WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Apalone spinifera APJP00000000.1 (APJP01) 200 58 17 78 19 14 12 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Apalone spinifera Vs40 igkv APJP01294718.1 2401 SCGQIVLTQTPESLAVSPGDTVTIRCKASSSLTSSGYQLLAWYQQKSGQAPKLLIYDASTRPSGIPDRFTGSGSGTDFTLTINRVEAEDAGDYYCHQYRSSP
Apalone spinifera Vs638 ighv APJP01532587.1 4360 AWSQISLVESGGDVKKPGDSLRLSCKASGFTFSSYYMSWVRQAPGKGLEWVAYISGNGGDIQYLDAVKGRFTISRDNSNNLLHLQMTGLKPEDTARYYCAK
Apalone spinifera Vs732 igkv APJP01687548.1 1973 SYGQIVLTQTPESLAVSPGDRVTINCKASTSISNYLGWYQQKPGQAPKLLIYDSTNRPSGIPARFSGSGSGTDFTLTISSIEAEDAGDYYCQQRQSLP
Apalone spinifera Vs283 ighv APJP01615114.1 4608 VFSQVQLVQSGPGAVKPGETLTLSCTISGDSVTSYYWEWVRQAPGKGLEWVGQIDWSSSSWRTYYSPAFQSRATLSADTSKNQFSLQLRSLTAADTATYYCARG
Apalone spinifera Vs505 ighv APJP01332034.1 340 VLSQVQLVQSGPGAVKPGETLTLSCAVSGFSISTQYYAWHWIRQPPGTGLEWMGRVYPYDGSTRYAPSLQSRVTISADTGKNQFSLQLRSLTAAETATYYCARG
Apalone spinifera Vs46 igkv APJP01300580.1 1925 AKGQIVMTQTPESLAVSPGDTVTIRCKASTSVASYVAWYQQKSGQAPKLLNHSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQAAGLP
Apalone spinifera Vs49 ighv APJP01306877.1 91 AWSQISFVESGGDVKNPGDSLRLSCKASGFTFSSYGMIWVRQAPGKRLEWVAYVYGGTTYYLDAVKGRFTVSRDNSNNLLHLQMTGLKLEDTARYYCTGE
Apalone spinifera Vs351 trbv APJP01728189.1 3567 SGLGVLISQFPRTATQRHGERMEITCVQNETSYTYMYWYKQLKAEGPRLIARSTDGSEATYEKDYNASKFLVSRPNTRTCAMNIVALETQDSASYYCAAS
Apalone spinifera Vs356 igkv APJP01744773.1 1002 SIGQIVLTQTPESLAVSPGDTVTICCKASSSAYSYMAWYQQKSGQVPKLLISSTSTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQHY
Apalone spinifera Vs357 igkv APJP01744773.1 3645 SSGDIVMTQSPESLSVSVGESVTIRCKASSGIGDDIAWYQQKSGKAPKRLIYEASDRDTGVPDRFSGSGYGTDFTFTISRVEADDAGDYYCQHYYGTPL
Apalone spinifera Vs596 ighv APJP01473731.1 3387 GQCQVQLVQSGAEVKKPGDSLKISCKTSGFTLTSYYMSWLQQAPGKGPVWVGRIDPEDGATIYASSFKDRFTITTENSISTMYLQFSSLRAEDTAVYYCA
Apalone spinifera Vs590 trgv APJP01467927.1 762 GSSQVSLTQPQLSITREESKTIRIDCHVSVPGDFGQAYIHWYRQRSGAAPERILYISTQAVFDNNSEKEKFNADKRIGQPICTLTINKISSSDKATYYCAYWD
Apalone spinifera Vs295 trav APJP01629438.1 119 RSQGDSVSQSPPEVRISEGRSVTLHCNFTSSDPAPYLFWYRQGPDQPPQHILTKTKFDPPEQTPVQGKFSASLDIKNQTVPLRIEKVSPQESAVYFCALRP
Apalone spinifera Vs3 ighv APJP01008467.1 95 VRSQIQLVQSGPGAVKPGETLTLTCAVSGYTISSGYYWSWIRQAPGKSLEYMGYIIAASGSTYYAPAFQGRVTISADTAKNQVSLQLRSLTAADTATYYCARG
Apalone spinifera Vs626 ighv APJP01518498.1 2364 VLAQVQLVQSGPGVVKPGETLTLSCAVSGYSIASGYGWNWLRQPPGKGLEWMGYVYPAGGGSTEYAPSVQGRITISADTAKNQFSLQLRSLTAADSATYYCARGY
Apalone spinifera Vs189 trbv APJP01474156.1 3062 YSGAWINQTQSLVLEKGYRAQLTCQQTYGHNNMFWYRQEPGQSLQLLFVFVNKVKTDKGNVTDRYQAEQQQTGVLHLDISPVAPEDSALYFCASSL
Apalone spinifera Vs188 trbv APJP01474156.1 1873 LCSGVTVTQKEKFIAIQSGSEGRIPCEHNDNSYFTVLWYQQKKGAEKQLQLVATSVDVKNPAVIEEHFKTRYNMTRPTILNASLTINRGTVEDTAVYFCAASK
Apalone spinifera Vs187 igkv APJP01471705.1 2601 AKGQIVLTQTPESLAVSPGDTVTIRCKASSTANSNVAWYQQKSGQAPKLLVYSASTRPSGVPDRFSGSGSGTDFTFTISRVEANDAGDYYCQQAQSWP
Apalone spinifera Vs9 igkv APJP01057793.1 9173 SSGQIVLTQTPESLAVSPGDRVTINCKASSSLTHSSTGKELLAWYQQKSGQAPKLLIYYATTLHSGVPARFSGSRSGSDYTLTISSVETDDAGDYYCQ
Apalone spinifera Vs628 trdv APJP01520567.1 391 ARSDVVLDQGPQDLAVREGEEVTFPCSMTGGRMSSYWMYWYRKGQSGPLTWIYRQGGNYGAGFRGRFVGTDDSSNNRFPLRIRTAELRDRAVYLCAAR
Apalone spinifera Vs182 ighv APJP01466906.1 1554 ASSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTMNYINWARRAPGKGLEWIGRIYPGSGATDYAPAFQGRFALTRDTSMSTAWLQLGSLRADDTATYYCAR
Apalone spinifera Vs180 igkv APJP01465309.1 1343 VRGDVVMTQTPESLAVSPGDRVTINCKASSSVSSYVAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTLTITSFQADDAGSYYCQQYNDWS
Apalone spinifera Vs470 trav APJP01288763.1 368 GTSGEDKVNQTEGSVVISQGDPLRLNCTYEFSLTPTNLFWYVQYPGQAPRMLLRDLGRQDSDEGIRKGFGATHDKKDKSFPLWKQSIELSDSATYYCAGR
Apalone spinifera Vs451 ighv APJP01216468.1 419 ASGGPPQPKPSIANNKVPPLRHTCKASVFTFSSYWMLWVRQAPGKGLEWIGEIHSSSSTINYAQAFKGRFSFSRDNPNNLLHLQMTGLKPEDTARYYCV
Apalone spinifera Vs102 trgv APJP01360673.1 1174 VLWAIRLEQEQISVTKQPLQGSSAKFTCKVSGGSDSTYIHWYRARAREAPQRLLHLTLSGSQLAREPGFSSDKFSAYGRQSICVLLVHKLEAADSGHYYCAAWD
Apalone spinifera Vs453 trav APJP01217866.1 473 GTFGADTVTQTEGSVVISQGDPLRLNCTYEFSVTYPSLFWYVQYPGQAPRMFLRDLGRQDSDEGIRKGFNATVETQKKSFPLWKPAVELSDSATYYCAGS
Apalone spinifera Vs746 trbv APJP01717147.1 1457 LCEESEQVVLSQVPRWVTLKTGTVAILHCYQNNTDHGWMYWYRQPTAQLGPELIGVLIKGTPDPTFEEHFKDSRFSMARDNDRHCMLRINQLSSGDSALYFCAS
Apalone spinifera Vs156 ighv APJP01427747.1 228 ARSQVQLVESGGGVKKPGDSLRLFCKASGFTFSDYNMNWVRQAPGQGLESVVYISYAGGTIYYLDAVKGRSTISRDNPNNLLYLQMTGLKPEDTARYYCAGE
Apalone spinifera Vs791 ighv APJP01801604.1 1246 AWSQIQLVQPGAEVKRPGESMKLTCKASGYTFTDYSLAWFRQAPGKGLEWVATIRTDNFNTFYPEALKGRVTISVDTADSTTSLQLASLAAEDTSVYYCA
Apalone spinifera Vs208 trav APJP01509779.1 37 RSGANLVTQPNRTETIQEGELVRILCSYDYSGIPSLFWYEQRPPGPPRLLLTQYKASDKGEKRCRRGFSATLRSHSKSFPQEKSASEGSDAAVYYCALR
Apalone spinifera Vs162 igkv APJP01439031.1 763 AKGQIVLTQTPESLAVSPGDTVTIRCKASSSVSSYMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQGQSYP
Apalone spinifera Vs204 trav APJP01506528.1 1035 LALDQPSILQVSRGDSVTLTCSCEPCNFTDFHSQWEFCSGNGDQTPLKVIAMRASSKSRARDLGSKFSVTHQMNSQSLLIIKDLWINDTGTYICTITTRVPPP
Apalone spinifera Vs206 trav APJP01507966.1 79 GTFGADTVSQIEGSVAISQGAPLRLNCTYQFSFTPYPFWYVKYPGQAPRMLLRDLGRQDSDEGIRKGFNATHDEKDKSFPLWKPSVELSDSATYYCAAS
Apalone spinifera Vs687 ighv APJP01609850.1 593 ASSQIQLIQSGAEIKKPGESVKLTCKTSGYTFTANCINWVRQAPGKGLEWVGYICPSSGSTGYAPTFQGRVTITRDNSISTSWLQLGSLRADDTATYYCAR
Apalone spinifera Vs35 igkv APJP01289147.1 3229 ANGQIVMTQTPESLAVSPGDTVTIRCKASSSISGSYNYLGWYQQKPGQAPKLLIYLASTRASGVPDRFSGSGSGTDFTFTISRVEAGDAGDYYCQQYY
Apalone spinifera Vs36 iglv APJP01291524.1 919 ACSQPVLTQPSSASVSLGQTAKLSCTISGDYSPSSASLDWYQQGSGQAPRFVLRRTSSRGVGVPDRFTGSSSGNVAYLTITNVHAEDEADYYCALWYDGVAI
Apalone spinifera Vs30 ighv APJP01262936.1 592 VSSQIQLIQSGAEIKKPGESVKVSCKTSGYTFTSYDIHWVRQTPGKGLEWVGYINPSSGGTGYAPSFQGRVTITRDNSISTAWLQLGSLRADDTATYYCVR
Apalone spinifera Vs689 ighv APJP01612624.1 421 VLSQVQLVQSGPGTVKPGETLSLSCTVSGVSITDSSYVWNWVRQPPGKGLEWVGYVYPYNSGETSYAPSLQGRLTISGDTAKNQFSLQLRSLTAADTTTYYCAR
Apalone spinifera Vs761 ighv APJP01735704.1 996 AAAQAQLVESGGDTKKPGESLRLTCKGSGFDFSQFGLHWFRHAPGKGLEWVSVIIYDGSQAYYAESVKGRFTTSRDNSLSQAYLDMSSLKPEDTARYYCAA
Apalone spinifera Vs618 igkv APJP01505553.1 5215 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSLTSGSYHYLAWYQQKSGQAPKLLIYRASTRASGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQQDI
Apalone spinifera Vs614 ighv APJP01496629.1 319 VRCQVLVESGGDVKKPGDSLRLSCKASGVTFSSLYMDWVRQAPGKGLEWVAHINPSLWIAYADSVKGRFTISRDNSQGTMYLQMTGLKPEDTARYYCAGE
Apalone spinifera Vs613 trbv APJP01496131.1 4845 CQKTPILFQTPGRIIALNNSTTEIFCTMKSEQLSQLGVYWYRWSQKSQDFQYILYATVLNKYTHGNDIDKGRFTVTKESFRNSQTLRISRLQHLDAGTYYCTV
Apalone spinifera Vs611 ighv APJP01493015.1 735 LSKSHTVTQSGVEIKKPGESVKLTCKTSGYTFTSYYLSWVRQTPGKGLEWVGYIDPRDSETGYAQNFQGRFTITRDNSISTTWLQVGSLRADDTATYYCAR
Apalone spinifera Vs111 ighv APJP01370529.1 374 VQAKYKFEASGGGVKMLGDSLRLSCKTSGFNFGESWFSWVRHAPGKGLQWVATISKASGDTKSYAESVRGRFTISRSNYWKTLYLDMTRLSSEDTAEYYCIW
Apalone spinifera Vs444 igkv APJP01165304.1 6906 SSGQTVMTQSPESVSVPSVDGGSVSINCKASTSVGTYLNWYQQKPGQAPKLLIYYANKLQSGVPARFSGSGSGTDFTFTISRVEAEDATDYYCQQSYSF
Apalone spinifera Vs445 igkv APJP01165304.1 3543 CRAQTVMTQTPESLSVSVGDTVTIKCKASASISNNINWFQQKPGQVPKLLIYYTSNRYTGVPDWFSGSGSGTDYTFTISRVEAEDAGDYYCLQYTNLP
Apalone spinifera Vs693 iglv APJP01616405.1 854 SLAQYLLTQPPSMSVSPGQNAQLTCTGNSIGSGNVQWYQQKPGSAPLLILYDSRSRPSGIPERFSGTSSASQATLTITGIQAQDEADYYCQLWQNSINE
Apalone spinifera Vs443 igkv APJP01165304.1 10099 SIGQMVLTQTPESLAVSPGDTVTIRCKASSSASDGIAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQYQ
Apalone spinifera Vs117 ighv APJP01379151.1 742 ALSQLQFQESGPGAVKPGETLTLTCSVTGATITSSGYWHWIRQAPGQGLEWMGRWSGNTVYNPSLEGRIAITVDSSSSKYYLRLSALTAADTATYFCAR
Apalone spinifera Vs561 igkv APJP01408179.1 2959 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTGGSSHYLAWYQQKSGEALKLLIYLASTRASGIPDWFSGSGSGTDYTFTISRVEADDAGDYYCQQYYCFP
Apalone spinifera Vs560 igkv APJP01407953.1 737 ANGDIVMTQTPESLAVSPGDRVTINCKASSSVSSYVAWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDFTLTITSFQADDAGTYYCQ
Apalone spinifera Vs754 iglv APJP01730689.1 555 SSSQNVLTQPPSASVSPGNTVKLSCTVSSGTSVSNYYVFWYQQKQGNSPRHLLTYYSQSSQDQGSEVPARFSSSKDTSSNTGYLTIAGALVEDKADYYCAV
Apalone spinifera Vs290 iglv APJP01621527.1 52 VRSQPVVTQEPSMSVTPGEAVTLTCSLSTGAITSSNYPTWFQQKSGSVPRTVIYNTNSRPSGIPARFSGAISGNKAALTNTGVQAEDEADYYCIVWTGS
Apalone spinifera Vs297 trgv APJP01630420.1 1222 GCAQIQLKQAQLSITRAEARTARIHCEASSISNFRSAVLHWYRQRPGNAPERILYISTDKPVYDKETDKNKFDCEKQPDQLVSTLIISGLSLNDRATYYCAYWD
Apalone spinifera Vs564 trgv APJP01411255.1 2338 GCAQIQLKQAQLSVTRAEARTARIDCEASGMSNFRSAVLHWYQHRPGNAPERILYISTDKPVHDKETDQNKFDCIKKSDQPVSTLIINELSLNDRATYYCAYWD
Apalone spinifera Vs567 igkv APJP01414165.1 620 SSGQIVLTQTPESLAVSPGDTVTIRCKASSSVSGYMAWYQQKSGQAPKLLIYSASSRPSGIPDRFSGSGSGTDYTFTISRVEADDAGDYYCQCYYSSS
Apalone spinifera Vs174 trgv APJP01457101.1 753 GAAQVQLTQTQISITKVPKKTVRIDCKISGIDVGGAYIHWYRQIPGEAPEWLLYYKTQNDQSNFDKDKFSIDKTPGKPICTLTVDKLTYNDTATYYCATW
Apalone spinifera Vs175 trgv APJP01457101.1 3984 GAAQVQPTQTPLSITKPPDRTIRMDCKVEISNFENTYIHWYRQRLGEAPEWLLYFQSPTQQSSFDKEKFGVGKTSGKNTCTLAIHKVNSKDTATYYCAYW
Apalone spinifera Vs271 iglv APJP01598142.1 5237 SSSQNVLTQPPSASVSPGNTVKLSCTMSSGTSISGYTVYWYQQKPGNSPWFLLYYNSESSKGQGFGVPARFSGSKDTSSNTGYLTIAGALVEDEADYYCAV
Apalone spinifera Vs194 trdv APJP01491853.1 891 ARSDVVLDQGAHNLIVREGEEVTFSCSMNGGSMGSYYMYWYRKGQSGPLTWIYKEGDRYGEGFQGRFVGEVKSSENKFTLRIRTVELRDRAVYLCAAE
Apalone spinifera Vs178 ighv APJP01462679.1 1850 QLVETGPGTVKPAETLSLTCSISGASSDTLGSNCCWWHWVRQSPGKGLEWMGRIAQGGSTNYAASLQSRISISVNPPRNQFSLQLPSLTAADTATYYCAR
Apalone spinifera Vs179 ighv APJP01464032.1 125 VLSQVQLVQSGPGAVKPGATLSLTCKISGVSVSDYYWSWVRQPPGTGLEWVGFIRSTAQGGTTEYSPALKPRVTITRDTSKNEVYLQLGSLAAADTATYYCAR
Apalone spinifera Vs26 igkv APJP01241281.1 4011 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTYSSYQLLAWYQQKLGQAPKLLIYAGSSLQSGVPSRFSGSGSGTDFTLTINRVETDDAGDYYCQQHY
Apalone spinifera Vs25 ighv APJP01223564.1 137 ASSQIQLTQSGAEIKKPGESVKLTCKTSGYSFTSYYIHWARQAPRQGLEWVGEINPNSGGTKYAQAFQGRVTITRDNSISTVWLQLGSLRADDTATYYCAR
Apalone spinifera Vs23 iglv APJP01219925.1 16 CYAQVTQPPSASVSLEGNVQLSCTLEASYTVSSNRVTWVQQKPGSAPRFLLYFFTESNKGTGSGVPSRFAGSRSGSDKIGYLTITGAQEEDDAVYYCATWTGSA
Apalone spinifera Vs22 ighv APJP01215565.1 2167 ASSQIQLTQSGAEIKKPGESVKLTCKTSGYTFTDYCIHWVRQAPGKGLEWMGYICPSSGSTGYASAFQGRATITRDNSITTAWVQLGSLRADDTATYYCAR
Apalone spinifera Vs21 igkv APJP01199178.1 1124 SIAQIVLTQTPESLAVSPGDTVTIRCKSSSSASSNMAWYQQKTGQAPKLLIYSSSSRPSGIPDRFSGSGSGTDFTFTISRVEVDDAGDYYCQHYYSTP
Apalone spinifera Vs147 ighv APJP01417123.1 2323 QLKETGPGAAKPGESLTVTCTISGDSVSSTRATWDWVRQPPGKRPEWLGCTWYRSGRWYTEYPSPLQGRVTISPDTSRNQVLLQLRSLTAADTATYYCSG
Apalone spinifera Vs650 trav APJP01557870.1 325 SSMEDSVTQTQSSESALERESVSLDCTYETSLSDYYLYWYKQPPRGSFIILFEQYSEGRKSNKAGERFSVNFEKGKSSFSLRITALELGDAATYFCAFRR
Apalone spinifera Vs806 igkv APJP01824694.1 845 VKGQVVMTQTPESLAVSPGDTVTIRCKASSSVSSYMAWYQQKSGQAPKLLIYSASTRPSGISDRFSGSGSGTDFTFTISRVEADDAGDYYCQQGNNLP
Apalone spinifera Vs525 ighv APJP01363698.1 1459 VCSEVKLVPSGPGLVKPGETLTLSCTISGDSVTSTWWDWIRQAPGKGLEWVGEIDWSNSKWRINYGPNFQSRATLSADTAKNQFSLQLRSLTAADTATYYCAR
Apalone spinifera Vs801 igkv APJP01817332.1 776 SCGDIVMTQTPESLAVSPGDRVTVNCKASSSVSSYMAWYQQKPGQAPKLLIHSASTRASGIPDRFSSSGSGTDFTFTISRVEADDAGDYYCHQGYNYP
Apalone spinifera Vs602 igkv APJP01484767.1 1347 VSGQIVLTQTPESLAVSPGDTVTIHCKASSSLILGSYHRLGWYQQKSGEAPKLFIYYASSRVSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQHYSAP
Apalone spinifera Vs603 igkv APJP01484768.1 7507 SSGQIVLTQTPESLAVSPGDRVTINCKASSNITSSSSGKELLAWYQQKSGQAPNLLIYYATTLHSGVPARFSGSRSGSDYTLTISRVETDDAGDYYCQQGKSFP
