGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Papio anubis V1150 ighv AHZZ02058941.1 39589 VLSQVQLQESGPGLVKPPETLSLTCAVSGGSISDSYYWSWIRQPPGKGLEWIGYIYGGSGSTSYNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1152 ighv AHZZ02071015.1 8083 VQCEVQLVESGGGSVQPGASLRLCCAASGFTFSSTRMNWIRQAPGKKLEWVADIKYDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCV
Papio anubis V1153 ighv AHZZ02071015.1 460 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTSYWISWVRQMPGKGLEWMGMIDPSDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAR
Papio anubis V1154 ighv AHZZ02071018.1 35554 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNSWMNWVRQAPGKGLEWVARIKSKADGETADYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCT
Papio anubis V1155 ighv AHZZ02071018.1 16186 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSNYWMYWVRQAPGKGLEWVSAINTGGGSTYYADSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAK
Papio anubis V1156 ighv AHZZ02071020.1 28834 VQCEVKLVESGGGLVQPGGSLRLSCAISGFTFSNYWMFWVRQAPGKGLEWVSSISGSSSSTYYPDSVKGRFTISRDNAKNTLYLQMNSPRAEDTAVYYCAR
Papio anubis V1157 ighv AHZZ02071020.1 19521 VQCEVQLVAYGGGLQQPGGSLRLSCGFTFSDHYMSWIRQAPGKGPEWVGFMRNKANGGTTEYATSVKGRFTISRADSKSMASLQMSSLNTEDTAVYYCAR
Papio anubis V1158 ighv AHZZ02071020.1 2863 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMDWVRQAPGKGLEWVSSVSGSSSNTYYPDSVKGRFTISRENAKNTLYLQMNSLRAEDTAVYYCAR
Papio anubis V1159 ighv AHZZ02071021.1 8416 VQCEVQLVESGGGLVQPGRSLRLSCAASGFTFSNYYMDWVRQAPGKGLEWVGRIRNKANSYTTEYAASVKGRFTISRDDSKNTLYLQMSSLKTEDTAVYYCAR
Papio anubis V1160 ighv AHZZ02071024.1 5046 VCAEVQLVQSGAEVKRPGESLRISCKTSGYSFTGSWISWVRQMPGKGLEWMGSIYPGDSDTRYNPSFQGQVTISADKSISTAYLQWSSLKASDTATYYCAK
Papio anubis V1161 ighv AHZZ02076649.1 587 VQCEVQLVESGGGLVKPGASLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSSISSDSSYIYYADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCAR
Papio anubis V1162 ighv AHZZ02076650.1 8286 AHSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGEINPKTGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAT
Papio anubis V1163 ighv AHZZ02076650.1 5385 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNHCMSWVRQAPGKGPEWVGLIRNKANGGRAEYAASVKGRFTISRDDSKSIASLQMNSLKTGDTAVYYCTR
Papio anubis V1164 ighv AHZZ02076652.1 7923 VLSQVKLQESGPGLVKPSETLSLTCTVSSGSISDSYYWSWIRQAPGKGLEWIGRIYSSGSSTNYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1165 ighv AHZZ02076653.1 14812 AQSQVQLVQSGAEVKKPGASVKLSCKASGFTFISYAISWVRQAPGQGLEWMGEIIPAFGIADYAQKFQGRVTITADTSTSTAYMELSSRRSEDTAVYYCAR
Papio anubis V1171 ighv AHZZ02084319.1 16313 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSYWNWIRQAPGKGLEWIGRIYSSGSSTNYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1172 ighv AHZZ02084319.1 3200 VQGEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSAISSGGGSTYYADSVKGRFTISRDNSKNTLSLQMNSLRAEDTAVYYCAK
Papio anubis V1173 ighv AHZZ02084323.1 1848 VQCEVQLVESGRGLVQPGGSLRLSCAVSGFTFSDHYMSWVRQAPGKGPEWVGFMRNKANGGRTEYAASVKGRFTISRDDSKSTPSLQMSSLNTEDTAVYYCAR
Papio anubis V1174 ighv AHZZ02084325.1 3128 VQCEVQLVESGGGLAQPGGSLRLSCVASGFTFSDHYMDWVRQAPGKGLEWVSSISTGSGSTTLYPDSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCA
Papio anubis V1175 ighv AHZZ02084326.1 559 AHSEVQLVQSGAEVRKPGATVKISCKASGYTFTDYYLSWVRQAPGKGLEWMGCVDPEDGEAIYAQKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAR
Papio anubis V1179 ighv AHZZ02094765.1 20771 VLSQVQLQESGPGLLKPSETLSLTCAISGGSISSSYHYWSWIRQAPGKGLEWIGYISYSGSTNYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1180 ighv AHZZ02094765.1 5883 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYSSGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1181 ighv AHZZ02094766.1 8458 VQCEVQLVESGGGVVQPGGSLRLSCAASGFTFDDYAMGWVRQAPGKGLEWVSAISWSGGSTGYADSVKGRFTISRDNAKNSLYLQMNRLRAEDTALYYCAKD
Papio anubis V1182 ighv AHZZ02094768.1 3261 VLSQVTLKESGPALVKPTQTLTLTCTLSGFSISTSGTGVGWIRQPPGKALEWLASIYWNDSKYYSTSLKSRLTISKDTSKNQVVLTMTSMDPVDTATYYCARV
