WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Felis catus ACBE00000000.1 (ACBE01) 147 27 51 6 37 15 7 4
Felis catus AANG00000000.3 (AANG03) 221 49 72 14 52 21 6 7
Felis catus AANG00000000.4 (AANG04) 134 7 34 13 43 21 6 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Felis catus V8 trbv ACBE01534696.1 2577 PVNAGITQTPAFQILGAGHSMTLRCEQDKDHDYMSWYRQDPGHGLRLIHYSVSAGTTERGEISNGYNVSRSNTKNFPLTLTSATPSQTSVYFCASSD
Felis catus V9 trbv ACBE01534696.1 4221 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHVGLYWYRQAVGQGPEFLVSFQNEDKVDSSGMPSNDRFQVNRSEGSYSILQIQRAEPGDSAVYLCASSP
Felis catus V0 ighv ACBE01498774.1 97 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSIYWMHWVRQAPGKGLQWVANIYTDGSSTNYADSVKGRLTISRDNSKNTLYLQMNNLRTEDTATYYCAR
Felis catus V1 trbv ACBE01534673.1 2099 TVFSALLSQKPHRDICQRGTSVTIHCEVDIQFTLMFWYHQLPGQSLVLMATTNQGLEATYEHGFTKDKFPISRPTLVFSTMTISNVSLEDSSFYFCSAG
Felis catus V2 trbv ACBE01534685.1 6439 SMDTQVTQSPRYLVRGKKQSAKMNCIPVKGHSYVYWYRRKLEEFKFLVYLQNEDILDKIEKFEDQFSAQCPKNSPCSLKIESTEPGDSALYFCASSK
Felis catus V3 trbv ACBE01534686.1 5528 PMNAGVTQNPEHLVRGTGQEATLRCSPEKEHNYVYWYQQLPGEGLKFMVYLQKENILDDSGMPTKRFSAEFPKEGPSVLKIRLAELGDSAVYFCASSL
Felis catus V4 trbv ACBE01534686.1 12244 GSGLGALVSQDPRTAVCKSGTSVMIQCHSVGIQAITVFWYRQFPEQGLTLMATSNVDSKAAYEQGFSETEFSISHPNTTFSSLTVRSAKPADSSLYFCSAS
Felis catus V5 trbv ACBE01534694.1 1043 PMDAEITQNPRYKVTGTGKRVILKCDQTENYDYMYWYRQDPGHGLKLIYYSNGFDSINKGDVPDGYAVSRKNMEDFPLVLESATSSQTSVYFCANSY
Felis catus V6 trbv ACBE01534695.1 2354 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHVGLYWYRQAVGQGPEFLVSFQNEDKVDSSGMPSNDRFQVNRSEGSYSILQIQRAEPGDSAVYLCASSP
Felis catus V7 trbv ACBE01534695.1 9221 PAGAGVTQSPRHLVKGSGGKAVLKCRPMSGHRSVSWYQQAPGQGPQFLIELFGQETREKGNLPSHFSVEQFSDDSSQLNMSSLELGDSASYLCASSL
Felis catus V10 trbv ACBE01534696.1 13883 PVEAGVTQTPRYLIKARGQQGTLRCSPISGHSSVSWYQQALNQGPQIIFEFFEYAQRTKGNFPDRFSGQQFHDYASELHVSSLEPTDSAVYLCASSL
Felis catus V11 trbv ACBE01534698.1 3417 PADSGLTQTPRHLVKARGQQVTLSCFPISGHLSLYWYQQAVGQGPQLLIQYYNREERGKGNFPERFSAQQFPDSHSELNMTSLELTDSALYLCASSP
Felis catus V12 trbv ACBE01534702.1 1532 PLDTAVSQTPKYLIAQMGTEKLLQCEQKLSHDAMYWYKQDSKKLLKIMFAYNNKELVHNETVPSRFSPKSPDKAHLNLRVRALETGDSAVYLCASS
Felis catus V13 ighv ACBE01574039.1 3772 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYSMNWVRQAPGKGLQWVAYISSSGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V14 ighv ACBE01577613.1 3030 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFRSYWMNWVRQAPGKGLQWVSAISGSGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAK
Felis catus V15 ighv ACBE01577623.1 1318 VQCDVQLVESGGNLVKPGGSLRLTCVASGFTFSSYDMSWVRQAPGKGLQWVAYIYDDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V16 ighv ACBE01577627.1 649 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYGMSWVRQAPGKGLQWVAYIRYDGSSTNYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAT
Felis catus V17 trgv ACBE01067315.1 6024 GMAAISLTQRAVVVERVGGLANLSCQASASVSYIHWYLHQEGTDPKRILRLDKSRLSVQRYGGLEADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Felis catus V18 trgv ACBE01067318.1 461 DVAAISVEQPAVVVARAGSWATLPCKASTSVSYIHWYRHQEGTAPKRILMLDMSSSYVTKDGVLTADKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEDQ
Felis catus V19 trgv ACBE01067320.1 5403 GVAAISLTQQAVVVERVGGLATLSCQASAYVRYIHWYLHQEGTAPKRILMLDMSRLSVQRYGGLKADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Felis catus V20 trgv ACBE01067323.1 31 GQRSAWGSPSMVVAQAGRSATLGCKASTKVSYIHWYHHQEGAAPKRLLRLDMSGTFVQKDGGLNEDKVNAKRGKGSNSCDLSVLELEKSDEGVYYCAAWE
Felis catus V21 trgv ACBE01067330.1 833 GLAETRLEQPALIMARTGSSAILSCRARTKVSYIHWYRHQEGKAVQRLLIVALYRSYVQTDSILKGDKVTAKRGTDGSSCNLLLLKLEKSDEGVYYCAAWE
Felis catus V22 igkv ACBE01107189.1 195 SGADVVMTQTPLSLPVTPGEPASISCRASQSLLHSDGNTYLNWYLQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCLQGTKYP
Felis catus V23 trav ACBE01202353.1 17437 GSCKTEIIQSSNITAIIGTDVEFPCQYNIPDKNFESVYWYLQRADQRFTYIGHTSQGTVELEHYQLFVNRKLLSSTLTIKHVQPRDKAIYYCAV
Felis catus V24 trdv ACBE01202386.1 861 SSNTQSITQSPSSVQEKEGESVTLDCRFTLNFDYYVMSWYQQLSNGKMTEIIYLVSTSTNTREGRYSVSHWARDKTLRLTITGLMPTDSGIYFCAVGEA
Felis catus V25 trdv ACBE01202387.1 1609 SSNTQSVTQTPGPVNKQERESVSLHCSFTLSYTYYVMSWFRQLSNGKMTEIINLYSTSTNTKKGRYSVSHQKGNKALSLTITGLMPTDSGVYFCAVGEA
Felis catus V26 trav ACBE01202390.1 730 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTSDSNYYLFWYKQPPSREMLLIIRQEANKQENATNNRFSVNFQKADKSFSLRISAAQLGDAAMYLCALME
Felis catus V27 trav ACBE01202393.1 813 ASGKNGVEQSPQSLTAQEGNFVTINCSFSVGMTALHWLQQNPGGGIVSLFILSLEMKKKGRIRATINTEELHSSLYITASQPRDSAIYLCAVE
Felis catus V28 trav ACBE01202406.1 898 VSSQELEQSPRSLIIQEGEDFTINCSSSKTFYTLGWYRQKNGEGLSSLMMLQKSGEEKTHEKITAKLDEKKQQTSLHITASQPSHSGIYLCAGD
Felis catus V29 trav ACBE01202418.1 2237 VNSQQNADQQQVKQTPSLSVQEREISILNCDYNNNMFDYFIWYKKYPAKSLEFVISIRSTVDKNEDERFTVYLNKSAKHLSLHIAASQPGDSALYFCTAN
Felis catus V30 trav ACBE01202424.1 524 VNGQEIKQIPQFLLLQEGENFTIYCNSSRTLNSLHWYKQRPGGSPILLITLVKSGDVKQERLTAWFGDTRKNSLLHMVATQTADSGVYFCTGAQCSQ
Felis catus V31 trav ACBE01202424.1 2903 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGTTYVFWYVQYPNQGLQLLLKYISGDTLVKGLNGFEAEFKKSETSFHLRKSPALGSDAAEYFCAVS
Felis catus V32 trav ACBE01202433.1 1529 VTGLMVKQSPPDLSLQEGLSCTLQCSFSTSVTRVQWFRQNPGGHLIHLFYIPSGTKQNGRLRSTTVVEDRRSLLYISSSRTTDSAIYFCAGAE
Felis catus V33 trav ACBE01202435.1 593 GTGAQSLTQPDGHITVSEGARLELSCNYSSSGTTYLFWYVQHPNQGLQFLLKYLSGPSDALVQGIKGFEAEFKKSEKAFHLRKHSAHWSDSAKYFCAVS
Felis catus V34 ighv ACBE01217354.1 2858 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFTDYYMHWLRQAPAQGFEWMGSIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAVYYCGR
Felis catus V35 ighv ACBE01217356.1 2804 VQCEVQLVESEGDLVQPGGSLRLTCVASGFTFSSASMSWVRQAPGKGLQWVSAISSGGSTNFADSVKSLFTISRDNAKNTLYLQMNNLKTEDTATYYCAK
Felis catus V37 ighv ACBE01217478.1 929 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYGMSWVRQAPGKGLQWVAAISYNGGSTGYADSVKGRFTISRINAKNTLYLQMNNLKSEDTATYYCAT
Felis catus V38 ighv ACBE01217479.1 1760 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTYSSYYMHWVRQAPGKGLQWVAYIYTDGSSTNYADSVKGRFTISIDNSKNTLYLQMNSLKTEDTATYYCAR
Felis catus V39 ighv ACBE01217480.1 942 VQCDVQLVESGGDLVQPGGSLRLTCVASGFTFSSYSMNWVRQAPGKGLQWVAYIRYDGGSTAYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAK
Felis catus V40 ighv ACBE01217514.1 1899 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMNWVRQAPGKGLQWVSWINTDGSSTSYADSVKGRFTISRDNSKNTLYLQMNNLKTEDTATYYCTR
Felis catus V41 ighv ACBE01217541.1 9890 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYEMSWVRQAPGKGLQWVAYIYDDGSSTYYADSVKGRFTISRDNAKNMLYLQMNNLKTEDTATYYCAR
Felis catus V42 ighv ACBE01217568.1 2248 VHSQVLLVQSGAEVRKPEASVKIFCKASGYSFTDYYMYWVRQAPAQGFEWMGSIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSNLRSTDTAVYYCAR
Felis catus V44 iglv ACBE01380657.1 1157 SVTSNRVTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKPNQVPLMIIYQDSNRPSGIPDRFSGSNSGNTATLTVSGARAEDEADYYCLS
Felis catus V46 iglv ACBE01380673.1 12187 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSYYAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDNSGN
Felis catus V47 iglv ACBE01380675.1 5806 CPASVSHSVWALGQIITISCSGSNNDIQGYKDVPWYQQLSATSPKLLFYHVHSQASGIPDRFSGSKSGNTASLTISGLRAEDEADYHCSSCAGSSI
Felis catus V48 iglv ACBE01380677.1 4021 SLASSMPTQSPYILVTLTQTARITCRGNNSGSKSVYWYQQKPGQAPMLVICYGRNQPSRTPDRFSGTNSGNTATLIISEAQTEDEADYYCQVWDSGN
Felis catus V49 iglv ACBE01380680.1 4426 SVTASELTQPPAVSVALGQTATITCKGDSFESSMINWYQQKSGQAPVLVIYEDSEQPTGIPDRFSGSNSGDAATLTITGAQAEDEADYYCQSYDNSGD
Felis catus V50 iglv ACBE01380681.1 10977 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSSYAYWYQQKSGQAPVLIIYKDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQSYDSNYD
Felis catus V51 iglv ACBE01380788.1 2931 SWAQSVLTQPPSVSGALGQTVTISCAGSRSNIGTVRVNWYQQLPGKAPKLLIHANNRRPSGVPERFSGSKSGNTGSLTITGLQAEDEADYYCSAWDAILK
Felis catus V52 iglv ACBE01380791.1 8808 SLSQPVVTQPASLSASLGATARLTCTLSRDINVGSYSIYWYQQSPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V53 iglv ACBE01380791.1 18802 SWAQSELTQPPSVSGGLGQTVTISCAGSANNNIGRIGVNWYQQFPGKAPKLLISAYSNQPSRVSGRFSGSTSGNTGSLTITGLQAEDEADYYCTSADPIQS
Felis catus V54 iglv ACBE01380793.1 13873 SLSQPVLTQPSSLSASPGTTARLTCTLSSGFSVGGYYINWFQQKPGSPPRYLLYYYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGPQPEDEADYYCAI
Felis catus V55 iglv ACBE01380793.1 23647 SLSQPVVTQPASLSASLGATARLTCTLSRDVSVGSKNIYWYQQKPGSPPRYFLYYYSDSSNELGPGVPSRVSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V56 iglv ACBE01380801.1 1608 SWAQSVLNQPPSVSGGLGQTVTISCAGSANNIGTVGVNWYQQLTGKAPTLLIYANNRRPSSVPDRFSGSTSGNTGSLTITGLQAEDEADYYCLSADVTQGA
Felis catus V57 iglv ACBE01380802.1 2561 SWAQSVLTQPPSVSGSLGQRVTISCIGSSSNIGGGNYVSWYQQVPGTAPRLLIYENNKRPSGVPDRFSGSKSGSSGSLTITGLQADNEADYYCAS
Felis catus V58 iglv ACBE01380807.1 6655 SWAQSRLTQPPSVSGSLGQRATISCAGSSSNIGDYGVNWHQQFPGMAPKTIIYGNSNRPSGVPDRFSGSKSGNTGTLTITGLQAEDEADYYCSSWDSSSSA
Felis catus V59 iglv ACBE01380814.1 4946 SWAQSVLTQPPSVSGTLGQRITISCTGSSSNIGGGNAVSWYQQVPGMGPKTVIYWNNSKPSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCSAWDDSLS
Felis catus V60 iglv ACBE01380814.1 24793 SWAQSVLSQPPSVSGALGQTVTIPCAGGANNIGIAGGNWYQQLPGKAPKLLIYDSSNRPSGVPERFSGSKSGNTGSLTITGLQAEDEADYYCQSLDFTQGA
Felis catus V61 iglv ACBE01380815.1 2415 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYDNSDRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGRA
Felis catus V62 iglv ACBE01380815.1 7701 IWAQSGPNQPSSVSGALGQRVTISCTGAGSYVYWYQQIPGMAPKTIISVNSNRPSGVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V63 iglv ACBE01380815.1 19737 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVSWYQQVPGTAPRLLIYENNKRPSGVPDRFSGSKSGSSGSLTITGLQADDEADYYCASWDNSLS
Felis catus V64 iglv ACBE01380816.1 33 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGRAPKTIIYYDSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSGGSA
Felis catus V65 iglv ACBE01380816.1 6364 SWAQSGLTQPSSVSGAMGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V66 iglv ACBE01380817.1 2659 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTVIYNNSNRPSGVPDRFSGSKSGSTSTLTITGLQAEDTADYYCSSWDSSGRA
Felis catus V67 iglv ACBE01380818.1 1668 IWGQSGPNQPSSVSGALGQRVTISCTGIDSYVGWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCVSWYSSGRA
Felis catus V68 iglv ACBE01380818.1 6939 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWDSSGSA
Felis catus V69 iglv ACBE01380821.1 2980 IWAQSGPNQPSSVSGALGQRVTISCTGAGSYVGWYQQIPGMAPKTIIYLNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWGGDII
Felis catus V70 iglv ACBE01380824.1 11321 SWAQSVLTQPPSVSGALGQRVTISCTGSSSNIGRGNYVSWYQQLSGTAPKLLIYGNSNRPSGVPDRFSGSKSGSTGSLTITGLQAEDEADYYCAAWDSSLN
Felis catus V71 iglv ACBE01380825.1 5328 SWAQSELTQPPSVSGGLGQKVTISCAGSRSNIGIAGVNWYQQHPGKAPKLLIYGSSNRPSGVPDRFSGSKSGNTGSLTITGLQAEDEADYYCLSVDVTRGA
Felis catus V72 iglv ACBE01380825.1 17415 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSHISNNFVNWYQQLPGTTPKTIILWDDSRPSGVSERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Felis catus V73 iglv ACBE01380825.1 26746 SWAQSMLTQPPSVSGALGQTVTISCSGSTNNIGIYGVNWYQQLPGEAPKLLIYGNSNRPSGVPDRFSGSKSGSTGSLTITGLQAEDEADYYCQT
Felis catus V74 iglv ACBE01380836.1 2640 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPKTIIYYDSDRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCASRYSSGSA
Felis catus V75 iglv ACBE01380843.1 1496 SLSQPVLTQPASLSASLGATARLTCTLSRDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKHQGPGIPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V76 iglv ACBE01380845.1 4731 SWTQSVVTQPSEVSKPVNKSVTISCTGSSSNVGAGGVSWYQQLPGSVPKVLIYGSSARPAGVPSRFTGSRSGNVASLSISSLQAEDEADYYCSVW
Felis catus V77 iglv ACBE01380847.1 6426 QSVLTQPPLVSGALGQTVTISCTISDSSFWGGEFRHWYQQLPGAAPKLLIYGNNNRLSGVPSRFSGSKSGNSHSLTIIGLQPEDEADYYCQYFDDRVI
Felis catus V78 trbv ACBE01534666.1 7667 VSAQTIHQWPPVRVQLVGSPLSLECIVKGESNPYLYWYRQAKGGPPQLLFYSLNIHQVDPEAPRNFTASRPQDGQFILSSQKLLLSDSGFYLCAWG
Felis catus V79 trbv ACBE01534678.1 10343 LVDASVSQTPRHYVSGTGKKITLECSQTMGHENMYWYRQDPGKALQLIHYSYGINTTEEVEASSGSTVSRIRKEHFPLTLESTSPSQTSLYFCASSE
Felis catus V80 trbv ACBE01534678.1 4268 LKDAVVTQFPRHKILGTGKKLTLQCTQDMNHFSMYWYRQDRGSGLQLIYYSTGTEAFEKGDIPEGYHVSQNELPYFPLTLDSASTNQTSVYFCASSL
Felis catus V81 trav ACBE01574520.1 979 DTSAQSVTQLDGHVTVSEKAHLELRCNYSYGATPNLFWYVQYPNQGLQLLLKYFSGPPNVLVQGIKGFQAEFRKNETSFHLRKHSAHWSDSAKYFCAAS
Felis catus V82 ighv ACBE01577626.1 1313 VQCDEQLVESGGDLVKPGGSLRLTCVASGFNVGSYGMSWFRQAPGKGLQWVAAISGSGGSTGYADSVKGRFTISIDNAKNTLYLQMDSLKTEDTATYYCAR
Felis catus V83 trgv ACBE01067344.1 6542 GLGQGNLEQPEISISRARGKSAHVSCKMSTEVIDRAIHWYRQKPDQEIEHLTLVSTQPVRVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAVYFCASWGW
Felis catus V84 trgv ACBE01067350.1 3469 TSGGIFITQFVPSITKKKGNTAFLECQVKTGVLKKNVNIHWYRQRPDQPLKRILYISSNENVVHEQGISEEKYEARKRQRDLPASLRIHKISEEDAGLYYCACWD
Felis catus V85 igkv ACBE01107173.1 412 SSGEVVLTQSSAFLSRTLKEKATITCRANQGISTNLHWYQQCILVKYASQSVSGAPSRFSGSGSGTDFTLTISSPEPEDAATYYCQQSNNLP
Felis catus V86 igkv ACBE01107184.1 642 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYRASTLQTGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQHNSG
Felis catus V87 igkv ACBE01107194.1 863 ASGTAELTQSPTHLSVSLTDSVSVICRASESISDHLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDAAAYYCQQGYALP
Felis catus V88 igkv ACBE01107197.1 10146 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Felis catus V89 igkv ACBE01107197.1 1967 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYRASTLQTGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQSSNLP
Felis catus V90 trdv ACBE01202335.1 1180 RGVLCDHVTQSPPYQTVASGSKVTLFCTYHTTYSNPDLYWYRIRPDRSFQFILYRDNTRSKDADFTQGRFWVWHSQSQKTFHLVISVEPEDSATYYCAIY
Felis catus V91 trav ACBE01202404.1 1389 VSSEDKVIQSPPSLVVQEEDSATLNCSYQVTNFQSLLWFQQQENAPTFLFRQISNGIQKSGRLKGTLDKKALLGTLHITATQLGDSATYLCAVE
Felis catus V92 trdv ACBE01202412.1 339 SVMAEKVIQMQNTVIIQEGKAATMECKYETSWSNYYTLYWYKQPPSGRMHFLIYQDESKPNAKQGRLSMNFQKTEKSIALTISLVQLADSAVYFCALSS
Felis catus V93 trav ACBE01202426.1 3584 VCSVLDVNQYPLSLHVHEGENTNFTCHFPTSSFYGLQWYRWEPAKSPKFLFTIALNGDEKEEGRVKVTLDTKKGSSSLYIKGSQPEDAATYLCALT
Felis catus V94 trav ACBE01202432.1 467 KSGQEQVKQGPPSLIVQEGASSTMNCTYENTAFDYLVWYRQYPGQGPALLLAVFSVKHTKEDGRFTVFVSESAKQFSLHIMASQPGDSATYFCAAS
Felis catus V95 trav ACBE01202439.1 843 VSSKQKVMQSPEALNVQEGDSVVLNCSYTGSTFYSLQWFRQDPGKGLTVLLLIQSAQREETSGRIKASLDKPSKHSTLYIAASQPSDSATYLCAIE
Felis catus V96 trav ACBE01202465.1 1999 VNSQQEQDHQTLSIQEGEKATMNCSYKTSINYLQWYKQDSGRGLVLLILIRLNEREKNSGRLRVTLNTSLKSSSLSITASQTADTATYFCATD
Felis catus V97 trav ACBE01202469.1 1043 GTRAQTVTQPEDHLSVFTGDPVQVKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISGGSVKGFTASLNQGEMSFHLKKPSAQEEDSAMYYCVLG
Felis catus V98 trav ACBE01202471.1 1072 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGMTYVFWYVQYPNQGLQLLLKYISGDTLVKGLNGFEAEFKKSETSFHLRKSPALGSDAAKYFCAVS
Felis catus V99 trav ACBE01202472.1 1812 MKRSHQNEVKQSPVPLTVLEGVTAFLNCSYSDSASQYFVWYRQYSGKGPEFLMRMYSNGEKEEGRFTGLLNKASLYLSLFIRDSQLSDSATYLCAV
Felis catus V100 trav ACBE01202475.1 1521 GLRAQSVSQPDQVTVAEGDPVTVKCNYSVSGNPYLFWYVQHRNQGLRFLLKYITGANLVKGNYGFEAEFNKSQTSFHLKKPSILGSDSAVYFCAVT
Felis catus V101 trav ACBE01202477.1 3640 TLSLAKTTQPVFIESYEGQEVSIPCNHTKIATNEYIHWYRQFPNQGPQFVIQGYKTNVENEVASLFISADRTSSTLSLPRAALRDTAVYYCTVSD
Felis catus V102 trav ACBE01202477.1 1869 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVTYVQWFRQNPGGGGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Felis catus V103 trav ACBE01202479.1 2285 VSGKNQVEQHPPSQIIQEGENCTFQCNYTVSPFSHLKWYKQGTGRSPAFLIIMTDDDSKNPSGRYTVTLDATSKHSFLHITAAQLSDSAVYICVVS
Felis catus V104 trav ACBE01202482.1 2044 QTHGDSVTQMEGPVTIPERKSLTINCTYSTTWTPTLFWYVQYPRESPQLLLKALRDKETGSHKGFEATYDSKSKSFHLEKSSVQASDSAVYYCAAS
Felis catus V105 trav ACBE01202486.1 10522 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGIPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKKHETTFHLRKSRALGSDAAKYFCAVR
Felis catus V106 trav ACBE01202489.1 2865 QTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKAFRDKEKGSHKGFEATYDGKSKSFHLEKSSVQASDSAVYYCAAS
Felis catus V107 trav ACBE01202497.1 1496 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNSVQWFRQNPRGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Felis catus V108 trav ACBE01202501.1 2957 RTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATLQSKSKTFHLEKSSVQVSDSAVYYCALM
Felis catus V109 trav ACBE01202502.1 749 QASQSGLLTVTLSERASLTVNCSYETTQYPALFWCVQYPGEGPQLLLKASKANEKGSSKGFEATYHKEPNSFHLKKSSVQVSDSAVYYCALR
Felis catus V110 trav ACBE01202503.1 6163 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGTPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKKHETTFHLRKSRALGSDAANYFCAVR
Felis catus V111 trav ACBE01202506.1 1329 SSISQKVTQAPPAMLVQEKEAVILECTYDTSDPNYSLLWYKQPSRGEMIFLVRQDSHNQQNATEGRYSLNFQKARKSIHLVISASQLEDSAVYFCALRS
Felis catus V112 trav ACBE01202508.1 856 QTHGDSVTQMEGPVTLSKGESLTINCTYSATGYPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCVLS
Felis catus V113 trav ACBE01202509.1 1270 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVTYVQWFRQNPGDGSLTRLFYITSGMKQDGRLNCTVNPKDRHSSLHIMASQQEDSATYLCAVE
Felis catus V114 trav ACBE01202512.1 3323 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGDGSLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Felis catus V115 trav ACBE01202516.1 3698 QTHGDSVTQMEGPVTLSKGESLTINCTYSATGYPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCAAS
Felis catus V116 ighv ACBE01217343.1 5491 VLSQLTLRESGPGLVKPSQSLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWLGYWSGSTSYNPAFQGRISITADTAQNQFSLQLSSMTTEDTAVYYCAR
Felis catus V117 ighv ACBE01217355.1 2067 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSNAMSWVRQAPGKGLQWVSAISYDGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V118 ighv ACBE01217359.1 332 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYSMNWVRQAPGKGLQWVAYIYTDGSSTNYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V119 ighv ACBE01217361.1 1947 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYAMSWVRQAPGKGLQWVADISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAK
Felis catus V120 ighv ACBE01217442.1 4208 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMNWVRQAPGKGLQWVAYINTDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCTR
Felis catus V121 ighv ACBE01217454.1 925 GGVWGKPGEAWRVPETNLCASGFTFSSYEMSWVHQAPGKGLQWVSAIGSGGSTYYTDSVKGRFTISRDNAKNMLYLQMNNLKTEDTATYYCARDMVRG
Felis catus V122 ighv ACBE01217476.1 1521 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMSWVRQAPGKGLQWVAYISSSGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V123 ighv ACBE01217489.1 974 VQCDVQLVESGGNLVKPGGSLRLTCVDSGFTFSSYTMHWVCQAPGKGLQWVAYISSSGSSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V124 ighv ACBE01217519.1 4631 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSNYWMSWVRQAPGKGLQWVAYIYDDGSSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAS
Felis catus V125 ighv ACBE01217529.1 2056 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFTDYYMHWLRQAPEQGLEWMGRIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Felis catus V126 ighv ACBE01217540.1 3135 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSSWMSWVRQAPGKGLQWVAYINTDGSSTSYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAR
Felis catus V127 ighv ACBE01217564.1 2467 VHSQVLLVQSGAEVRTPGASVKIFCKASGYSFTDYYMHWLRQAPAQGLEWMGSIDPEAGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Felis catus V128 ighv ACBE01217566.1 4413 VQCDVQVVESGGDLMQPGGALRLTCVVSGFTFSSASISWVRQAPGKGLQWVSAISSGGSTYYADSVKGRFTMSRDKAKNTLYLQMNNLRAEYKATYYCAR
Felis catus V129 trav ACBE01240040.1 6095 VSSQKMEQSPQSLNIQEGEKAVLTCNCTNFSPVVFQWYRQDPGRGLVFLLLIRENESKKQTGRLKATFDKTIKQSSFYITEPQPADSATYLCAA
Felis catus V130 trav ACBE01240050.1 5226 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Felis catus V131 trav ACBE01240052.1 3138 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASDYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V132 iglv ACBE01380655.1 944 SMASYVLTQPPSVSVNLGQTARITCGGNNIGSKHAYWYQQKPGQAPMLVIYYSSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQVWDGSSD
Felis catus V133 iglv ACBE01380656.1 5265 SVTSNRVTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKPNQVPLMIIYQDSNRPSGIPDRFSGSNSGNTATLTVSGARAEDEADYYCLS
Felis catus V134 iglv ACBE01380658.1 6591 SVASYELTQPPSVSVNLGQTARITCGGNNIGNKDAYWYQQKSGQAPMLIIYEDSKRPSGIPDRFSGTNSGNMATLTISGARAEDEADYYCQVWDSSSD
Felis catus V135 iglv ACBE01380660.1 4728 SIASYVLTQPPSVSVSLGQTARITCGGNNIESKSVHWYQQKSGQTPVLIIYSDSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQVWDSSSD
Felis catus V136 iglv ACBE01380688.1 476 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSKNAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDNSGN
Felis catus V137 iglv ACBE01380689.1 6273 FVASSEVTQPPSVSVALGQTARITCSGDMMEKKYTNWHQQKPGQAPIQIIYKDSERPSGIPDRFSSSSSGKTVTLTISGARAEDEADYYCQSYDISSN
Felis catus V138 iglv ACBE01380695.1 14140 SWAQSALNQPPSLSGDLGRTVTISCAGSSNDIGRYSDVSWYQQLEGTSPKLLIHNVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYASSNT
Felis catus V139 iglv ACBE01380695.1 5621 SMASYVLTQPPSVSMNLGKTARITCGGNNIGSKYAYWYQQKPGRAPMMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWGGNSD
Felis catus V140 iglv ACBE01380715.1 9064 ATSQEVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQRFQGLIGGTSYRNPGVPARFSGSLVGQKAVLTITGAQSEDEAEYYCVLWFSNH
Felis catus V142 iglv ACBE01380747.1 2875 SLSQPVVTQPASLSASLGATARLTCTLSRDINAGGYYIYWYQQKPGSPPRYLLYYYSDSDKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V143 iglv ACBE01380784.1 1839 IWAQSGPNQPSSVSGTLGQRVTISCTGVGISVDWYQQIPGMAPKTVIYRNSNRLSEVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWDSSGIT
Felis catus V144 iglv ACBE01380790.1 1679 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYGNSYRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSGRA
Felis catus V145 iglv ACBE01380792.1 4756 SLSQPVLTQPSSLSASPGTTARLTCTLSSGYNVGGYHIYWYQQKQGTSPRYLLRFYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Felis catus V146 iglv ACBE01380833.1 5049 IWAQSGPNQPSSVSGALGQRVTISCTGVGTWVGWYQQIPGMAPKTIIYGNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCVSWYSSGRA
Felis catus V147 iglv ACBE01380834.1 3168 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYDNSNRHSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V148 iglv ACBE01380835.1 4881 IWAQSGPNQPSSVSGALGQRVTISCTGVGSWVDWYQQIPGIAPKTIIYVNSNRPSGVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWYSSGIT
Felis catus V149 iglv ACBE01380840.1 3445 SWAQSVLTQPPSVSGGLGQTVTISCAGSANNNIGTVGVNWYQQLPGKAPKFLISANSNQPSWVSGRFSGSTSGNTGSLTITGLQAEDEADYYCTSADPIQS
Felis catus V150 iglv ACBE01380842.1 523 SLSQPVVTQPASLSASLGTTARLTCTLSRDINVGSYSIYWYQQSPGSPPRYLLYYYSDSDKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V0 trav AANG03000418.1 640 GLRAQSVSQPDQVTVAEGDPVTVKCNYSVSGNPYLFWYVQHRNQGLRFLLKYITGANLVKGNYGFEAEFNKSQTSFHLKKPSILGSDSAVYFCAVT
Felis catus V1 trav AANG03000418.1 3406 GAGAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYMQHPNQGLRLLLKYISGDILVKGTKGFEAEFRKSEKTFHLRKPAVQWSDTAKYFCAVS
Felis catus V2 trav AANG03000418.1 8467 TLSLAKTTQPVFIESYEGQEVSIPCNHTKIATNEYIHWYRQFPNQGPQFVIQGYKTNVENEVASLFISADRTSSTLSLPWAALRDTAVYYCTVSD
Felis catus V3 trav AANG03000419.1 819 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVTYVQWFRQNPGGGGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Felis catus V4 trav AANG03000419.1 6910 MSRGEEVKQHPSFLSVWEGDSFVINCTYTDSASTYFFWYKQQPGKGLQLLIYTVSSMDKKQEQRLTVLLNKKDKHLSLQVTRTHPGDSATYFCAVR
Felis catus V5 trav AANG03000420.1 3424 VSSQKMEQSPQSLNIQEGEKAVLTCNCTNFSPVVFQWYRQDPGRGLVFLLLIRENESKKQTGRLKATFDKTIKQSSFYITEPQPADSATYLCAA
Felis catus V6 trav AANG03000421.1 7464 DTSAQSVTQLDGHVTVSEKAHLELRCNYSYGATPNLFWYVQYPNQGLQLLLKYFSGPPNVLVQGIKGFQAEFRKNENSFHLRKHSAHWSDSAKYFCAAS
Felis catus V7 trav AANG03000421.1 12487 QASQSGLLTVTLSERASLTVNCSYETTQYPALFWCVQYPGEGPQLLLKASKANEKGSSKGFEATYHKEPNSFHLKKSSVQVSDSAVYYCALR
Felis catus V8 trav AANG03000422.1 2369 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGIPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKKHETTFHLRKSRALGSDVAKYFCAVR
Felis catus V9 trav AANG03000423.1 10583 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIMASQQEDSATYLCAVQ
Felis catus V10 trav AANG03000423.1 16542 LSRGENVEQSPSTLSVQEGNSCVITCSYSDSASYYFPWYKQELGKGPQLIIDIHSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V11 trav AANG03000426.1 4431 QTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKSFHLEKSSVQASDSAVYYCAAS
Felis catus V12 trav AANG03000427.1 9821 RTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATLQSKSKTFHLEKSSVQVSDSAVYYCALM
Felis catus V13 trav AANG03000428.1 5558 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGDGSLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Felis catus V14 trav AANG03000430.1 75 QTHGDSVTQMEGPVTLSKGESLTINCTYSATGYPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCVLS
Felis catus V15 trav AANG03000430.1 5534 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGIPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKKHETTFHLRKSRALGSDAANYFCAVR
Felis catus V16 trav AANG03000430.1 15379 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVTYVQWFRQNPGDGSLTRLFYITSGMKQDGRLNCTVNPKDRHSSLHIMASQQEDSATYLCAVE
Felis catus V17 trav AANG03000430.1 20142 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASDYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V18 trav AANG03000430.1 30778 QTHGDSVTQMEGPVTLSKGESLTINCTYSATGYPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCAAS
Felis catus V19 trav AANG03000431.1 4456 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNSVQWFRQNPRGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Felis catus V20 trav AANG03000431.1 12957 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASDYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V21 trav AANG03000431.1 17311 SSISQKVTQAPPAMLVQEKEAVILECTYDTSDPNYSLLWYKQPSRGEMIFLVRQDSHNQQNATEGRYSLNFQKARKSIHLVISASQLEDSAVYFCALRS
Felis catus V22 trav AANG03000432.1 7563 QTHGDSVTQMEGPVTIPERKSLTINCTYSTTWTPTLFWYVQYPRESPQLLLKALRDKETGSHKGFEATYDSKSKSFHLEKSSVQASDSAVYYCAAS
Felis catus V23 trav AANG03000432.1 15377 VSGKNQVEQHPPSQIIQEGENCTFQCNYTVSPFSHLKWYKQGTGRSPAFLIIMTDDDSKNPSGRYTVTLDATSKHSFLHITAAQLSDSAVYICVVS
Felis catus V24 trav AANG03000432.1 27601 MKRSHQNEVKQSPVPLTVLEGVTAFLNCSYSDSASQYFVWYRQYSGKGPEFLMRMYSNGEKEEGRFTGLLNKASLYLSLFIRDSQLSDSATYLCAV
Felis catus V25 trav AANG03000432.1 31806 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGMTYVFWYVQYPNQGLQLLLKYISGDTLVKGLNGFEAEFKKSETSFHLRKSPALGSDAAKYFCAVS
Felis catus V26 trav AANG03000432.1 37441 GTRAQTVTQPEDHLSVFTGDPVQVKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISGGSVKGFTASLNQGEMSFHLKKPSAQEEDSAMYYCVLG
Felis catus V27 trav AANG03000432.1 42691 VNSQQEQDHQTLSIQEGEKATMNCSYKTSINYLQWYKQDSGRGLVLLILIRLNEREKNSGRLRVTLNTSLKSSSLSITASQTADTATYFCATD
Felis catus V28 trav AANG03000432.1 49294 GINGDSVTQTEGSVTLFEGTPLTLNCTYQSSYTVFVFWYVQYQNKAPQLLLKSLSENQRAEHHGFHASLVKSDGSFHLQKRSVRMSDSAVYYCVLG
Felis catus V29 trav AANG03000434.1 4615 ASMAQKVTQAQPAISMPEKEAVTLDCVYEASGYTYYLFWYKQPPSGEMILLIYQESYSEQNATEGRYSLNFQKPDRSISLTITALQLTDSAVYFCALR
Felis catus V30 trav AANG03000437.1 16049 VSSKQKVMQSPEALNVQEGDSVVLNCSYTGSTFYSLQWFRQDPGKGLTVLLLIQSAQREETSGRIKASLDKPSKHSTLYIAASQPSDSATYLCAIE
Felis catus V31 trav AANG03000437.1 31843 GTGAQSLTQPDGHITVSEGARLELSCNYSSSGTTYLFWYVQHPNQGLQLLLKYLSGPSDALVQGIKGFEAEFKKSEKAFHLRKHSAHWSDSAKYFCAVS
Felis catus V32 trav AANG03000437.1 37407 VTGLMVKQSPPDLSLQEGLSCTLQCSFSTSVTRVQWFRQNPGGHLIHLFYIPSGTKQNGRLRSTTVVEDRRSLLYISSSRTTDSAIYFCAGAE
Felis catus V33 trav AANG03000437.1 45155 KSGQEQVKQGPPSLIVQEGASSTLNCTYENTAFDYFVWYRQYPGQGPALLLAVFSVKHTKEDGRFTVFVSESAKQFSLHIMASQPGDSATYFCAAS
Felis catus V34 trav AANG03000439.1 925 VCSVLDVNQYPLSLHAHEGENTNFTCHFPTSSFYGLQWYRWEPAKSPKFLFTIALNGDEKEEGRVKVTLDTKKGSSSLYIKGSQPEDAATYLCALT
Felis catus V35 trav AANG03000439.1 8361 VNGQEIKQIPQFLLLQEGENFTIYCNSSRTLNSLHWYKQRPGGSPILLITLVKSGDVKQERLTAWFGDTRKNSLLHMVATQTADSGVYFCTGAQCSQ
Felis catus V36 trav AANG03000439.1 10740 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGTTYVFWYVQYPNQGLQLLLKYISGDTLVKGLNGFEAEFKKSETSFHLRKSPALGSDAAEYFCAVS
Felis catus V37 trav AANG03000439.1 28084 VRVQMNVEQSPGVLNLQEGRNTSMMCNYSSIITSVQWFQQNPEGHLVSLSFITSGMQRKGRLIFTLNFQERNSHLHITDSQPGDSGTYFCTVE
Felis catus V38 trav AANG03000439.1 33688 VNSQQNADQQQVKQTPSLSVQEREISILNCDYNNNMFDYFIWYKKYPAKSLEFVISIRSTVDKNEDERFTVYLNKSAKHLSLHIAASQPGDSALYFCTAN
Felis catus V39 trdv AANG03000439.1 51529 SGMAEKVIQMQNTVIIQEGKAATMECKYETSWSNYYTLYWYKQPPSGRMHFLIYQDESKPNAKQGRLSMNFQKTEKSIALTISLVQLADSAVYFCALSS
Felis catus V40 trav AANG03000439.1 54654 IMSDAKTTQPNAMESTEEEPVRLPCNHSTISGSEYIHWYRQIPHHGPEYLIHGLKDNVTNGMASLTIAKDRKSSTLVLPRVTLRDAAVYYCIAR
Felis catus V41 trav AANG03000439.1 64950 VSSQELEQSPRSLIIQEGEDFTINCSSSKTFYTLGWYRQKNGEGLSSLMMLQKSGEEKTHEKITAKLDEKKQQTSLHITASQPSHSGIYLCAGD
Felis catus V43 trav AANG03000439.1 78747 VSSEDKVIQSPPSLVVQEEDSATLNCSYQVTNFQSLLWFQQQENAPTFLFRQISNGIQKSGRLKGTLDKKALLGTLHITATQLGDSATYLCAVE
Felis catus V44 trav AANG03000439.1 97999 SSMAQKVTQTQPEMSVYEAETVTLDCTFDTRVSNYYLFWYKQPPSGEMVLIIRQEANKQENATNNRFSVNFQKADKSFSLRISAAQLGDAAMYLCALME
Felis catus V45 trav AANG03000439.1 105446 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTSDSNYYLFWYKQPPSREMLLIIRQEANKQENATNNRFSVNFQKADKSFSLRISAAQLGDAAMYLCALME
Felis catus V46 trav AANG03000439.1 139244 ASGKNGVEQSPQSLTAQEGNFVTINCSFSVGMTALHWLQQNPGGGIVSLFILSLEMKKKGRIRATINTEELHSSLYITASQPRDSAIYLCAVE
Felis catus V47 trdv AANG03000446.1 4432 SSNTQSVTQTPGPVNKQERESVSLHCSFTLSYTYYVMSWFRQLSNGKMTEIINLYSTSTNTKKGRYSVSHQKGNKALSLTITGLMPTDSGVYFCAVGEA
Felis catus V48 trdv AANG03000447.1 11317 SSNTQSITQSPSSVQEKEGESVTLDCRFTLNFDYYVMSWYQQLSNGKMTEIIYLVSTSTNTREGRYSVSHWARDKTLRLTITGLMPTDSGIYFCAVGEA
Felis catus V49 trdv AANG03000447.1 23918 SSNTQSVTQYPSSVHKQEGESANLFCRFTLSYTYYVMSWFQQPSNGKMTEIIYLYSDSTNNKKGRYSVSYQARDKALRLTITGLMPTDSGVYFCAVGEA
Felis catus V50 trdv AANG03000448.1 21059 SSNTQGITQSPSLVQEKEGESVTLNCRFTLSYTYYVMRWYQQLSNRKMTEIIYLYSASTNTRTGRYSVSHQKGNKAVSLTITGLMPTDSGIYFCAVGEA
Felis catus V51 trav AANG03000448.1 66948 GSCKTEIIQSSNITAIIGTDVEFPCQYNIPDKNFESVYWYLQRADQRFTYIGHTSQGTVELEHYQLFVNRKLLSSTLTIKHVQPRDKAIYYCAV
Felis catus V52 trdv AANG03000448.1 73461 VSLDIVLKPDTETLTVLVGEPATFRCSITGGDWKNYQVSWYKKNEDNSLTLVYRLSNSSNANISSNFKGNIDALKGQCILDIQRATIKDTGTYYCASD
Felis catus V53 ighv AANG03030225.1 3148 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSSWMSWVRQAPGKGLQWVAYINTDGSSTSYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAR
Felis catus V54 trbv AANG03031951.1 8273 VSAQTIHQWPPVRVQLVGSPLSLECIVKGESNPYLYWYLQAEGGPPQLLFYSLNIHQVDPEAPRNFTASRPQDGQFILSSQKLLLSDSGFYLCAWG
Felis catus V55 ighv AANG03040103.1 8194 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMNWVRQAPGKGLQWVSWINTDGSSTSYADSVKGRFTISRDNSKNTLYLQMNNLKTEDTATYYCTR
Felis catus V56 iglv AANG03040322.1 2903 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTVIYNNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDTADYYCSSWDSSGRA
Felis catus V57 iglv AANG03040323.1 2953 IWAQSGPNQPSSVSGALGQRVTISCTGIDSYVGWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCVSWYSSGRA
Felis catus V58 iglv AANG03040325.1 2399 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPKTIIYYDSDRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCASRYSSGSA
Felis catus V59 iglv AANG03040637.1 2292 IWAQSGPNQPSSVSGALGQRVTISCTGVGISVDWYQQIPGMAPKTVIYRNSNRLSEVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWDSSGIT
Felis catus V60 iglv AANG03040638.1 748 IWAQSGPNQPSSVSGALGQRVTISCTGVGISVDWYQQIPGMAPKTVIYRNSNRLSEVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWDSSGIT
Felis catus V61 ighv AANG03040708.1 3410 VQWDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYHMNWVRQAPGKGLQWVAYISSSGGSIYYADSMKGRFTISRDKAKNTLYLQMHSLKTEDTATYYCAS
Felis catus V62 ighv AANG03040779.1 549 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMSWVRQAPGKGLQWVAYISSSGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V63 ighv AANG03041243.1 4423 VHSQVLLVQSGAEVRTPGASVKIFCKASGYSFTDYYMHWLRQAPAQGLEWMGSIDPEAGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Felis catus V64 iglv AANG03041293.1 66 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYGNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSGSA
Felis catus V65 ighv AANG03041600.1 4011 VHSQVLLVQSGAEVRKPEASVKIFCKASGYSFTDYYMYWVRQAPAQGFEWMGSIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSTDMAVYYCAR
Felis catus V66 ighv AANG03041652.1 2185 VHSQVLLVQSGAEVRTPGASVKIFCKASGYGFTDYYMHWVRQSPAQGLEWMGSIDPEDGATSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Felis catus V67 ighv AANG03041801.1 508 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMSWVRQAPRKGLQWVAYINTDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V68 ighv AANG03041876.1 179 GGVVGETVVQPGGSLRLTCVASGFTFSSYEMNWVRQAPGKGLQWVAYISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V69 iglv AANG03041935.1 228 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVSWYQQVPGTAPSLLIYENNKQPSGVPDQFSGSKSGSSGSLTITGLQADDEADYYCASWDNSLS
Felis catus V70 ighv AANG03042492.1 2309 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYDMNWVRQAPGKGLQWVAYINTDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCTR
Felis catus V71 ighv AANG03042693.1 1360 GGVWGKPGEAWRVPETNLCASGFTFSSYVMSWVHQAPGKGLQWVSAIGSGGSTYYTDSVKGRFTISRDNAKNMLYLQMNNLKTEDTATYYCARDMVRG
Felis catus V72 ighv AANG03044549.1 302 WRAASWWGLEDLVKPGGSLRLTCVASGFTFSSSSRNWVHQAPGKGLQWVSTISSSGCSTSYADSVKGRFTISRHNAKNALYLQMNNLRAEDTAKYYCARDKVRQ
Felis catus V73 ighv AANG03050019.1 429 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFTDYYMHWLRQAPEQGLEWMGRIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Felis catus V74 ighv AANG03050358.1 242 VQCDVQLVESGGNLVKPGGSLRLTCVASGFTFSSYGMSWVRQAPGKGLQWVAYIYDDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V75 iglv AANG03052296.1 277 IWAQSGPNQPSSVSGALGQRVTISCTGVGTWVGWYQQIPGMAPKTIIYGNSNRPSGVPDRFSGSKFGSTGTLTITGLQAEDEADYYCSSWDSSGSA
Felis catus V76 iglv AANG03052810.1 676 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGRAPKTIIYYDSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSGGSA
Felis catus V77 iglv AANG03052962.1 13 SWTQSVVTQPSEVSKPVNKSVTISCMGSSSNVGAGGVSWYQQLPGSVPKVLIYGSSARPAGIPSRFSGSRSGNVASLSISSLQAEDEADYYCSVWDHSLKA
Felis catus V78 ighv AANG03054672.1 222 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSRYGMSWVRQAPGKGLQWVAYIRYDGSSTNYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAT
Felis catus V79 iglv AANG03054759.1 680 SWAQSVLTQPPSVSGGLGQTVTISCAGSANNNIGTVGVNWYQQLPGKAPKFLISANSNQPSWVSGRFSGSTSGNTGSLTITGLQAEDEADYYCTSADPIQS
Felis catus V80 ighv AANG03056397.1 263 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMNWVRQAPGKGLQWVAYINTDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCMR
Felis catus V81 ighv AANG03059099.1 726 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSIYWMHWVRQAPGKGLQWVANIYTDGSSTNYADSVKGRLTISRDNSKNTLYLQMNNLRTEDTATYYCAR
Felis catus V82 ighv AANG03063340.1 316 LVKPGGSLRLTCVASGFTFSSYGMSWVCQAPGKGLQWVAYIYDDGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLKTEDTATYYCARDMVRG
Felis catus V83 iglv AANG03064342.1 392 SLSQPVVTQPPSLSASLGATARLTCTLSREVSVGSKSIYWYQQKPGSPPRYFLYYYSDSSNELGPGVPSRVSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V84 iglv AANG03074962.1 594 SWAQSVLTQPPSVSGALGQTVTISCAGSRSNIGTVRVNWYQQLPGKAPKLLIHANNRRPSGVPERFSGSKPGSTGTLTITGLQAEDEADYYCSAWDGSLR
Felis catus V85 trav AANG03085745.1 534 RTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATLQSKSKTFHLEKSSVQVSDSAVYYCALM
Felis catus V86 ighv AANG03087046.1 456 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYSMNWVRQAPGKGLQWVAYIRYDGSSIYYADSVKGRFTVSRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V87 trav AANG03122972.1 397 QTHGDSVTQMEGPVTLSKGESLTINCTYSATGYPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCAAS
Felis catus V88 ighv AANG03134807.1 101 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFTDYYMHWLRQAPAQGFEWMGRIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAVYYCAR
Felis catus V89 iglv AANG03151458.1 338 SLSQPVLTQPSSLSASPGTTARLTCTLSSGYNVGGYHIYWYQQKQGTSPRYLLRFYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V90 ighv AANG03151894.1 117 VQCDVQLVESGGDLVQPGGSLRLTCVASGFTFSSYEMNWVRQAPGKGLQWVAYISSGGSTYYTDSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V91 ighv AANG03153783.1 36 GHSQVCWVQSGAEVRKLEASVKIFCKASGYSFTDYYMYWVRQAPAQGFEWMGSIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSNLRSTDTAVYYCAR
Felis catus V92 trav AANG03168230.1 211 LSRGENVEQHPSTLSVQEGNSCVITCSYSDSASYYFPWYKQELGKGPQLIIDIHSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V93 iglv AANG03172715.1 345 SWTQSVVTQPSEVSKPVNKSVTISCMGSSSNVGAGGVSWYQQLPGSVPKVLIYGSSARPAGIPSRFSGSRSGNVASLSISSLQAEDEADYYCSVW
Felis catus V94 trav AANG03181858.1 249 GAGAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYMQHPNQGLRLLLKYISGDILVKGTKGFEAEFRKSEKTFHLRKPAVQWSDTAKYFCAVS
Felis catus V95 iglv AANG03184424.1 273 SVASYVLTQPPSVSVNLGQTARITCGGNNIGSYYAYWYQQKSGQAPVLIIYSDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDNSGN
Felis catus V96 ighv AANG03197782.1 304 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYSMNWVRQAPGKGLQWVAYIYTDGSSTNYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V97 iglv AANG03271752.1 49 SWAQSVLAQPSSVSGSLGQRVTISCSGSSSNIGSNYVSWYQQLPGTTPKTIIYWDNSRPSGVSERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDGSLR
Felis catus V98 ighv AANG03315487.1 13116 VQCDVQLMESAGDLVKPGGSLRLTCVASGFTFSSNNMNWVHQALGKGLQWVAYIRYDGSSTYYTDSVKGRFTISRDNAKNTLYLQMNNLRAEDTATYYCAR
Felis catus V99 ighv AANG03315487.1 27907 VHCDVLVVESGGDLVKPGGSLRLTCVASGFTFSGYWMSWVRQAPGKGLQWVTEISGSGGSTNYADSMKGQFIISRDNSKNTLYLQMNNLKTEDTATYYCAR
Felis catus V100 ighv AANG03315493.1 7579 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYSMNWVRQAPGKGLQWVAYISSSGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAS
Felis catus V101 ighv AANG03315521.1 1925 VQCDEQLVESGGDLVKPGGSLRLTCVASGFNVGSYGMSWFRQAPGKGLQWVAAISGSGGSTGYADSVKGRFTISIDNAKNTLYLQMDSLKTEDTATYYCAR
Felis catus V102 ighv AANG03315523.1 23200 VQCDVQLVESGGNLVKPGGSLRLTCVASGFTFSSYTMHWVCQAPGKGLQWVAYISSSGSSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTTTYYCAR
Felis catus V103 ighv AANG03315527.1 3450 VQCDVQLVESGGDLVQPGGSLRLTCVASGFTFSSYSMNWVRQAPGKGLQWVAYISSSGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAK
Felis catus V104 ighv AANG03315534.1 4341 VQCDVQLVESGGNLVKPGGSLRLTCVASGFTFSSYDMSWVRQAPGKGLQWVAYIYDDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V105 ighv AANG03315563.1 3073 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFRSYWMNWVRQAPGKGLQWVSAISGSGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAK
Felis catus V106 ighv AANG03315565.1 5275 VLSQLTLRESGPGLVKPSQSLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWLGYWSGSTSYNPAFQGRISITADTAQNQFSLQLSSMTTEDTAVYYCAR
Felis catus V107 iglv AANG03319030.1 42569 QSVLTQPPLVSGALGQTVTISCTISDSSFWGGEFRHWYQQLPGAAPKLLIYGNNNRLSGVPSRFSGSKSGNSHSLTIIGLQPEDEADYYCQYFDDRVI
Felis catus V108 iglv AANG03319030.1 56133 SWTQSVVTQPSEVSKPVNKSVTISCMGSSSNVGAGGVSWYQQLPGSVPKVLIYGSSARPAGIPSRFSGSRSGNVASLSISSLQAEDEADYYCSVW
Felis catus V109 iglv AANG03319032.1 2300 SLSQPVLTQPASLSASLGATARLTCTLSRDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKHQGPGIPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V110 iglv AANG03319034.1 2857 SWAQSELTQPPSVSGGLGQTVTISCAGSANNIGRIGVNWYQQFPGKAPKLLISAYSNQPSRVSGRFSGSTSGNTGSLTITGLQAEDEADYYCTSADPIQGA
Felis catus V111 iglv AANG03319036.1 6552 SWAQSVLTQPPSVSGALGQTVTISCAGSRSNIGIAGVNWYQQLPGKAPKLLIYANNRRPSGVPERISGSKSGNTGSLTITGLQAEDEADYYCSAWDAILK
Felis catus V112 iglv AANG03319038.1 14047 SLSQPVVTQPASLSASLGATARLTCTLSRDINVGSYSIYWYQQSPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V113 iglv AANG03319038.1 25219 SWAQSELTQPPSVSGGLGQTVTISCAGSRSNIGIAGVNWYQQHPGKAPKLLIYGSSNRPSGVPDRFSGSTSGNTGSLTITGLQAEDEADYYCLSVDVTQGS
Felis catus V114 iglv AANG03319038.1 37283 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSHISNNFVNWYQQLPGTTPKTIILWDDSRPSGVSERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Felis catus V115 iglv AANG03319039.1 16105 SWAQSVLTQPPSVSGALGQRVTISCTGSSSNIGRGNYVSWYQQLSGTAPKLLIYGNSNRPSGVPDRFSGSKSGSTGSLTITGLQAEDEADYYCAAWDSSLN
Felis catus V116 iglv AANG03319042.1 2956 IWAQSGPNQPSSVSGALGQRVTISCTGAGSYVGWYQQIPGMAPKTIIYLNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWGGDIT
Felis catus V117 iglv AANG03319042.1 8456 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPKTIIYGNRNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSGSA
Felis catus V118 iglv AANG03319042.1 13843 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYGNSYRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V119 iglv AANG03319042.1 19131 IWAQSGPNQPSSVSGALGQRVTISCTGAGSYVYWYQQIPGMAPKTIISVNSNRPSGVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V120 iglv AANG03319048.1 108 SLSQPVLTQPPSLSASPGTTARLTCTLSSGYNVGGYHIYWYQQKQGTSPRYLLRFYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Felis catus V121 iglv AANG03319048.1 15058 SLSQPVLTQPSSLSASPGTTARLTCTLSSGFSVGGYYINWFQQKPGSPPRYLLYYYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGPQPEDEADYYCAI
Felis catus V122 iglv AANG03319050.1 5310 SLSQPVVTQPASLSASLGATARLTCTLSRDVSVGSKNIYWYQQKPGSPPRYFLYYYSDSSNELGPGVPSRVSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V123 iglv AANG03319055.1 3512 SWAQSGLTQPSSVSGAMGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V124 iglv AANG03319056.1 223 IWAQSGPNQPSSVSGALGQRVTISCTGAGSYVGWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V125 iglv AANG03319058.1 1786 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMVPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCASWYSSGSA
Felis catus V126 iglv AANG03319060.1 5164 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMTPKTIIYLNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCVSWYSSGRA
Felis catus V127 iglv AANG03319060.1 15832 SWAQSVLTQPPSVSGTLGQRITISCTGSSSNIGGGNAVSWYQQVPGMGPKTVIYWNNSKPSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCSAWDDSLS
Felis catus V128 iglv AANG03319061.1 6658 SWAQSVLTQPPSVSGTLGQRITISCTGSSSNIGGGNAVSWYQQVPGMGPKTVIYWNNSKPSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCSAWDDSLS
Felis catus V129 iglv AANG03319061.1 28383 SWAQSVLSQPPSVSGALGQTVTIPCAGGANNIGIAGGNWYQQLPGKAPKLLIYDSSNRPSGVPERFSGSKSGNTGSLTITGLQAEDEADYYCQSLDFTQGA
Felis catus V130 iglv AANG03319064.1 6839 SWAQSRLTQPPSVSGSLGQRATISCAGSSSNIGDYGVNWHQQFPGMAPKTIIYGNSNRPSGVPDRFSGSKSGNTGTLTITGLQAEDEADYYCSSWDSSSSA
Felis catus V131 iglv AANG03319064.1 20182 SLSQPVVTQPASLSASLGATARLTCTLSRDINAGGYYIYWYQQKPGSPPRYLLYYYSDSDKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Felis catus V132 iglv AANG03319065.1 386 SWAQSVLTQPPSVSGALGQTVTISCAGSANNIGTVGVNWYQQLTGKAPTLLIYANNRRPSSVPDRFSGSTSGNTGSLTITGLQAEDEADYYCLSADVTQGA
Felis catus V133 iglv AANG03319065.1 12793 SWAQSVLTQPSSVSGSLGQRVTISCTGSSSNIGSNYVSWYQQLPGTTPKTIIYGDNSRPSGVPERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Felis catus V134 iglv AANG03319067.1 14888 ATSQEVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQRFQGLIGGTSYRNPGVPARFSGSLVGQKAVLTITGAQSEDEAEYYCVLWFSNH
Felis catus V136 iglv AANG03319072.1 31573 SWAQSALNQPPSLSGDLGRTVTISCAGSSNDIGRYSDVSWYQQLEGTSPKLLIHNVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYASSNT
Felis catus V137 iglv AANG03319072.1 40092 SMASYVLTQPPSVSMNLGKTARITCGGNNIGSKYAYWYQQKPGRAPMMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWGGNSD
Felis catus V138 iglv AANG03319072.1 73913 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSNYAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDNSGN
Felis catus V139 iglv AANG03319077.1 6205 CPASVSHSAWALGQIITISCSGSNNDIQGYKDVPWYQQLSATSPKLLFYHVHSQASGIPDRFSGSKSGNTASLTISGLRAEDEADYHCSSCAGSSI
Felis catus V140 iglv AANG03319077.1 28321 SVTASELTQPPAVSVALGQTATITCKGDSFESSMINWYQQKSGQAPVLVIYEDSEQPTGIPDRFSGSNSGDAATLTITGAQAEDEADYYCQSYDNSGD
Felis catus V141 iglv AANG03319079.1 18700 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSSYAYWYQQKSGQAPVLIIYKDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQSYDSNYD
Felis catus V142 iglv AANG03319080.1 6575 FVASSEVTQPPSVSVALGQTARITCSGDMMEKKYTNWHQQKPGQAPIQIIYKDSERPSGIPDRFSSSSSGKTVTLTISGARAEDEADYYCQSYDISSN
Felis catus V143 iglv AANG03319080.1 43411 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSKNAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSGN
Felis catus V144 iglv AANG03319080.1 53732 SMASYVLTQPPSVSVNLGQTARITCGGNNIGSKSVHWYQQKPGQAPMLVIYYSSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQSYDSNYD
Felis catus V145 iglv AANG03319080.1 69128 SIASYVLTQPPSVSVSLGQTARTTCGGNNIESKSVHWYQQKSGQTPVLIIYSDSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQVWDSSSD
Felis catus V146 iglv AANG03319080.1 77465 SVASYELTQPPSVSVNLGQTARITCGGNNIGNKDAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNMATLTISGARAEDEADYYCQVWDSSSD
Felis catus V147 iglv AANG03319080.1 84899 SVTSNRVTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKPNQVPLMIIYQDSNRPSGIPDRFSGSNSGNTATLTVSGARAEDEADYYCLS
Felis catus V148 iglv AANG03319080.1 94161 SLASSMPTQSPYILVTLTQTARITCRGNNSGSKSVYWYQQKPGQAPMLVICYGRNQPSRTPDRFSGTNSGNTATLIISEAQTEDEADYYCQVWDSGN
Felis catus V149 iglv AANG03319081.1 12894 SMASYVLTQPPSVSVNLGQTARITCGGNNIGSKHAYWYQQKPGQAPMLVIYYSSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDGSSN
Felis catus V150 iglv AANG03319671.1 250 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSSYAYWYQQKSGQAPVLIIYKDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQSYDSNYD
Felis catus V151 trgv AANG03320948.1 27346 DVAAISVEQPAVVVARAGSWATLPCKASTSVSYIHWYRHQEGTAPKRILMLDMSSSYVTKDGVLTADKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEDQ
Felis catus V152 trgv AANG03320948.1 74891 GVAAISLTQRAVVVERVGGLATLSCQASAYVRYIHWYLHQEGTAPKRILMLDMSRLSVQRYGGLKADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Felis catus V153 trgv AANG03320948.1 115479 SWAAISLGQPSMVVAQAGRSATLGCKASTKVSYIHWYHHQEGAAPKRLLRLDMSGTFVQKDGGLNEDKVNAKRGKGSNSCDLSVLKLEKSDEGVYYCAAWE
Felis catus V154 trgv AANG03320948.1 270539 GMAAISLTQRAVVVERVGGLANLSCQASASVSYIHWYLHQEGTDPKRILRLDMSRLSVERYGGLEADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Felis catus V155 igkv AANG03323563.1 5611 SSGDIVMTQTPLSLSVTPGEPASISCRASQSLLHSDGNTYLNWYLQKPGQSPRRLIYLVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQALQYP
Felis catus V156 igkv AANG03323563.1 10520 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Felis catus V157 igkv AANG03323563.1 15211 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYRASTLQTGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQHNSG
Felis catus V158 igkv AANG03323564.1 1764 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLNWYLQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Felis catus V159 igkv AANG03323565.1 289 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRRLIYRVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCLQG
Felis catus V160 igkv AANG03324064.1 17127 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Felis catus V161 igkv AANG03324064.1 25282 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYRASTLQTGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQSSNLP
Felis catus V162 igkv AANG03324065.1 6241 ASGTAELTQSPTHLSVSLTDSVSLICRANESVSDYLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSDTEFILKISTVEADDAAIYYCQQDYALP
Felis catus V163 igkv AANG03324066.1 18950 SGADVVMTQTPLSLPVTPGEPASISCRASQSLLHSDGNTYLNWYLQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCLQGTKYP
Felis catus V164 igkv AANG03324069.1 8505 SSGEVVLTQSSAFLSRTLKEKATITCRANQGISTILHWYQQKPNQAPKLLVKYASQSVSGAPSRFSGSGSGTDFTLTISSPEPEDAATYYCQQSNNLP
Felis catus V165 igkv AANG03324069.1 19271 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRLLIYRVSNRASGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Felis catus V166 igkv AANG03324071.1 4660 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLNWYLQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Felis catus V167 igkv AANG03324071.1 11298 AGGTTELTQSPTHLSVSLTDSVSVICRASESISDHLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDAAAYYCQQGYALP
Felis catus V168 ighv AANG03357967.1 5603 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYSMSWVRQAPGKGLQWVAYISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V169 ighv AANG03357971.1 1360 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYGMSWVRQAPGKGLQWVAYIYDDGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLKTEDTATYYCAR
Felis catus V170 ighv AANG03357982.1 6862 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYEVSWVRQAPGKGLQWVAYIYDDGSSTYYADSVKGRFTISRDNAKNMLYLQMNNLKTEDTATYYCAR
Felis catus V171 ighv AANG03357995.1 8345 VQCDVQLVESGGDLLKPGESLRLTCVASGFTFSSYSMQWVPQAPGKRLQCVAYIRDDGSSTSCTDSVKGRFTISRDNAKNMLYMKMNNLRAEDTATYYCAR
Felis catus V172 trdv AANG03000453.1 1530 RGVLCDHVTQSPPYQTVASGSKVTLFCTYHTTYSNPDLYWYRIRPDRSFQFILYRDNTRSKDADFTQGRFWVWHSQSQKTFHLVISVEPEDSATYYCAIY
Felis catus V173 trbv AANG03031954.1 149712 PVNAGITQTPAFQILGAGHSMTLRCEQDKDHDYMSWYRQDPGHGLRLIHYSVSAGTTERGEISNGYNVSRSNTKNFPLTLTSATPSQTSVYFCASSD
Felis catus V174 trbv AANG03031954.1 147831 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHVGLYWYRQAVGQGPEFLVSFQNEDKVDSSGMPSNDRFQVNRSEGSYSILQIQRAEPGDSAVYLCASSP
Felis catus V175 trbv AANG03031954.1 138184 PVEAGVTQTPRYLIKARGQQGTLRCSPISGHSSVSWYQQALNQGPQIIFEFFEYAQRTKGNFPDRFSGQQFHDYASELHVSSLEPTDSAVYLCASSL
Felis catus V176 trbv AANG03031954.1 132911 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHVGLYWYRQAVGQGPEFLVSFQNEDKVDSSGMPSNDRFQVNRSEGSYSILQIQRAEPGDSAVYLCASSP
Felis catus V177 trbv AANG03031954.1 126084 PAGAGVTQSPRHLVKGSGGKAVLKCRPMSGHRSVSWYQQAPGQGPQFLIELFGQETREKGNLPSHFSVEQFSDDSSQLNMSSLELGDSASYLCASSL
