WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ursus maritimus AVOR00000000.1 (AVOR01) 134 5 27 18 54 16 10 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ursus maritimus V213 iglv AVOR01056198.1 8177 SMASYVLTQPPSMSVNLGQTAKITCGGNNIGSKNAQWYQQKPGQAPVLIIYDDSTRPSGIPDRFSGTNSGNTATLTISGTRAEDEADYYCQIYDSSTY
Ursus maritimus V214 iglv AVOR01056199.1 5122 SMASYVLTQPPSMSVNLGQTAKITCGGNNIGRKSAQWYQQKPSQAPVLIIYGDSTRPSGIPDRFSGTNSGNTATLTISRAQAEDEADYYCQVWDSSAD
Ursus maritimus V215 iglv AVOR01056199.1 14720 SMASSEVTQPPFVSVALGQTATITCSGEELGENILKWYQQKPGQAPVLIIYYEKDRPSGIPERFSGSRSGNTATLTISGAQAEDEADYYCQTYDSSAD
Ursus maritimus V216 iglv AVOR01056200.1 15144 SMASYVLTQPPSMSVNLGQTAKITCGGNNIGDKYTYWYQQKPGLAPMLIIYKDSNRPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQTYDSSAY
Ursus maritimus V217 iglv AVOR01056202.1 4206 SMASSEVTQPPFVSVALGQTATITCSGEELGENILKWYQQKPGQAPVLIIYYEKDRPSGIPERFSGSRSGNTATLTISGAQAEDEADYYCQTFDNSGT
Ursus maritimus V218 iglv AVOR01056203.1 7389 SMASYVLTQPPSMSVNLGQTAKITCGGNSIGRKYASWYQQKPGQAPVLIIYENSKRPSGIPDRFSGSSSGNTATLTISGARAEDEADYYCQTYDSSTY
Ursus maritimus V219 iglv AVOR01056203.1 18652 SVASSVLTQSPSVSVSLGQTATITCSGEILSKNYARWLQQKAGQVPVTVIYKDTERPSGIPDRFSGSSSGNTHTLTISGARAEDEADYYCQAWDSNVK
Ursus maritimus V220 iglv AVOR01056203.1 25816 SLASSGLTQPPSVSVALAQTATITCSGDVLGKRYAYWYQQKPSQAPVLVINKNNERPSGISDRFSGSNSGNTATLTISGARAEDEADYYCQSYDSSGN
Ursus maritimus V221 iglv AVOR01056203.1 30569 SVASSVLTQSPSVSVSLGQTATITCSGEILSKAYTQWIQQKAGQAPVTVIYKDTERPSGIPNRFSGSSSGNTHTLTISGARAEDEADYYCQSYDDGSK
Ursus maritimus V222 iglv AVOR01056203.1 40025 SVASYVLTQPPSVSVTLGQTASITCGGDNIGSTYVSWHQQKPGQAPVTIIYKDSNRPSGIPDRFAGSNSGNTATLTISGTRAEDEADYYCLSYSSSTGT
Ursus maritimus V223 iglv AVOR01056268.1 8615 SQPGLAQPEALLVFPGQVAQLSCMLSPRHATVGEYGVSWYQQRAGSAPRYLLYYRSEDDYHRPPDIPERFSAATDAAHNACILTISPVQPEDDADYYCSVG
Ursus maritimus V258 igkv AVOR01064450.1 53333 ACGAITMTQSPGSLAVSVGQRVTMNCRASQSVSSYVNWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISSLQAEDVGVYYCQQSYDTP
Ursus maritimus V259 igkv AVOR01064450.1 61872 SAGDIVLTQSPASLTMSPGQRATISCKASEKVSGIWGITNYITWYQQKSGQSPKILIYKATSRESGVPARFSGSESGTDFTLTIDPVEAGDAASYYCQQGQKEP
Ursus maritimus V260 igkv AVOR01064451.1 37740 SAGDIVLTQSPASLTMSPGQRATISCKASEKVSGIWGITNYITWYQIKSGQSPKILIYKATSRESGVPARFSGSESGTDFTLTIDPVEAGDAASYYCQQGQKEP
Ursus maritimus V307 trgv AVOR01078359.1 1252 LGAGLKLEQPAFVVARLPSDRSATLTCKVDSSVSYIHWYRHQEGEAPRRLLHLDMSRGYVQRDYTTKSDKVNAEKGRDGYSCTLSVLKLEKSDEGVYYCAAWE
Ursus maritimus V308 trgv AVOR01078360.1 12932 GGAGLKLEQPALVVARLPLEPSATLTCKVDSSVRYIHWYRHQEGMVPRRLLYLDMSSSKVERDFPMNADKVNAEKGSDGYSCSLSVLKLRKSDEGVYYCAAWE
Ursus maritimus V309 trgv AVOR01078361.1 19203 SGSGLKLEQPDVVVERLGSTASLPCKVDTSVNYIHWYRHQEGSAPQRLLYLDMSGSYVRRDSVLKADKVNVKKGKQSNSCNLLVLKLEKDDEGVYYCAAWE
Ursus maritimus V310 trgv AVOR01078364.1 22354 SSGAISLEQPAVVVARTGNSATLPCKASTKVNYIHWYHHKEGMAPERILRLDMSGSSVHKDSVLKADKVMATKDKDGTSCNLFVLKLEKSDEGVYYCAAWE
Ursus maritimus V311 trgv AVOR01078364.1 77489 GWAWNTLEQPIMVVAPAGSSATLPCKASSRVNYIHWYRLQEGMAPKRLLRVDTSGPYVRRDWVLKADKVNATSGEDSTSCTLSVLKLEKSDEGVYYCAAWE
Ursus maritimus V312 trgv AVOR01078365.1 34204 RLAGIRLEQPALVVARSGSSVTLSCRANTKVSYIHWYQHQEGNAPRRLLIVALFSSYVQTDSVLKGDKVTARRGSDGKSCNLLMSKLEKSDEAVYYCTAWE
Ursus maritimus V313 trgv AVOR01078365.1 85608 GHAEIRLEQPAVVVARESGSASLTCTAKTKVNYIHWYRHQEGKAPQRLLRRAMYQSDVWWDTVEKADKVTATEAKDGTSCTLSVLKLEKSDEGVYYCAAWE
Ursus maritimus V314 trgv AVOR01078365.1 98350 KLEQPGISISRARHKTARISCKVSAKDLNSETIHWYQQKPGQEIEHLTHVITNRVQVPSDGKNNKLEASKNAGTSTSMLRIDFLQKEDEAVYYCACWIW
Ursus maritimus V315 trgv AVOR01078365.1 107223 TKADILITQLIPSITKKQGNTAFLECQIKTGGLRNNVYIHWYRQKPDQPLKRILYISSNENVVHEQEVDEERYEARKRQRDLPSSLRIHRVEEADAGLYYCACWD
Ursus maritimus V316 trgv AVOR01078365.1 135475 GLGQVKLEQPEISISRARDKSARISCKVFISDFNNAVIYWYRQKPDQEIEYLGLVQAISGQVSIGGKKNKLEASKNALTSTSTLNINFLEKQDEAVYYCACWNR
Ursus maritimus V392 trav AVOR01115621.1 1031 VSGKTGVEHRPQYLTAHEGDSVTINCSYSIGMTSLHWLQQNPGGGIVSLFILSLEMKTKGRVRATINTEELHSTLDITASQPRDSATYLCAVTQCSP
Ursus maritimus V400 trav AVOR01120059.1 25577 ESTQQLEQSPRFRNTQEGENFTAYCNSMSTFPSLQWYRQKPGEGPVHLMTLSKGGEMKKHKSLTVWFGEARKDSSLLVIAAQPADAAIYLCAG
Ursus maritimus V405 trav AVOR01121040.1 112 IMSDAKTTQPNAMESTEEEPVHLPCNHSTISGNEYIYWYRQIPNQGPEYMIHGLKDNVTDGKATLIVAVGRKSSTLILPRVTLGDAGVYYCILRE
Ursus maritimus V406 trav AVOR01121398.1 24101 VTAAEVEQRPPALSLQEGASSTLQCNFSTTPANVQWYRQDPGGRLSLLFSVPSGTKQHERLNSMTVAKERRSSLYISSSQTADSATYFCAMEPQCSP
Ursus maritimus V407 trdv AVOR01121400.1 7537 SSTAEKVIQTRSAVAMQEGQVATIFCKYETSWSNYYTLYWYKQPPSGEMIFLIYQDENKPNAKQGHFSVNFQKTEKSISLTISPLQLTASAVYFCALGS
Ursus maritimus V408 trav AVOR01121402.1 1722 VSGQQLNQSPQSESLQEGENVSMNCTSLSIFSSLLWFKQDPGEGLVLLIALYKAGELTRNGKLTAQFRGTRMDSFLTISGSEMKHSGTYFCSG
Ursus maritimus V409 trav AVOR01121404.1 18935 SNTAQKVTQTQPDTSVWETETVTLHCTYDTSDSNYYLFWYKQPPSGELILIIHQEAFKQENAMKDRFSVDFQKAKKSFSLRISESWLEDAAMYFCALVE
Ursus maritimus V410 trav AVOR01121406.1 25199 VSGKTRVEHRPQYLTAHEGDSVTINCSYSIGMTSLHWLQQNPGGGIVSLFILSLEMKMKGRVRATINTEELHSTLDITASQPRDSAIYLCAV
Ursus maritimus V411 trdv AVOR01121409.1 8885 SRYADKVRQSPSTVRGEEGQSVTLDCSFTLSYNYYVMNWYHQPPNGKMTQIISMFSDSSSQKQGRYALSFQKGSKSLKLTITGLQPSDTDVYFCAVGET
Ursus maritimus V413 ighv AVOR01123505.1 73 VQCEVQLVESGGDLGKPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLQWVASISSSGGSTYYADSVKGRFTISRDNGKNTLYLQMNSLKAEDTAVYYCAS
Ursus maritimus V414 trav AVOR01124940.1 223 FSRGETVEQRPSTLSVRQGCSSVINCSYSDSASVYFPWYKQELGKGPQLRIDIRSSMATKDQRLSVLLNRTARHLSLHITDTQPEDSAVYFCVA
Ursus maritimus V415 trav AVOR01124940.1 28320 NRREQSLGSLSVLEGATASLNCNYIDSASQHFVWYRQYSGKGPELLVYLYSKGDKKEGRFLAQVNAAKQYVSLLISDSQSSDSATYLCAVSTQCSP
Ursus maritimus V421 trav AVOR01126637.1 5683 LSRGETVEQRPSTLSVQQGRSSVINCSYSDSASDYFPWYKQELGKGPQLLIDIRSSMTTKEDQRLTVLLNKTARHLSLHIADSQPEDSAVYFCAA
Ursus maritimus V422 trav AVOR01126638.1 6195 QTHGDSVTQTEGPVTLSEEASLTINCTYSTTGSPTLFWYVQYPGEGLQLLLKALRDQEKKSNNGFEATLDSKSKSFHLEKGSVQASDSAVYYCAMN
Ursus maritimus V423 trav AVOR01126638.1 16404 FSRGETVEQRPSTLSVQQGRSSVINCSYSDSASHYFSWYKQEFGKCPQLLIDIHSTMTTKEDQRLTVLLNRTARHLSLHIADTQPEDSAVYFCAA
Ursus maritimus V424 trav AVOR01126638.1 18532 QTHGDSVTQTEGQLTLSEKASMTINCTFSTTWSPTLFWYVQYPGEGLQLLLKAMKEKEKGINKGFEATYDKDSKSFHLEKGSVQVSDSAVYYCAMN
Ursus maritimus V425 trav AVOR01126638.1 27616 LSRGETVEQRPSTLSVRQGRSSVINCSYSDSASDYFPWYNQELGKGPQLLIDIRSSMTTKEDQRLTVLLNKTARHLSLHIADSQPEDSAVYFCAA
Ursus maritimus V426 trav AVOR01126640.1 21539 GTGAQSVTQPVAHITVSEGSPLELRCNYSYSRTPYLYWYVQYPSQGLQLLLQYFSGDTLVQGIRDFEAEFRKTETSFHLRKPSAHGSDAAKYFCAVS
Ursus maritimus V428 trav AVOR01126640.1 48203 SSMTQKVTQAQPAISMLENEAVTLDCVYEASGSSYYLFWYKQPPSGEMIFLIRQDSYSEQNATEGRSSLNFQKSDRSISLTITALQAAHSAVYFCALR
Ursus maritimus V429 trav AVOR01126641.1 1107 LSGEDRVEQSPQTLRLQEGDHVSLNCNYTVSSFNGLQWYRQDPGQGPELLFLLYSVGAEKQKDRLTATLLKKGSYLHIEASKPQDSATYFCAVE
Ursus maritimus V430 trav AVOR01126642.1 11694 VTATEVEQRPPALSLQEGASSMLQCNFSSTPANVQWYLQDPGGRLSLLFSVPSGTKQHGRLNSTTVAKELRSSLYISSSKTADSATYFCAWSHSAPQ
Ursus maritimus V433 trav AVOR01128639.1 9299 QTHGDSVTQTEGQVTISEDASLTINCTYITTSFPTLFWYVQYPGEGPQLLLKASRDQEKGSNKGFVATYNRDSKSFHLEKGSVQESDSAVYYCVMN
Ursus maritimus V434 trav AVOR01128639.1 16931 VRGLEVEQRPSALSLQEGAGAALKCNFSSSVQSVQWFRQNPGGGGLTSLFFIASGMKQSGRLNCTLNTRERSSALHIAASQLEDAASYLCAAE
Ursus maritimus V435 trav AVOR01128639.1 21801 FSRGETVEQRPSTLSVRQGRSSVINCSYSDSASVYFPWYKQELGKGPRLLIDIRSSMTTKEDQRLTVLLNKMARHLSLHIADTQPEDSAVYFCAA
Ursus maritimus V436 trav AVOR01128639.1 31834 QTHGDSVTQTEGQVTLSEEASLTINCTYITTRFPTLFWYVQYPGEGPQLLLKALRDKEKGTSKGFEATYDKDSKSFHLEKSSVQASDSAVYYCAMN
Ursus maritimus V437 trav AVOR01128639.1 47403 FSRGETVEQRPSTLSVRQGRSSVINCSYSESVSEYFPWYKQELGKGPRLLIYIRSSMTTKEDQRLTVLLNKTARHLSLHIADTQPEDSAVYFCAA
Ursus maritimus V438 trav AVOR01128639.1 54533 QTHGESVTQTEGEVTVSEKASLTMNCTYSASGYPALFWYVQYPGEGPQLLLKASRDQEKGSNKGFEATYGRDSKSFHLEKGSVQASDSAVYYCAMS
Ursus maritimus V439 trav AVOR01128639.1 59093 SSIAQKVTQAQPAMLVQEKGAVALECTLSTSDPSYSLLWYKQPSSGAMIFLIRQDSYSQQNATNGRYSLNFQKTRKSIQLVMSASELEDSAVYFCALRE
Ursus maritimus V440 trav AVOR01128639.1 63895 ETQGNSVTQTEGQVTLSEKTSLTINCTYSTTGSPTLFWYVQHPSEGLQLLLRAFSDKKESNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCVMN
Ursus maritimus V441 trav AVOR01128640.1 4464 VRGLEVEQSPSALSLQEGARAALKCNFSQVVDSVQWFRQNPGGGGLTRLIYVASGTKQSGRLNCTLNTRERCSTLHIAASQLEDAASYLCAAE
Ursus maritimus V442 trav AVOR01128640.1 8779 FSRGETVEQRPSTLSVRQGRSSVINCSYSDSASVYFPWYKQELGKGPRLLIDIRSSMTTKEDQRLTVLLNRTARHLSLHIADTQPEDSAVYFCAAS
Ursus maritimus V443 trav AVOR01128640.1 16256 QTHGDSVTQTEGQVTLSEEASLTLNCTYSVPGSLTLFWYVQYPGEGPQLLLKALRDKEKGSNKGFEATYDKDSKSFHLEKGSVQASDSAVYYCAVN
Ursus maritimus V451 ighv AVOR01132909.1 36751 VQCEVQLVESGGNLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLQWVTSISNTGSSTYYADSVKGRFTISSDNGKNTLYLQMNSLRAEDTAVYYCAK
Ursus maritimus V452 ighv AVOR01132911.1 7852 VQCEVQLVESGGDLVKPGGSLRLSCAASGFSFSSYYMSWVLQAPGKGLQWVAGISSGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRADDTAVYYCAK
Ursus maritimus V453 ighv AVOR01132913.1 9840 VQCEVQLVESGGDLVKPGGSQSVSCAASGFTFSSYGMSWVCQAPGKGLQWVAVISYDGSSTSYTGSVKGRFTISRDNGKNTLYLQMNSLRADDTAVYYCAS
Ursus maritimus V454 ighv AVOR01132922.1 143 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYWMYWVRQAPGKGLQWVAGISGSGGSTYYADSVKGRFTISRDNGKNTLYLQMNSLRADDTAVYYCAK
Ursus maritimus V647 trbv AVOR01055944.1 34575 LAAAQVTQTPRHLIKKVGAKVLMECSQNMDHEGMFWYRQDPGLGLQLLYWSYGINDTEQGDLPFGYDVSRKKKEAFLLTLESASTNQTSVYLCASS
Ursus maritimus V648 trbv AVOR01055944.1 28679 SVFGALLSQKPRRDICQRGTSTTIQCEVDTQLPLMFWYRQLAGQGLILIATANQGTKATYESGFTEEKFPISRPTSTFSNLTVTNVSLQDSSFYFCSAG
Ursus maritimus V649 trbv AVOR01055945.1 20189 SMDAGITQTPKNGIIKTGKSILLECYQTKGRDYMYWYRQDPGLGLRLIYYSYVNDINEGEVSHGYNASREDLSKFSLSLGSAIPNQTALYFCAIGD
Ursus maritimus V650 trbv AVOR01055945.1 14403 LVDAGVSQTPRHSVSGTGKKIVLECSQTLGHDNMYWYRQDPGKALELMHYSYGVNTTEKTELSSGSAVSRIKKEHFPLTLESASPSQTSLYLCASSE
Ursus maritimus V651 trbv AVOR01055945.1 9558 LKDAVVTQFPRHRVLGTGKEITLQCSQDMSYVSMYWYRQDPGFGLRLIYYSTGIRTFEKGDVPQGYRVSRNELQSFPLTLESASANQTSVYLCASSE
Ursus maritimus V652 trbv AVOR01055945.1 716 PLEAGVTQTPRYLITRTGRQLTLHCSQDLNHDAMYWYRQDPGLGPKLISLSRNVDFTEDGDVPEGYTVSRKEKKKFPLTVKSAGTNQTSLYLCASSV
Ursus maritimus V654 trbv AVOR01055947.1 5676 TADGGITQTPKYLFREEGQEATLECEQDFNHDYMYWYRQDPGQGLGLIYYSPVENEIQKGDIPDGYSASRKKTTFSLTVTQIRKNQTALYLCASSR