Papio anubis V1183 ighv AHZZ02094769.1 8648 VQCDVQLVESGGGLVKPGGSLRLSCVASGFTFSSYEMHWVRQAPGKGLEWVSGISTSGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCAKE
Papio anubis V1184 ighv AHZZ02094769.1 4683 VLSQVQLQESGPGVVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYSSGSNYLNPSLKSRVTLSVDTSKNQFSLKLSSVTAADTAVYYCA
Papio anubis V1185 ighv AHZZ02095080.1 439 VLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWNWIRQAPGKGLEWIGSIYSSGSSTNYNPSLKNRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR
Papio anubis V1186 iglv AHZZ02098938.1 23881 SWAQSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Papio anubis V1187 iglv AHZZ02098939.1 18698 SWAQAALTQPPSVSKSLGQSVTISCTGTSNDIGGYNAVSWYQQHPGTAPRLLIYEVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCGSYRSG
Papio anubis V1188 iglv AHZZ02098939.1 6293 SAASYELTQPHSVSVSPGQTARITCGGDNIGSKYVQWYQQKPAQAPVLVIYADSERPSGIPERFSGSKSGNTATLTISGVEAGDEADYYCQVWDSSSDH
Papio anubis V1189 iglv AHZZ02098939.1 1811 SVVSSELTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNNYRPSGIPGRFSVSWSGNTGSLTITAAQVEDEADYYCNSWDKSGNH
Papio anubis V1190 iglv AHZZ02098940.1 21872 SVVSSELTQEPALSVALGHTVRMTCQGDSLKTYYASWYQQKPGQVPVLVIYGNTNRPSGIPGRFSGSWSGNTGSLTITAAQVEDEADYYCGSWDNSGNH
Papio anubis V1191 iglv AHZZ02098940.1 5471 SAASYELTQPGSVSVSPRQTARITCGGDNIGSKSVHWYQQKPGQAPVLVIYNDSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSKY
Papio anubis V1193 iglv AHZZ02098941.1 23301 SVASYELTQPPSVSVSPGQTARITCSGDALPKNYAYWYQQKPGQAPVLVIYKDSERPSGIPERFSSSSSGTTVTLTISGAQAEDEADYYCYSGDGNS
Papio anubis V1194 iglv AHZZ02098941.1 14130 SWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGTAPKLMIYDVSNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCCSYTTS
Papio anubis V1195 iglv AHZZ02098941.1 1931 SAASYELTQPPSVSVSPGQTARITCGGDNIGSEAVHWYQQKPPQAPVLVIYADSERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDISNDH
Papio anubis V1196 igkv AHZZ02103759.1 553 TTGEIVMTQSPATLSLSPGERATLSCRASQSVNSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISSLEPEDVAVYFCLQSSNW
Papio anubis V1197 igkv AHZZ02103763.1 688 AKCDIQMTQSPPSLSASVGDRVTITCQASQGISNWLAWYQQKPGEAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSYP
Papio anubis V1198 ighv AHZZ02104243.1 5011 AHAQVQLVQSGPEVKQPGASVKVSCKASGYTFTSYGMNWVRQAHGQRLEWMGWINTDSGNPTYAQGFKERFTFSMDTSISTAYLQISSLKAEDTAVYYCA
Papio anubis V1200 ighv AHZZ02106842.1 10459 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSVSGSYWSWIRQAPGKGLEWIGEINGNSGSTSYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCA
Papio anubis V1201 igkv AHZZ02108959.1 369 TTGETVVTQSPATLSLSPGERATISCRTSQSVGSRLAWYQQKPGQAPRLLIYGASNRATGIPDRFSGSGSGTDFTLTISSLKPEDAAVYYCQQDNDWK
Papio anubis V1202 igkv AHZZ02111216.1 897 ARCDIQMTQSPSSLSASVGDKVTITCHASQSISSWLAWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYDSNH
Papio anubis V1203 igkv AHZZ02112986.1 20318 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLSWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSSP
Papio anubis V1204 igkv AHZZ02112986.1 18238 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGEAPRLLIYDASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Papio anubis V1205 igkv AHZZ02112986.1 7553 ARCDIQMTQSPPSLSASVGDRVTITCQASQSISNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQRHNSYP
Papio anubis V1206 igkv AHZZ02113084.1 14915 ARCDIQMTQSPSSLSASVGDKVTITCHASQGISSWLSWYQQKPGKAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSSSP
Papio anubis V1207 igkv AHZZ02113084.1 12835 TTGEIVMTQSPATLSLSPGERATLSCRASQSVSSRLAWYQQKPGEAPRLLIYDASSRATGIPARFSGSGSGTDFTLTISSLEPEDVAVYFCQQESNW
Papio anubis V1208 igkv AHZZ02113084.1 2024 ARCDIQMTQSPPSLSASVGDRVTITCQASQGISNYLAWYQQKPGKAPKLLIYAASTLQSGVASRFSGSGSGTEFTLTISSLQPEDFATYYCQQHNSYP
Papio anubis V1209 ighv AHZZ02113598.1 392 VLSQVQLQESGPGVVKPSETLSLTCAVSGGSISSSYWSWIRQPPGKGLEWIGYIYGGGSTNYNPSLKSRVTMSADTSKNQLSLKLSSVTAADTAVYYCAR
Papio anubis V1211 ighv AHZZ02116539.1 4212 VLSQVQLQESGPGLVKPSETLSLTCTVSGGSISVSYYWSWIRQPPGKGLEWIGRIYGNSASTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAR