WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rhamphochromis esox ABPN00000000.1 (ABPN01) 12 4 0 3 2 2 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rhamphochromis esox Vs2 trbv ABPN01003317.1 672 VFLGLEVRQSSSDIIANVSSKVQIFCIHDKTDYYVMLWYQRPPGETAMKLIGYLYHKQVTMEDQYKSNFIISGDLTGSTAKNSSLIANAAQQGDSAVYYCAASK
Rhamphochromis esox Vs1 trdv ABPN01001860.1 2412 LTAGDSITPQQPEVTKTEGESVKLTCGYETRAGGALLHWYRHHSDLQAPQFILWKGAKDNSGDEYIPDDRYESETSSTSTNLTIAALTLADTALYYCALQ
Rhamphochromis esox Vs8 trbv ABPN01016819.1 853 ASSFSDQVHQTPPDIYTKEDEARIYCSHSISGYYTILWYKQSEKQLQFLGYMSYDKGNPETGVNVTMDGGANQKENCTLTIKDLTVSSSGIYFCAAI
Rhamphochromis esox Vs10 ighv ABPN01037448.1 688 SISVGTEGQTLTESEPVVKRPGDSHRLTCTYSGFNYNIDGVWVRQAAGKGLEWIAYISRSSAIFYSQSFRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCAEQ
Rhamphochromis esox Vs27 ighv ABPN01067923.1 732 LNAQAMESIPSTPVLKKPQEAVSLSCRGSGFSFGSFGMDWIRQPDGKALEWLGVIWSDASRTAYASSVEGRVEITKDNSNSMVYLRLSNLKPEDSAVYYCA
Rhamphochromis esox Vs25 trav ABPN01041703.1 373 YKLEVFVPSEVAVSEGGDAILPCRSVTAGQSVKSARWRRNGEVLLELNGRTGEITYGDDFNRSRVSIPSDWDRRADLSLTIKGAQQQDGGVYYCDIEKAE
Rhamphochromis esox Vs22 igkv ABPN01025330.1 1043 SSAEIILTQTPTAQSAVPGQTVSIRCKASSGMGSYLHWYLQKPSEAPKLLVYYATNRQSGVSDRFSGSGYGTDFTLTISGVQAEDAGVYYCGQSGYSRP
Rhamphochromis esox Vs15 igkv ABPN01056611.1 553 SSGEQVLTQTPTAQSVVPGQTVSVRCKASSSVGSCLHWYLQKDGESPKLLIYYATSRQSGVSDRFSGSGSETDFTLTISRVQAEDAGVYYCQQCNSWP
Rhamphochromis esox Vs18 ighv ABPN01008027.1 1399 VNGQTLTESEPAVKQPGQSHRLTCSTSGFTLSSYWIHWVRQAPGKGLEWIAADTSSSTNYYSQSVRGRFTVSRDNSRQQLYLQMNSLKTEDSAVYYCARD
Rhamphochromis esox Vs6 ighv ABPN01009007.1 1015 VDGQTLTESEPDLIKRPGESHRLTCTASGFTFRDYEMVWVRQATGKGPEWIAFISTSTYSYATYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARE
Rhamphochromis esox Vs3 igkv ABPN01003556.1 1771 SRGQITVTQPGAVSSAVGASVSIKCTTSQDVFVSGSSHCLAWYQQKDGGVPKRLIYYASTRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Rhamphochromis esox Vs0 trav ABPN01001860.1 1632 CRAQKDNVLQAKGEETAAAGGTVTLGCLYNTSSLSNYYLFWYKQDGNNSPKFILSRFKVSEGKNEAGDRFSSTLDSSIRSVPLKIQKLQLSDSAVYYCALQ