Ursus maritimus V655 trbv AVOR01055949.1 57821 HAGAGVAQFPRHRVTRKGQNVTLSCDPISGHVGLYWYRQTVGQGPEFLISFQNNNPVDKSGMTNNRFSAKRQTGTHSTLQIQHAEQGDSAVYLCASSL
Ursus maritimus V656 trbv AVOR01055949.1 54581 GPLDAAITQTPRYQIVQIGTKMTLECSQDMNHFAMFWYRQDPGQGLRLIHYSSGVTGTAKENVGEGYSVSRNKQEHFSLTLESAGTNQTSVYLCASSK
Ursus maritimus V657 trbv AVOR01055949.1 42402 HAGAGVAQFPRHRVTRKGQNVTLSCDPISGHVGLYWYRQTVGQSPEFLVYFQNSDLVDKSGLTNNRFSAKRRTGTHSTLQIQHAEQGDLAVYLCASSL
Ursus maritimus V658 trbv AVOR01055949.1 36365 PVGAEVIQTPQHLIQGRGGKAVLKCHPIPGHISVSWYQQAPGQGLRFLVEYYNEQQRDKGDMPGRFSAQQFGNYSSQLDLSSLELGDSALYLCASS
Ursus maritimus V659 trbv AVOR01055949.1 16535 FTVGGVFQTPGHKVTKMGQEVTLRCEPISGHRVLYWYRQTSGQGPGLLIYFNDQDPVDDSGMPKERFSAEMPEKTFSTLKIKPTEPKDSATYLCASSV
Ursus maritimus V660 trbv AVOR01055949.1 8639 FTDAGVIQTPGHKVTKMGQEVTLRCEPISGHRALYWYRQTSGQGPGLLIYFNDQDPLDDSGMPKEWFSAEMTEKTFSTLKIEPTEPKDSATYLCASSV
Ursus maritimus V661 trbv AVOR01055950.1 21726 PLDTAVVQTPKYLIAQTGDKKYLKCEQRLGHDTMYWYKQDSENGPKIMFIYDNKEQLLNDTVPRRFLPETPDKTRLNLHVDSLETGDSAVYLCASSR
Ursus maritimus V662 trbv AVOR01055950.1 18292 SMDTGVTQIPKHLVTAMGRNVTLKCKQHLGHNAMYWYKQSAQNAPKLMFAYNYKNIARNETDSSRFSLWRPDTSQLDLHMGAVQREDSATYLCASSR
Ursus maritimus V663 trbv AVOR01055950.1 2178 GPVESEVTQTPRHLIKTRGQKATLRCSPVSGHLSVYWYQQVLGQGPQFLIQYYNTKERDRGKIPERFSAQQFSDYSSQLDMTLLEPGDSALYLCASSL
Ursus maritimus V693 igkv AVOR01064451.1 55613 STGEIVMTQSPASLSLSPGEKATLNCRASQSVSSYVAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYNSGC
Ursus maritimus V694 igkv AVOR01064451.1 46327 SSGEVVMTQTPLSLPVTPGEPASLSCSASQSVLHSDGKSYLNWYLQKPGQSPRALIYEASKRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCQQSLQSP
Ursus maritimus V695 igkv AVOR01064451.1 27031 SHGEIVLTQSPALLSKALKEKVTITCRASQSISTNLHWYQQKPNQAPRLLVKYASQTISGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQSNSNP
Ursus maritimus V696 igkv AVOR01064451.1 17790 SSGEIVMTQTPLSLPVTPGEPASISCKASQSLLHSNGNTYLYWFQQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQG
Ursus maritimus V697 igkv AVOR01064451.1 12215 SSGEIVMTQTPLSLPITPGEPASISCKASQSLLHSNGNTYLHWFRQKPGQSPEGLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQNLQSP
Ursus maritimus V698 igkv AVOR01064451.1 7488 SSGEIVMTQTPLSLPVTPGEPASISCKASQSLLHSNGNTYLHWFQQKPGQSPKRLIYKVSNRDPGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQNLQSP
Ursus maritimus V699 igkv AVOR01064452.1 3018 SSGEIVMTQTPLSLPVTLGEPASISCKASQSLLHSNGYTYLYWYLQKPGQSPQLLIYAASNRFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCMQA
Ursus maritimus V700 igkv AVOR01064453.1 15744 SSGEIVMTQTPLSLPVTPGESASISCKASQSLLHSNGNTYLSWFRQKPGQAPEGLIYLVSNRFSGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCGQNLQSP
Ursus maritimus V701 igkv AVOR01064455.1 7543 SSGEVVMTQTPLSLPVTLGEPASISCKASQSLLHSNGYNYLYWFLQKPGQSPQLLIYAASNRFTGVPDRFSGSGSGTDFTLKISRVEADDVGVYYCMQA
Ursus maritimus V702 igkv AVOR01064456.1 29061 ASSEIQMTQSPSLLSASLGDRVTITCRASQNANRWLTWYQQNPGKAPKPLIYEASKLQTGVPSWFSGSGSGTDFTLTISSLEPEDAGTYYCLQYNSNP
Ursus maritimus V703 igkv AVOR01064456.1 24317 VRGSTSLIQSPAFLSVSLRESVSITCRANDSISDYLSWYQLKPGQAPKLLIYDADNLGTGVPDRFSAIQSKTEFILKISTVEAEDAASYYCQQDYTLP
Ursus maritimus V704 igkv AVOR01064456.1 16842 SSGEIVMTQTPLSLPVTLGEPASISCKASQSLLHGNGNTYLSWYLQKPGQAPTRLIYRVSNRAPGVPDRFSGSGSGTDFTLKISRVEADDLGVYYCGQGIQSP
Ursus maritimus V705 igkv AVOR01064456.1 9803 SSGEIVMTQSPLSLPVTLGEPASISCKASQSLLHSNGNTYLYWFRQKPGQSPEGLIYRVSNRYSWVPDRFSGSGSGTDFTLKISRVEADDLGVYYCGQG
Ursus maritimus V706 igkv AVOR01064457.1 2893 CGGRLLVLTQTPETLAASQDSFISITCRSNMEVGTSMAWYQQKPNEAPRLLVFGASARAAGTPSRFRGSGSGSDFSLTIHGVETEDVGVYYCQ
Ursus maritimus V742 trav AVOR01077330.1 26485 TSDEDFQVIQPESSVSVRAGEILTLGCNVSARSPAGPVLWFRENGQERQLIYSFNGSQFPRVTQVENSEFNQTDYSIRISDVSPKDVGTYYCVKLTI
Ursus maritimus V757 iglv AVOR01081209.1 21690 SMAAYVVTQPPSVSVTPGQTASITCGGDNIASRYVSWYQQKPGQAPVMIINSNNNRPSGIPERFSGSKSGNTATLTISRAQAEDEADYYCLPYQGGS
Ursus maritimus V758 iglv AVOR01081209.1 15222 SVASSVLTQSPSVSVSLGQTATITCSGEILSKAYAQWIQQKAGQAPVMVIYKDTERPSGIPDRSSGSSSGNTHTLTISGARAEDEADYYCEAWDSNVN
Ursus maritimus V759 iglv AVOR01081210.1 16924 SWAQSTLTQPPSLSGALGSTVTISCAGSSSNIGGNNYISWYQHPPGTSPKLLIYRVSSRPSGIPDRFSGLKTGNTAILIISGLQAEDEGDYYCTSVTSSDN
Ursus maritimus V760 iglv AVOR01081215.1 11295 SWAQSSLTQPPSVSGTLGQTITISCAGSSSNIGSGNYVSWYQQLPGTSPKLLIYNVNTWPSGIPDPFSGSRCGNTASRTISRLQAEHEPEYYCCSYLGSDNF
Ursus maritimus V761 iglv AVOR01081215.1 3438 SWAQSTLTQPASVSGALGQTFTISCTGTSNDIGKYNYVSWHQQYPGMAPKTLIYDVNTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCA
Ursus maritimus V762 iglv AVOR01081216.1 30235 SWAQSALTQPASVSGALGQTVTISCTGTSNDIGGYNGVSWYQQYPGMAPKTLIYRVNTRPSGIPDRFSGSKSGNTATLTISGLQAEDEAEYYCASYRSG
Ursus maritimus V763 iglv AVOR01081216.1 5651 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGRYNYVSWYQQYPGMAPKTLIYYVNTRPSGIPDRFSGSKSGNTATLTISGLQAEDEAEYYCATYRSG
Ursus maritimus V764 iglv AVOR01081217.1 5478 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGSYNDVSWQQQYPGMAPKALIYNVNTWPSGIPDRFSGSKSGNTATLTISGLQAEDEAEYYCASYRSG