Apalone spinifera Vs367 iglv APJP01767671.1 1055 VMSQPVVTQEPSMSVTPGGAVTLSCILSTGTMTSSNYPAWFQQKPGSVPRTVIYSPNIRPSGIPTRFSGAISGNNAALTITGVQAGDEADYYCIVWTGSA
Apalone spinifera Vs366 igkv APJP01766107.1 2037 ARGDIVMTQTPESLAVSPGDRVTINCKASTSISSNIAWYQQKSGQAPKLIFYGSSSRPSGIPDRFSGSGSGTDYTLSITSFQADDAGSYYCQQYNAWPL
Apalone spinifera Vs578 igkv APJP01440764.1 2037 SSGQTVLTQTPESLAVSPGDTITIHCKASSSLNYGSTPYQAWYQQKSGQAPKLLIYDGSTRPSGIPDRFTGSGSGTDFTLSIRNVQMEDAADYYCQQGF
Apalone spinifera Vs298 trav APJP01637588.1 106 GASGADTVTQTEGSVAISKGDSLRLNCTYELSFTPNNLFWYVQYPGQAPRMLLRDLGRLDSDEGNRKGFGATHEKQHKSFHLWKPSVELSDSATYYCAAS
Apalone spinifera Vs360 trbv APJP01748943.1 1180 YTGAEITQTESLVLAKGQTANLTCRQTDNHNNMYWYQQQQGKGLQLIYYSVAEKNMEEGDSKSGFSAFRPEIQVFYLDIPSVKPEHSAVYFCASSL
Apalone spinifera Vs442 ighv APJP01156651.1 330 VRSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSYDMNWVRQAPGKGLEWVARVSSPSGSSQWYSKAVEGRFTISRENSLNSVYLQLTGLKPEDTARYYCVR
Apalone spinifera Vs479 igkv APJP01303420.1 1111 CSGQIVLTQTPESVSVPVGGRVSINCKASTSIGTCLSWYQQKPGQAPKLLIYYANTLQSGVPARFSGTGSGTDFTLTISSVEADDAGDYYCQQCSSWP
Apalone spinifera Vs149 trbv APJP01419564.1 1695 HTGSEITQTASLVLEKGQTAQLTCRQTDNHDYMYWYQQQQGKGLQLVYYSVNVDNQDKGEVKEGFSASRPDTAAFYLNISSVKPEHSAVYFCASSL
Apalone spinifera Vs368 igkv APJP01770209.1 1081 SSADIVLTQTPEALAVSPGDKVTISCKASSAIYNNMAWYQQKPGQAPKLLIYSASSLQSGVPARFSGSGSGSSYTDYTLTISAVQAEDAGDYYCQHYYSSP
Apalone spinifera Vs143 igkv APJP01404752.1 9262 SSGQIVLTQTPESLTVSPGDTVTIRCKASSSLTGGSNHYLAWYQQKSGQAPKLLIDDGSSLQSGVLFRFSGSGSGTDFTLTINRVEAEDAGDYYCQL
Apalone spinifera Vs142 igkv APJP01404751.1 5428 AKGQIVMTQTPESLAVSPGDRITINCKASSSASNWMSWYQQKSGQAPKLLIYQASSRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCLQAQSWP
Apalone spinifera Vs141 igkv APJP01404751.1 869 SSGQIVMTQTPESLAVSPGDRVTINCKASASLTGSSSGKELLAWYQQKSGQAPKLLIYYATTLETGVPARFSGSRSGSDYTLTISRVEADDAGDYYCQQSKSLP
Apalone spinifera Vs91 iglv APJP01348135.1 2180 SSSQNVLTQPPSASVSPGNTVKLSCTMTSGPSISGYTVRWYQQKPGNSPRYLLRYKSDSDKHRGSGVPARFSGSKDTSSNTGYLTISGALAEDEADYYCAV
Apalone spinifera Vs301 igkv APJP01643188.1 1291 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTSSGFQLLAWYQQKSGQAPKLLIYLGSSLQSGVPSRFSGSGSGTDFTLTINRVEAEDAGDYYCQQ
Apalone spinifera Vs520 igkv APJP01355295.1 3648 ARGDIVMTQTPESLAVSPGDTVTIHCKASSSISGNYNYLAWYQQKTGQAPKLLIHSATTLASGIPDRFSGSESETDFTLTISRVEADDAGDYYCQQSYETP
Apalone spinifera Vs92 ighv APJP01348235.1 951 VLSQVQLVQSGSGVVKPGETLTLTCAVTGVSITSSSYSWNWVRQPPGQGLEWVVRIYPYDGRKWFAASLQSRTSISADTAKNQFFLQLASLALADSAMYYCAR
Apalone spinifera Vs96 ighv APJP01351612.1 147 ARSQPQLVESGGDVKKLEESLRLSCKASGFTFSSYDMSWIRQAPGKGLEWVGRIYTDGSQQFYAGSVKGRFTISRDNRKNLLSLQMTDLKSEDTARYYCAG
Apalone spinifera Vs783 iglv APJP01784478.1 1433 SLSQDVLTQPPSVSVSPGQNAQLTCSGDNIGSNAVNWYQQKPGSAPLLIIYNDDERHSGIPDRFSGASSGNTATLTITGVQAEDEADYYCQVWDSSDQ
Apalone spinifera Vs266 igkv APJP01594814.1 885 SSGQTVLTQTPESLAVSPGDAVTIRCKASSSAYDSMAWYQKKSGQEPKLLIYSASTRPSGIPDRFSGSGSGTDYTFTISRVEAGDAGDYYCQQHY
Apalone spinifera Vs784 ighv APJP01784538.1 791 ARSQELVESGGYVKKPGDSLRLSCKASGFTFSSYWMSWIRQALGKGLEWIGEINPSSATINYAQDFKGRFTISRDNPNNLLHLQMTGLKPEDTARYYCA
Apalone spinifera Vs118 ighv APJP01379312.1 1130 ARSQVQVVYSGGDVKKPGDSLRLSCKTSGFTFGDHWMHWFRLAPGKGLEWVAGISSGAGSRTYYADAVRGRFTISRDNPNNLLHLQLTGLKPEDTARYYCA
Apalone spinifera Vs16 igkv APJP01104019.1 174 SSGQIVLTQTPESLAVSLGDTVTIRCKASSSVSSWMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQKHDSSP
Apalone spinifera Vs292 ighv APJP01624226.1 1375 ARSQVLVESGGDVKKPGDSLSLSCKASGFTLSSVYMHWIRQAPGKGLEWVAAINADGSSQWYFQAVQGRFTIYGENPSNLLNLQLTGLKPEDTARYYCVK
Apalone spinifera Vs492 ighv APJP01316769.1 2750 VLAQVQLVQSGPGQVKPGETLTLTCTILGYSIARGRVWIRQHPGTGLEWMGWVYLYGSGGTAYAPSLQGQISISADTSRNEFSLQLCMLTAANTTTYYCAQQEP
Apalone spinifera Vs18 ighv APJP01145589.1 2448 VAAQAQLAESGGDTKKPGESLRLTCKGSGFDFSQFGLHWVRQAPGKGLEWVSVIYYDGSQEYYAASVKGRFTTSRDNSQSQAYLDMSSLKPEDTARYYCAA
Apalone spinifera Vs346 ighv APJP01721281.1 597 ARAQVRLVESGGDVRKAGDSLRLSCKASGFTFSSSYMDWYRQAPGQRPEWVAQIKPDASKQWYSKAVEGRFTISRDNTNSLLYLQMSGLTPEDTARYHCA
Apalone spinifera Vs776 igkv APJP01774675.1 2719 IRGDIAMTQTPESLAVSPGDRVTINCKASSSLTYSRTDYLSWYQQKMGQAPKLLIYHASTRASGIPDRFSGSGSGTDFTLTISRVEAEDAGDYYCLQTRSSP
Apalone spinifera Vs544 iglv APJP01390135.1 1370 LSSQSVLTQTQTSLSVAPGGRAQMNCTLEGVKFISENKPSWYQQRWGKAPRLLIYESRNRATGIPERFSGDTSNNIASLTITGVQAEDEADYYCGVWFSNS
Apalone spinifera Vs540 igkv APJP01385717.1 1765 TVMTQSPESLSVSVGESVTIRCKASSGISNNIDWYQQKSGKAPKHIIYEASTCDTRVPDRFSGSGSGTDFTFTISRVEADDVGDYYCQHY
Apalone spinifera Vs565 ighv APJP01411458.1 1059 ARSQISLVESEGDVKKLGDSLRLSCKASGFTFISYHMNWVRQAPGKGLEWVAFISDGGGTIYYLDTVKGRFTISKDNSKNLLSLQMTGLKPEDTARYYCA
Apalone spinifera Vs296 iglv APJP01629762.1 88 SSSQNVLSQPPSASVSPGNTVKLSCAMSSGTSISNYAMNWYQQKPGNSPRYLLRYKSDSDKHQGSGVPARFSGSKDTSSNTGYLTISGALVEDEADYYCAV
Apalone spinifera Vs371 ighv APJP01777109.1 564 MSISDLLQRVVHPGETLTLTCSVTGGTVTSSYWWNWIRQAPGQGLEWKERWAGSTNYNPSLQGRIAITVDSSSTKYYLRLSSLTAADTATYFCA
Apalone spinifera Vs468 igkv APJP01285466.1 465 AKGQIVLTQTPESLAVSPGDTVTIRCKASSTAYSYMAWYQQKSGQAPKLLIYSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDGGDYYCQQH
Apalone spinifera Vs375 igkv APJP01789206.1 4757 TRGDMVLTQTPESLAASPGETVTIHCKASSNLTLGSTHILAWYQQKTGEAPKLLMYNSSTPASGIPDRFTGSGSGTDFTLTIRNVQTEDAADYYCQKTF
Apalone spinifera Vs466 igkv APJP01278893.1 966 ANGQVVMTQTPESLAVSPGDTVTIRCKASSSVSNWVAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQSNNLP
Apalone spinifera Vs676 trbv APJP01594865.1 487 QTDAKITQTSSLVLERGQTAYLRCQQTYQHEGMFWYRQDTGQGLQLLFYFYYKEQREKGENLTRFQAAQPQDDLFRLNISSVQVEDSAVYFCASKF
Apalone spinifera Vs671 ighv APJP01589513.1 752 ARSQITLVESGGDVKKPGDSLRLSCKASGFTISSYYMSWVRQAPGKGLEWVASIYSSGYYNDAVKGRFTISRDDSNSLLHLQMTGLKPEDTARYYCAR
Apalone spinifera Vs670 trav APJP01589062.1 1006 GASGADTVTQTERNVVISQGDPLRLNCSYELSFTPYNLFWYVHYSGQAPRMLLRDLGRQDSDEGIRKGFGATHDKKDKSFPLWKASVELSDSATYYCAAS
Apalone spinifera Vs672 igkv APJP01589738.1 2012 AQGQIVLTQTPESLAVSPGDTVTIRCKASSSVSSYMAWYQQKSGQVPKLLIHSISTRPSGIPDRFSGSGSGTDFTFTISRVEADDVGDYYCQQGQSWP
Apalone spinifera Vs316 igkv APJP01680591.1 2400 SSGQIVLTQTPESLAVSPGDTVTIRCKASSTLTSGSDHYLAWYQQKSGQAPKLLIYDGSSLQSGVPARFSGSGSGTDFTLTINKVETEDAGDYYCQQYYSRP
Apalone spinifera Vs799 iglv APJP01815446.1 3840 PSSQQLLALKTSESVSPGGTVTLSCSLSSGTFSDNSYPQWIQQRPGNVPRRLIHGTSNRPAGVPEHFTASMAGNIMSLTITGALPEDNADYYCVAWSGDD
Apalone spinifera Vs790 iglv APJP01797721.1 4710 VRSQPVVTQEPSMSVTPGETVTLSCSLSTGAITSSNYPTWVQQKPGSAPRLLIYSTNSRPSGIPARFSGAISGNKAALTITGVQAEDEADYYCIVWTGSA
Apalone spinifera Vs157 ighv APJP01429559.1 319 VLSQVQLVQSGPGTVKPGETLTLSCSVSGFSISTQYYRWNWSRQPPGKGLEWIGRVYPYGGGIIEYASTLQGRITISGDTAKNQLSLQLHSLTAADTATYYCARD
Apalone spinifera Vs153 ighv APJP01421827.1 307 VLSQVQLVQSGPGAVKPGETLTLSCAVSGFSITTQHYLWNWIRQPPGKGLEWMGFVYPYNSGETGYAPSLQGRVTISGDTAKNQLSLQLRSLTAADTATYYCAR
Apalone spinifera Vs491 trav APJP01316222.1 333 SSMEDSVTQTQRSESALERESVSLDCTYETSEQYYYLYWYKQPPRGSLIFLLWQYSEGAEKNEAGERFSFNFEKGKSSFSLRITALELGDAATYLCAFRR
Apalone spinifera Vs654 igkv APJP01561503.1 1257 TSGQVVVTQSPESLLVSIGETVTIKCKSDTDIDDDMNWYQQKFGAAPKLLLSEGSARQTGVPDRFSSSGYGTDFTFTISGVEVDDAGDYYCQQSDRT
Apalone spinifera Vs701 trav APJP01628749.1 497 FRGNPLEISVAEGEPISFECRFNASSEMGNPFYEIIWMYTNSRNTSDRILQFRMTRPNTSAPVSVTAGHFRARLEFEKNTSSLSIPAVSMNDSGLYYCDVVIG
Apalone spinifera Vs559 igkv APJP01407953.1 4925 STGQKVLTQTPESLSVSPGDTVTIKCRASESVSTYLHWYQQKSGQAPKLLIYKASNRPSGIPDRFSGSGSGTDFTLTINRVEAEDAGDYYCHQSYIP
Apalone spinifera Vs456 ighv APJP01226647.1 309 TLKETGPGAAKPGESLTLTCTISGDSVSSTTADWNWIRQPAGKGLEWVGRIYYRPSRWYIDYASALQGRVTITQDTSKNQFSLQLRSLTAADTATYYCAR
Apalone spinifera Vs384 igkv APJP01795614.1 3793 SLGQVVMTQSPESLSVPLGGRVSINCKASTSIGSSLSWYQQKPGQAPKLLIYSATNLQSGIPTWFGGSGSGTDFILTITNVQADDAADYYCQQYNSSPL
Apalone spinifera Vs387 ighv APJP01798336.1 83 ARSQVVLTQSGPALKKPGEAHKLQCATSGFALSSYWMDWVRQQPGKGLEWLVRYYDPSYKYYAASVQGRFTASKDSANFYLQMNNLRAEDSAVYYCARE
Apalone spinifera Vs415 trgv APJP01012476.1 330 GEAQSIVLVQSQISITKAEDKTAQIHCHVSGITFSSAYIHWYRQRRDAALERILYLSSGKPEFDQKSEKGKFEAEKKHSHSICILTVKKATKSDEATYYCAVW
Apalone spinifera Vs383 trbv APJP01794120.1 92 YTGAKITQTSSLVLNREEAAKLTCRQTDDHSYMYWYLQRQGKELLLIYYSLGRDTTQEGDSNIKGFTASRPDIAAFDLNISPVKLEHSAVYFCASSL
Apalone spinifera Vs631 igkv APJP01522353.1 2672 SSGQKVLTQTPESLSVSLGDTVTIKCRASESVSTYLHWYQQKSGQAPKLLIYNASNRPSGIPDRFSGTGSGTDFTLTISRVEAGDAADYYCQQGYTP
Apalone spinifera Vs327 igkv APJP01690820.1 2261 ARGDIVMTQTPESLAVSPGDRVTIKCKASSSLTYLGSNYLAWYQQKRGQSPKLLIYGASTRASGIPDRFSGSGSGTDFTLTISRVEADDAGDYYCKHNYETP
Apalone spinifera Vs739 ighv APJP01698454.1 745 ARSQVQLVESGGDVKKPGDSLRLSCKASGFTFSSSNMNWVRQAPGKGLEWVAYIRYDGGIIHYLDAVKGRFTISRDNSNNLLHLQMTSLKPEDTARYYCA
Apalone spinifera Vs328 igkv APJP01690820.1 5805 AKGQIVLTQTPESVAVSPGDTVTIRCKASSSISSYMAWYQQKSGQAPKLLIPSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQAAGLP
Apalone spinifera Vs127 ighv APJP01391917.1 3396 SMAAVTLTQPPSARAAPGGSLTLDCVVSGYNIDNHHLHWVRQAPGKALVWVTAFRRGYNTITAKEFEGRVTPSTSGSTARLRIDRLTAADTATYYCARE
Apalone spinifera Vs126 igkv APJP01391755.1 1344 SRGQIVLTQTPESLAVFPGETVTIRCKASSSLTSGSYQLLAWYQQKSGQAPKLLIYEASTRPSGIPDRFTGSGSGTDFTLTIRNVQTEDAADYYCQQGYS
Apalone spinifera Vs78 igkv APJP01334336.1 2925 SSGQIVMTQTPESLAVSPGDTVTINCKASASLTSSYSGKELLAWYQQKSGQAPKLLIYYATTLHSGVPARFSGSRSGSDYTLTISRVEADDAGDYYCHESKS
Apalone spinifera Vs73 igkv APJP01332144.1 1272 TNGDIVMTQTPESLAVSPGDRVTINCKASSSVSSYMAWYQQKSGQAPKLIFYGSSSRPSGIPDRFSGSGSGTDFTLTITSFQADDAGTYYCQQYDERP
Apalone spinifera Vs76 trav APJP01333421.1 291 LLQAQTVSQPAGETKVKEGGNVTLECSYDSGFPTLLWYRQDPPGSPQLILHEGSRPEDLGARFRNRFTARINKTSRVFPLDITSAQLSDSATYYCVLR
Apalone spinifera Vs717 trav APJP01656445.1 402 APSEERIQIQQSPGQMWLTPGQTAKLDCSHSLQGQRALWYKEQPSGSLQRIDQSSPSDGRYSSTVNTSANRFSLIISDVQRDDSGVYFCGLNAY
Apalone spinifera Vs381 ighv APJP01794049.1 258 ARSQITLVESGGDVKKPGDSLRLSCKASGFTFTSYWMGWVRQAPGTGLEWLASIAGSSIYYSDSVKGRFTISRDDPKNLLHLQMTGLKPEDTARYHCVR
Apalone spinifera Vs718 trgv APJP01658388.1 558 NGHTHKKVTQTPMSITRQESKTAVMHCEISGATINSEYIHWYRQSPGAAPKRILYTQAKSVTVDEGIDKERFEVSDVPSKPISILRMHQLTPEDTAMYYCAVWD
Apalone spinifera Vs719 igkv APJP01658682.1 2010 SKGQIVLTQTPESLAVVPGETVTISCKASSSLTDEDLSIDFLAWYQQRPGQAPKLLIYAASTLEDGIPDRFSGSGSGTDFTLTISRVEADDAGDYYCQQSNETPL
Apalone spinifera Vs257 igkv APJP01585784.1 2242 ATGETVLTQTPESLAVSPGDTVTIRCKASSSVYSYMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVETDDAADYYCQHFY
Apalone spinifera Vs524 igkv APJP01360708.1 1032 STGQKVLTQTPESLSVLPGDTVTIKCRASESVSTYLHWYQQKSGQAPKLLIHSASTRPSGIPDRFSGTGSGTDFTLTISRVEAEDAGDYYCHQNYIP
Apalone spinifera Vs659 ighv APJP01572357.1 1336 ARPKPEFVASGGEVKMLGDSLRLSCKTSGFNFETFNMDWVRHTPGKGLQWVAYISRSSGETTSYADSVTGRFTISRDNSRGLLYLQMTNLRREDAAEYYCG
Apalone spinifera Vs80 trbv APJP01336636.1 1657 SLFLLGVVSTYVEQPPFLTEVEGRSLALECILKKSNCDRMFWYRQRESRELEGLFYSYGNQLMNFTAESMLAQRKNKNWHLQWNNLSQLDSAVYYCAC
Apalone spinifera Vs251 igkv APJP01573201.1 1099 CSAQTVMTQTPESLSVSVGDTVTIKCKASASISNNINWFQQKSGQAPKLLIYYTSNRDTGVPDRFSGSGSGTDYTFTISRLEADDAGDYYCLQYNSNP
Apalone spinifera Vs399 igkv APJP01817922.1 2696 SSGDTVMTQSPESLSVSVGESVTIRCKASSGITNDIAWYQQKSGKAPKLLIYEASTRGTGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYNNWP
Apalone spinifera Vs652 ighv APJP01560556.1 1783 ARSQISLVESGGDVKKPGDSLRLSCKASGFTFSSYWMSWVRQTPGEGLEWVAAINSGGGTTHYLDAVKGRFTISRDNSNNLLSLQMTGLKPEDTARYHCA
Apalone spinifera Vs400 igkv APJP01817922.1 6898 PVGGRVSINCKASTSGERVSINCKASTSISNILHWYQQKPGQAPKLLISYASSLQSGVPARFSGSGSGTDFTLTISSIEADDAGDYYCQQSSNWP
Apalone spinifera Vs513 igkv APJP01341499.1 430 SIGQIVLTQTPESLAVSPGDTVTIRCKTSSSVSTAMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYY
Apalone spinifera Vs88 ighv APJP01346758.1 116 VQTQVRFVETGGGVKRPGDSSHLSCTGSGFSFGDNWLSWLRWSPGKGLEWVATISFWAGDTKRYAASVTGRFSISRDNAKSTLHLQMNRLKPEDAGIYYCSQ
Apalone spinifera Vs390 iglv APJP01801836.1 204 SSSQNVLTQPPAASVSSGNTVKLSCTMTSGTSICGYDVSWYQQKPGNSPRYLLRYKSDSDKHQGSGVPAHFSGSKDTSSNTGYWTISGALEEDEADYYCTV
Apalone spinifera Vs391 igkv APJP01804180.1 1043 SSGQVVLTQTPESLSVPVGGRVSINCKASTSISNNLYWYQQKPGQAPKLLIYSASSLQSGVPARFSGSGYSTDFTLTISSVEADDAGDYYCQQSNELP
Apalone spinifera Vs235 ighv APJP01549301.1 154 QLKETGPSAAKPGESLTLTCTISGDSVSTDKAAWPWLRQPAGKGLEWAGRTWYRSGQWNTEYASALRGRVTLPADTARNQVSLQLRALTAADTGTYYCARQ
Apalone spinifera Vs234 trav APJP01547887.1 292 RVQGDSVAQWPPEIRISEGRSVTLHCNFTTSYSNPDLFWYRQGPDQPPQHILTKTKFDSPEQTPVQGKFSASLNMGNKTVPLRIEKVSPQESAVYFCALR
Apalone spinifera Vs236 ighv APJP01549697.1 572 ALSQLRLQESGPGTVKPGEILTLTCSVTGGTVTTSYGWNWIRQAPGQGLEWIARWRGSSNINYNPSLQGRITITVDSSSTKYYLRLSSLTAADTATYFCAR
Apalone spinifera Vs338 iglv APJP01704181.1 1753 VRSQPVVTQEPSKSVTPGGAVTLTCSLSTGAITSSIYPGWFQQKPGSAPQTVIYFSDKRPSGIPVRFSGAVSCNDAALTITGVQAEDESDYYCAVWTGIV
Apalone spinifera Vs233 igkv APJP01546049.1 2317 ARGDIVLTQTPESLAVSPGDRVTINCKVSFSYSYSGTNYLAWFQQKRRQAPKLLIYLGSTRASGIADQFSGSGSGTDFTLTISRVEAVDAGDYYCQQS
Apalone spinifera Vs580 ighv APJP01450089.1 1101 VSSQVQLTQSGSEIKKPGESVKLTCKTSGYSFTSNYIHWARQAPGQGLEWVGRISPYSGITDYAPAFQGRVTITKDNAMSTAWLQLGSLRADDTATYYCAR
Apalone spinifera Vs239 igkv APJP01556595.1 2842 TNSDTVMTQTPESLLVSPGDSVAINCKASASIGHQIGWYQQKSGQPPKLLVYAASTRHSGVPDRFSGSGSGTHYTLTITNFQADDTGTYHCLQDKSFPL
Apalone spinifera Vs61 igkv APJP01325854.1 495 AKGQIVLTQTPESLAVSPGDTVTIRCKASSSVGSYMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQTAGLS
Apalone spinifera Vs67 igkv APJP01329188.1 19404 AKGQTVMTQTPESLAVSPGDSVTIRCKASSSVSNWVAWYQQKSGQAPKLLIHSASTRPSGVPDRFSGSGSGTDFTFTISRVEADDAGDYYCYQGYSLP
Apalone spinifera Vs66 igkv APJP01329188.1 10109 AKGQIVMTQTPESLAVSPGDTVTIRCKASSSVGTAMAWYQQKSGQAPKLLIHSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGAYYCQQGYSLP
Apalone spinifera Vs65 igkv APJP01329188.1 3678 AKGQIMMTQTPESLAVSPGDTVTIRCKASSSVSSYMAWYQQKSGQAPKLLIYRASNRPSGIPDRFSGSGSGTDFTFTISRVEADDVADYYCQQGDS
Apalone spinifera Vs437 igkv APJP01123121.1 3845 ASGQIVMTQTPESLAVSPGDTVTIRCKASSSVSSYVAWYQQKPGQAPKLLIRSASTRPSGIPDRFSGSGSGTDFTFTISRVEADDAGDYYCQQYQS
Apalone spinifera Vs645 trav APJP01551499.1 1222 GTFGADSVTQTEGSVGITHGDGLRLNCTYTFSGTPYLFWYVQYPGQGPRMLLRELGGQDSDEGIRRRFGATLDEQNKSFPLWKASFELSDSATYYCAGS
Apalone spinifera Vs433 igkv APJP01099746.1 770 ARGDIVLTQTPESLAVTLGDRVTINCKASSSLTDSGSDYLGWYQQKMGQAPKLLIYLASTRTSGIPDRFSGSGSGNDFTLTISRVEADDVGDYYCQTGYETP
Apalone spinifera Vs432 igkv APJP01099746.1 3359 SSGQIVLTQAPESLAVSPGDTVTIRCKASSSVTSGSTHYIAWYQQKSGQAPKLLIYYASTRASGIPDRFSGSGSGTDFTFTISRVEAGDAGDYYCQ
Apalone spinifera Vs642 ighv APJP01539830.1 1697 GVRSEIQFVQSGAEVKKPGESLKLSCKASGYTFNEYRMSWLRQAPGKGLEWVASIRTDTFETFYPSHLKGHVTISVDVPLSTAYLQMGSLGPEDTAVYYCAR
Apalone spinifera Vs643 trbv APJP01539832.1 2208 VRSATILQSPQSVVEELGRNASLECSLEGTSNPNIYWYRQLPSGVINMLAYSIGISQEDNTGPSHFKASRTKDTMLLLNIKGLLANDTGMYYCAWS
Apalone spinifera Vs726 ighv APJP01669831.1 1790 ARSQLQLVESGGDVRKPGDSLRLSCKASDFTLSSYWMHWIRQAPGKGMEWIASIYSSGYYSDSVKGRFTVSRDDSKNLLHLQLTGLKPEDTARYYCARE
Apalone spinifera Vs648 igkv APJP01556989.1 4376 AKGQIVLTQTPESLAVSPGDTVTIRCKASSSVYSNMAWYQQKSGQTPKLFIYDATTRPSGIPDRFSGSGYGTDFTFTISRVEAEDAGDYYCQQYQS
Apalone spinifera Vs649 igkv APJP01556989.1 1698 SKGEIVMTQTPESLAVSPGDSVTIHCQASEDITGTYTYLAWYQQKAQEVPKLLIYRVSTRTSGIPDRFTGSVSGTDFTLTISNFQAEDAGDYYCQQIYS
Apalone spinifera Vs439 trgv APJP01150606.1 1919 GAAQVQLIQTQLSITKKPDSTARISCKVDGINFGDAYIHWYRQRPGEAPEWLLYFKTERDKSYSKEDEFRVEKTPEKSCILTVQKVTYSATYYCAYWD
Apalone spinifera Vs405 ighv APJP01824862.1 757 ARSQVQLVESRGDVKKPGDSLRLSCKASGFTFTAYWMQWVRQAPGKRLEWIGEIHPSSSSISYTQAFKGLFTIARDNPNNLLYLQMTGLKPEDIARYYCTA
Apalone spinifera Vs241 igkv APJP01561647.1 19 ARGDIMLTQTPESLAASPGDRVTTNCKVSFSLTYSGTNYLAWYQQKRGHASKLLICLASTRTSGIPDRVSGSGSGTDFTLTISRVEAEDAGDYYCQQSYETP
Apalone spinifera Vs244 trav APJP01563377.1 232 SSMEDSVTQTQRSESALERESVSLDCTYETSAAGYYLYWYKQPPWGSLIFLFRQYSGGTKSNGAGERFSVNFEKGKSSFSLRITALELGDAATYFCAFRR
Apalone spinifera Vs245 trav APJP01564132.1 2380 AASEEGIQILQSPAQLWLNSGQTAQLDCRPPKKEWRVMWYKEQSGSLQWIYQCSRFAPSNEKYFCNVTVTANTFSLMISTIQRNDSGVYYCGLADS
Apalone spinifera Vs528 ighv APJP01372472.1 1312 VRPKVQLVESGGRIQQPGGSLRLSCKASRFTFSSYHLSWVQQAPRKGLEWVSWTCNPTNSHSTCYSDVVKGRFTISRDNSSSLVYLQMNSLRAEDTARYYCAR
Apalone spinifera Vs248 igkv APJP01570671.1 1614 SRGQIVLTQMPESLAASPGDRVTINCKASSSAGGWVAWYQQKSGQAPKLLIYNAATRASGVPDRFSGSGSGTDYTFTISRVEAEDAGDYYCQQYSSA
Apalone spinifera Vs538 iglv APJP01385272.1 1071 SLAQYVLTQPPSVSVSPGQNAQLTCSGNNIGSKNVQWYQQKPGSAPLLVIYNSNSRPSGIPDRFSGANSGNTATLTIAGVQAQDEADYYCQVWDSSA
Apalone spinifera Vs539 igkv APJP01385716.1 2331 CVGQVVMTQTPESLSVPVGGRVSINCKASTSISTYLSWYQQKPGQAPKLLIHSATSLQSGIPAWFSGSGSGTDFILTITNVQADDAGDYYCQQTNELP
Apalone spinifera Vs562 igkv APJP01408179.1 486 ARGDIAMTQIPESLAVSPGDRVTINCKASSSLTYSGSDYLAWYQQKRGQAPKLLIYLASTRASGIPDRFSGSGSGTDFTLTISRVEAEDAGDYYCLQSRSSP
Apalone spinifera Vs52 igkv APJP01314561.1 1111 ARGDMVLTQTPESLAVSPGDRVTINCKASSSLTYSGSDYLAWYQQKAGQAPKRLIYLASTRASGTPGRFSGSGSGTDFTLTISRVEADDAGDYYCQQHSSSL
Apalone spinifera Vs220 trav APJP01533817.1 294 APGRAEIEQPGSAESLEGAELNLSCSHDGIKGNDYIYWYRQFPGRGPQYIVQGFKENVQTSDPKGALHISGDRKSSALALRRARLADAAVYYCALS
Apalone spinifera Vs51 igkv APJP01313294.1 1594 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSAYGYVAWYQQKSGQAPKLLIYSASTRPSGVPDRFSGSGSGTDYTFTISRVEADDAGDYYCQNSYNTP
Apalone spinifera Vs344 trgv APJP01717215.1 190 GSSQVRLTQPQQFRTSEQSKTIRIDCRVSVRDFGQAYIHWYRQRPGAAPERILHVSTKVAFDRASDKGKFNAEKKKIGHPTCTLFIYKTSFSDTATYYCAYWD
Apalone spinifera Vs229 igkv APJP01544184.1 1160 ASGDIVMTQTPESLAVSPGDRVTINCKATASFSSSLAWYQQKTGQAPKLLIYSASTRPSGIPDRFSGSKSGTDFILTITSFQADDAGSYYCQQYYELP
Apalone spinifera Vs738 trgv APJP01697896.1 1448 GSSQVSLTQPQLSITREESKTIRIDCRVSVPGDFGQAYIHWYRQRPGAAPERILHVSTKVDLDKVSDKGKFNAEKKISQPTCTLIIYKTSFSDTATYYCAYW
Apalone spinifera Vs421 igkv APJP01020722.1 4318 SSGQIVLTQTPESLAVSPGDTVTIRCKASSTLTSGSYQYLAWYQQKSGQAPKLLIYLGSSLQSGVPSRFSGSGSGTDFTLTINRVEAEDAGDYYCQQSRSYP
Apalone spinifera Vs425 ighv APJP01036341.1 1597 ARSQITLVESGGDVKKPGDSLRLSCKASGFTFSSYWMGWVRQAPGKGLEWLAYIHGSSTYYSDSIKGRFTVSRDDPNNLLYLQMTGLKPEDTARYYCVK
Apalone spinifera Vs426 ighv APJP01036341.1 885 QLQETGPGAAKPGESLTLTCAISGDSVFSTSTEWNWVRQPAGKGLEWVGRIYYRPSSWHTNYASALQGRVTITQDTAKNQFSLQLRSLTAADTAPYYCAT
Apalone spinifera Vs583 iglv APJP01453199.1 2279 SLAEYVLTQPPSVSVSPGQNAQLTCSGNNIGSKSVHWYQQKPGSAPLLVIYGDSSRLSGIPERFSGANSGNTATLTITGVQAQDEADYYCQVWDSSSDQ
Apalone spinifera Vs655 trbv APJP01565372.1 1277 STDVRLNQTLNVVEEREKTVQLQCEQNADHDYMYWYQQHQGKGLHLIYYSYDTSEVKQGNISERFKGTRLQTQRFHLNISSLKPEDSAVYFCASSL
Apalone spinifera Vs742 trbv APJP01714493.1 1625 GTDAGLTQTPNLILMTGQTAHLRCEQTDEHYIMYWYWLQQGKGLQLIYSSVINSVQSEGDDSIQGFTASRPEIALFHLTISSVTVNHSAVYFCTNSRSAEE
Apalone spinifera Vs788 trbv APJP01794122.1 2605 YTGAKITQTSSLVLNREEAAKLTCRQTDDHNYMYWYLQQQGKGLQQIYYSTGKDVTNEGDSDIKGFTASRPEINTFDLNISLVKPEHSAVYFCASSL
Apalone spinifera Vs269 trav APJP01596507.1 217 LAQGDSVSQWPPEVRISEARSVTLHCNFTTSDSDPNLFWYRQGPDQPPQHILTKAKYNALDQTPVHGKFSASLHKENNTVPLRIEKVSPQESGVYFCALR
Apalone spinifera Vs782 trgv APJP01781595.1 2664 GEAQVLVQSQLSLTRVEDKTARIDCRVSGITFSSAYIHWYRQRRDAALERILYLSSGNPKFDQDSEKAKYEAEKQLSESNCVLTVKKITKSDAAIYYCAVW
Apalone spinifera Vs395 ighv APJP01808697.1 1364 ASSQIQLTQSGAEIKKPGESVKLTCKTSSYTFTRYYLSWVRQAPGKGLEWVGYIDPSDGETGYAQNFQGRFTITRDNSISTTWLQLGSLRADDTATYYCAR
Apalone spinifera Vs481 ighv APJP01306791.1 1288 ARSQVQLAESGGDVKKPGDSLRLSCKASGFTFSSYGMNWVRQAPGKGLEWISRIYSDGSQQFYADSVKGRFTISRDNSNNLLHLQMTDLKAEDTARYYCAR
Apalone spinifera Vs711 igkv APJP01646548.1 1854 SSGQIVMTQTPESLAVSPGDTVTIRCKASSSLTTGGDNHLAWYQQKSGQAPKCLIYLASTLQSGVPAQFSGSGSGTDYTLTISRIESEDAGDYYCQQ