Ursus maritimus V765 iglv AVOR01081218.1 16482 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGGYNAVSWHQQYPGMAPKTLIYRVNNRPSGIPDRFSGSKSGNTATLTISGLQAEDEAEYYCASARSG
Ursus maritimus V766 iglv AVOR01081220.1 28633 SWAQSTLTQPASVSGTLGQTVTISCTGTSNDIGSYNGVSWHQQYPGMAPKTLIYKVNTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCASYRSA
Ursus maritimus V767 iglv AVOR01081220.1 3355 SWAQSTLTQPASVSGTLGQTVTISCTGTSNDIGRYNGVSWHQQYPGMAPKTLIYRVNTRPSGIPDRFSGSKSGNTASLTISGLQAEDEAEYYCASASSGGT
Ursus maritimus V768 iglv AVOR01081226.1 37597 CSFPGSWAQSALTQPLSVSGALGWKITISCAGSSSNIGSGNYVSWFQQLPGTSPKFLIYDISSWPSGIPGHFSGSKLTSLTISGPQAEDEADYYCCSYRTS
Ursus maritimus V769 iglv AVOR01081226.1 2829 SWAQSTLTQPASVSGALGQTVTISCTGTSNDIGNYNRVSWHQQYPGMAPKALIYDVNTRPSGIPDRFSGSKSGNTASLTISGLQAKDEAEYYCA
Ursus maritimus V780 trdv AVOR01083876.1 4847 VSLDILLEPDTKTLTVLVGEPATLHCSVTGGDLKNYQVSWYKKNEDNSLILVYRPSNNTNEDSRSNFKGNANASKSQLDIQRTTVEDAGTYYCACD
Ursus maritimus V781 trav AVOR01083877.1 1150 GSCRTEIIQPSNLAAVIGADVTFQCEYSIPDGIYDTVYWYLQRADRRLTYIHRTSQGTMESEHYQLSVNRELPSSTLTIKHVQPRDKATYYCAL
Ursus maritimus V839 trav AVOR01104736.1 331 HIHGDSLTQTEGQVTLSEEASLTINCTDTTTGYPTLFWYVQYSGEGLQLLLSSSRDQEKKINKGFEATLDSKSKSFHLEKGSVQVSDSAVYYCVMR
Ursus maritimus V841 igkv AVOR01112659.1 331 SAGDIVLTQSPASLTMSPGQRATISCKASEKVSGIWGITNYITWYQQKSGQSPKILIYKATSRESGVPARFSGSESGTDFTLTIDPVEAGDAASYYCQQGQKEP
Ursus maritimus V846 trav AVOR01116671.1 8184 FSRGETVEQRPSTLSVRQGRSSVINCSYSDSRSEYFPWYKQELGKGPRLLIYIRSSMTTKEDQRLSVLLNRTARHLSLHIADTQPEDSAVYFCAA
Ursus maritimus V847 trav AVOR01116671.1 6993 SSIAQKVTQAQPAMLVQEKGAVALECTLSTRDPSYSLLWYKQPSSGAMIFLIRQDSCSQQNATDGRYSLNFQKTRKSIQLVMSASELEDSAVYFCALSK
Ursus maritimus V848 trav AVOR01116671.1 1703 HIHGDSLTQTEGQVTLSEEASLTINCTDTTTGYPTLFWYVQYSGEGLQLLLSSSRDQEKKINKGFEATLDSKSKSFHLEKGSVQVSDSAVYYCVMR
Ursus maritimus V849 trav AVOR01116672.1 18883 QTHGDSVTQTEGQVTLLEEASLTMNCTYSTIGSPTLFWYVQYPGEGPQLLLKASRDQEKKSNNGFEATFDSKSKSFHLEKGSVQVSDSAVYYCAMN
Ursus maritimus V850 trav AVOR01116672.1 4880 QTHGDSVTQTEGRVTLLEEASLSLNCTYSASGSLALFWYVQYPGKGPQLLLKALRDKEKGSNKGFEATYDKDSKSFHLEKGSVQASDSAVYYCAMN
Ursus maritimus V851 trav AVOR01116672.1 737 VRGLEVEQSPSALSLQEGVRAALKCNFSSSVQSVQWFRQNPGGGGLTRLIYVASGTKQSGRFNCTLNTRERPSTLHIAGSQLEDAASYLCAAE
Ursus maritimus V853 trav AVOR01116957.1 6913 VRAQMKVEQSPKVLTLQEGRNASMMCNCSSSMTSVQWFQQSPEGRLTSLSYIASGMQQKGRLIFTVNTKERNSHLYITDSQPGDSFTYFCAVE
Ursus maritimus V854 trav AVOR01116960.1 16054 INGQEIQQNPQFLLLQEGEDFTLYCNSSVALNGLQWYKQRPGSGPVLLITLLKGGEEKQKRLTARFGEARKDSSLHMEASQTADAGTYFCAGAQCSQ
Ursus maritimus V855 trav AVOR01116960.1 5422 ESTQQLEQSPRFRSLQEGENFTAYCNSTSTFPSLQWYRQKPGEGPVHLMTLSKGGEMKKHKSLTARFGEARKDSSLLIIAAQPADAAIYLCAG
Ursus maritimus V856 trav AVOR01116961.1 20011 VTAAEVEQRPPALSLQEGASSTLQCNFSTTPANVQWYRQDPGGRLSLLFSVPSGTKQHGRLNSTTVAKERRSSLYISSSQTADSATYFCAMEPQCSP
Ursus maritimus V857 trav AVOR01116961.1 18648 VTAAEVEQRPPALSLQEGASSTLQCNFSTTPANVQWYRQDPGGRLSLLFSVPSGTKQHGRLNSTTVAKERRSSLYISSSQTADSATYFCAMEPQCSP
Ursus maritimus V858 trav AVOR01116964.1 85542 FSRGETVEQRPSTLSVRQGRSSVINCSYSDSRSDYFPWYKQELGKGPRLLIDIRSTMTTKEDQRLTVLLNKTARHLSLHIADTQPEDSAVYFCAA
Ursus maritimus V859 trav AVOR01116964.1 83416 QTHGDSVTQTEGQLTLSEKASLTINCTFSTTWSPTLFWYVQYPGEGLQLLLKAVKEKEKGINKGFEATYDKDSKSFHLEKGSVQASDSAVYYCAMN
Ursus maritimus V860 trav AVOR01116964.1 74881 FSRGETVEQRPSTLSVRQGRSSVINCTYSDSLSVYFPWYKQELGKGPQLIIDIRSSMTTKEDQRLTVLLNRMARHLSLHIADTQPEDSAVYFCVA
Ursus maritimus V861 trav AVOR01116964.1 68119 QTHGDSVTQTEGQVSLSEEASLTINCTYTTTLYPTLFWYVQYPGEGLQLLLSESRDQEKGSNKGFEATLDSKSKSFHLEKGSVQASDSAVYYCAMS
Ursus maritimus V862 trav AVOR01116964.1 64585 SSIAQKVTQAQPTMLVQEKGAVTLECTFSTSDPSYSLLWYKQPSSGEMIFLIRQDSYSQQNATDGRYSLNFQKTRKSIQLVISASELEDSAVYFCALRE
Ursus maritimus V863 trav AVOR01116964.1 58039 QTHGNSVTQTEGQATLSEEASLTMNCTYSTGYPTLFWYVQYPGEGPQLLLKASRDQEKGSNKGFVATYNRDSKSFHLEKGSVQASDSAVYYCAMS
Ursus maritimus V864 trav AVOR01116964.1 38243 MKSHQKGVEQSLGSLSVPEGATASLNCNYSDSASQYFVWYRQYSGKGPELLVYLYAKGDKKEGRFSAQVDTAKQYVSLLISDSQSSDSATYLCAV
Ursus maritimus V865 trav AVOR01116964.1 34519 GTGAQSVTQPDAHVTVSEGSPLELRCNYSYSGTPYLYWYVQYPSQGLQLLLRYFSGDTLVKGIRGFEAEFRKTETSFHLRKPSARGNDAAKYFCAAS
Ursus maritimus V866 trav AVOR01116964.1 29284 GTGAQTVAQPEDHISVFEGDFVQVKCNYSYSGSPVLFWYVQYPKQSLQLLLKHISGESIKGFTANLNKDETSFHLKKQSAQEEDSATYYCALR
Ursus maritimus V867 trdv AVOR01117190.1 2798 VSLDILLEPDTKTLTVLVGEPASLRCSVMGGDLKNYQVSWYKNSEDNSLILVYRPSNDTNEDSRSNFKGNTNASKSQLDIQRTTVEDAGTYYCACD
Ursus maritimus V873 trav AVOR01121347.1 743 GSCRTEIIQPSNLAAVIGADVTFQCEYSIPDGNYDTVYWYLQRADRRLTYIHRTSQGTMESEHYQLSVNRELPSSTLTIKHVQPRDKATYYCAL
Ursus maritimus V878 trav AVOR01123653.1 769 LSGEDRVEQSPQTLRLQEGDRVSLNCTYTVSSFNGLQWYRQDPGQGPELLFLLYSVGAEKQKERLTATLLKKGSSLHIEASKPEDSATYFCAVE
Ursus maritimus V894 iglv AVOR01131882.1 4980 SWAQSVLTQPSSVSGALGQKVTISCTGSSSNIGDNYVSWIQQLPGTAPRTVIYNNNNRPSGIPDRFSGSKSGSSATLTITGLQAEDEADYYCASWDDSLR
Ursus maritimus V895 iglv AVOR01131885.1 12832 SWAQSGLTQPSSVSGALGQTVTISCTGSSSNIVGNYVNWYQQLPGTAPRTVIYGDNDRPSGIPDRFSGSKSGSSATLTITGLQAEDEADYYCQSYDSSLS
Ursus maritimus V896 iglv AVOR01131888.1 7556 SWAQSVLTQPSSVSGALGQKVTISCTGSSSNIGGYYVSWFQQLPGTAPRTIIYGDNNRPSGIPGRFSGSKSGSSATLTITGLQAEDEADYYCASWDSSLK