Felis catus V178 trbv AANG03031954.1 121129 PMDAEITQNPRYKVTGTGKRVILKCDQTENYDYMYWYRQDPGHGLKLIYYSNGFDSINKGDVPDGYAVSRKNMEDFPLVLESATSSQTSVYFCANSY
Felis catus V179 trbv AANG03031954.1 108506 PTDAGVTQTPRHKVTMKGQTVTLRCEPISGHASLYWYRQTSGQGLKQLVYFNNQASIDDSGMPSDRFSAKMPEKSLSTLEIQRTEPGDSATYLCASSL
Felis catus V180 trbv AANG03031954.1 88090 HTGARVIQSPRYQVTGIGKQVSLSCSQNLNHDAMYWYQQKPNQAPKLLLYYYDTNLYTEKDTSNNFKASRDNSSFCSLDILLAGFEDTAVYLCASSK
Felis catus V181 trbv AANG03031954.1 71619 PMNAGVTQNPEHLVRGTGQEATLRCSPEKEHNYVYWYQQLPGEGLKFMVYLQKENILDDSGMPTKRFSAEFPKEGPSVLKIRLAELGDSAVYFCASSL
Felis catus V182 trbv AANG03031954.1 64916 GSGLGALVSQDPRTAVCKSGTYVMIQCHSVGIQAITVFWYRQFPEQGLTLMATSNVDSKAAYEQGFSETEFSISHPNTTFSSLTVRSAKPADSSLYFCSAS
Felis catus V183 trbv AANG03031954.1 57752 SMDTQVTQSPRYLVRGKKQSAKMNCIPVKGHSYVYWYRRKLEEFKFLVYLQNEDILDKIEKFEDQFSAQCPKNSPCSLKIESTEPGDSALYFCASSK
Felis catus V184 trbv AANG03031954.1 40808 SVDAGITQTPRNGIIETGKSIVLECSQTMDHAYMYWYRQDPELGLQLVYLSYGTDDINKGEVSNGYSASRKEREKFSLFLETAIPKQTALYFCATRD
Felis catus V185 trbv AANG03031954.1 34931 LVDASVSQTPRHYVSGTGKKITLECSQTMGHENMYWYRQDPGKALQLIHYSYGINTTEEVEASSGSTVSRIRKEHFPLTLESTSPSQTSLYFCASSE
Felis catus V186 trbv AANG03031954.1 28902 LKDAVVTQFPRHKILGTGKKLTLQCTQDMNHFSMYWYRQDRGSGLQLIYYSTGTEAFEKGDIPEGYHVSQNELPYFPLTLDSASTNQTSVYFCASSL
Felis catus V187 trbv AANG03031954.1 19084 PVVARVTQTPRHLITGTGKRLTVRCSQDMNHDALYWYRQDSGLGLKLIYYSRNVDFIEKGDAPDGYAVSRKEERNFPLTLESTSTSQTPLYLCASSKSS
Felis catus V188 trbv AANG03031954.1 515 TVFSALLSQKPHRDICQRGTSVTIHCEVDIQFTLMFWYHQLPGQSLVLMATTNQGLEATYEHGFTKDKFPISRPTLVFSTMTISNVSLEDSSFYFCSAG
Felis catus V189 trbv AANG03031955.1 27760 PVDTAVTQTPKHLVTATGSNGTLKCEQRLGHNAMYWYKQSAQRPPKLMFAYSYKELAENDSVPSRFTPECSDSSLLHLHVAALQPEDSALYLCASSE
Felis catus V190 trbv AANG03031955.1 19725 PLDTAVSQTPKYLIAQMGTEKLLQCEQKLSHDAMYWYKQDSKKLLKIMFAYNNKELVHNETVPSRFSPKSPDKAHLNLRVRALETGDSAVYLCASS
Felis catus V191 trbv AANG03031955.1 16094 PVDTAVTQTPKHLVAATGSNGTLKCEQRLGHNAMYWYKQSAQRPPKLMFAYSYKELAENDSVPSRFTPECSDSSHLHLHVAALQPEDSALYLCASSK
Felis catus V192 trbv AANG03031955.1 2204 PADSGLTQTPRHLVKARGQQVTLSCFPISGHLSLYWYQQAVGQGPQLLIQYYNREERGKGNFPERFSAQQFPDSHSELNMTSLELTDSALYLCASSP
Felis catus V193 ighv AANG03040595.1 4700 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTYSSYYMHWVRQAPGKGLQWVAYIYTDGSSTNYADSVKGRFTISIDNSKNTLYLQMNSLKTEDTATYYCAR
Felis catus V194 ighv AANG03041116.1 3895 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYDMNWVRQAPGKGLQWVAYISSSGGSIYYADSVKGRFTISRDNAKNTLYLQMNNLKAEDTATYYCAS
Felis catus V195 iglv AANG03041264.1 5051 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVSWYQQVPGTAPRLLIYENNKRPSGVPDRFSGSKSGSSGSLTITGLQADNEADYYCAS
Felis catus V196 iglv AANG03041264.1 473 IWAQSGPNQPSSVSGALGQRVTISCTGVGSWVDWYQQIPGIAPKTIIYVNSNRPSGVPDRFSGSTSGSTATLTITGLQAEDEADYYCSSWYSSGIT
Felis catus V197 ighv AANG03042108.1 1020 IQCDVQLVESGGDLVKPGVSLRLTCVDSGFTFSRYAMIWVHQAPGKGLQWVSDISSGGSTHYADSVKGQFTISRDDAKNTLYLQMKNLKTEDTATYYCAR
Felis catus V198 ighv AANG03042276.1 1904 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMHWVRQAPGKGLQWVAQISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAS
Felis catus V199 ighv AANG03042792.1 1040 VQCDVQVVESGGDLMQLGGSLRLTCVASGFTFSSSRMSWVRQAPGKGLQWVSAISSGGSTYYADSMKGRFTMSRDKAKNTLYLQMNNLRAEYKATYYCAR
Felis catus V200 ighv AANG03044183.1 1338 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSNAMSWVRQAPGKGLQWVSAISYDGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V201 ighv AANG03045540.1 1869 VQCDVHLVESGRDLVKPGGSLRLTCVASGFTFSSYGMSWVRQAPGKGLQWVAYIYTDGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLKTEDTATYYCAR
Felis catus V202 iglv AANG03051073.1 453 SLSQPVVTQPASLSASLGATARLTCTLSRDINAGGYYIYWYQQKPGSPPRYLLYYYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Felis catus V203 ighv AANG03053594.1 994 VQCDEQLMESGGDLVKPGGSLRLTCVASGFTFSRYGMSWVRQAPGKGLQWVAAISGSGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V204 iglv AANG03054518.1 1178 SLSQPVVTQPASLSASLGATARLTCTLSRDINVGGYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V205 iglv AANG03062470.1 973 SLSQPVVTQPASLSASLGTTARLTCTLSRDINVGSYSIYWYQQSPGSPPRYLLYYYSDSDKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V206 ighv AANG03063071.1 646 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSNYWMSWVRQAPGKGLQWVAYIYDDGSSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAS
Felis catus V207 iglv AANG03065548.1 907 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYGNSYRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSGRA
Felis catus V208 ighv AANG03067946.1 926 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYDMSWVRQAPGKGLQWVAAISYNGGSTGYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V209 iglv AANG03096182.1 689 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYGNSYRPSGVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWDSSLSA
Felis catus V210 trav AANG03103078.1 713 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGIPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKKHETTFHLRKSRALGSDAAKYFCAVR
Felis catus V211 iglv AANG03103757.1 730 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVSWYQQVPGTAPRLLIYENNKRPSGVPDRFSGSKSGSSGSLTITGLQADDEADYYCASWDDSLS
Felis catus V212 iglv AANG03106819.1 674 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYMDWYQQIPGMAPKTIIYGNSNRHSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCSSWYSSGSA
Felis catus V213 ighv AANG03110359.1 779 VQCDVQLVESGGDLLKPGESLRLTCVASGFTFSSYSMQWVPQAPGKRLQCVAYIRDDGSSTSCTDSVKGRFTISRDNAKNMLYMKMNNLRAEDTATYYCAR
Felis catus V214 iglv AANG03115390.1 610 IWGQSGPNQPSSVSGALGQRVTISCTGIDSYVGWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCVSWYSSGRA
Felis catus V215 iglv AANG03118509.1 627 SWAQSVLTQPPSVSGSLGQRVTISCIGSSSNIGGGNYVSWYQQVPGTAPSLLIYENNKRPSGVPNRFSGSKSGSSGSLTITGLQADNEADYYCASWDNSLS
Felis catus V216 iglv AANG03122753.1 478 IWGQSGPNQPSSVSGALGQRVTISCTGIDSYVGWYQQIPGMAPKTIIYGNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCVSWYSSGRA
Felis catus V217 trav AANG03132576.1 615 GAGAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYMQHPNQGLRLLLKYISGDILVKGTKGFEAEFRKSEKAFHLRKHSAHWSDTAKYFCAVS
Felis catus V218 ighv AANG03160177.1 541 VHSQVLLVQSGAEVRKPEASVKIFCKASGYSFTDYYMYWVRQAPAQGFEWMGSIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSTDMAVYYCAR
Felis catus V219 ighv AANG03174853.1 631 VQCEVQLVESEGDLVQPGGSLRLTCVASGFTFSSASMSWVRQAPGKGLQWVSAISSGGSTNFADSVKSLFTISRDNAKNTLYLQMNNLKTEDTATYYCAK
Felis catus V221 trgv AANG03320948.1 248283 GLGQGNLEQPEISISRARGKSAHVSCKMSTEVIDRAIHWYRQKPDQEIEHLTLVSTQPVRVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAVYFCASWGW
Felis catus V222 trgv AANG03320948.1 240826 TSGGIFITQFVPSITKKKGNTAFLECQVKTGVLKKNVNIHWYRQRPDQPLKRILYISSNENVVHEQGISEEKYEARKRQRDLPASLRIHKISEEDAGLYYCACWD
Felis catus V223 igkv AANG03324073.1 12152 ACGAITMTQSPGSLAGSPGQQVTMNCRASQSVSSYLAWYQQKPGQHPKLLIYSASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVASYYCQQYYSSP
Felis catus V6 trbv AANG04000096.1 32627418 PVDTAVTQTPKHLVTATGSNGTLKCEQRLGHNAMYWYKQSAQRPPKLMFAYSYKELAENDSVPSRFTPECSDSSLLHLHVAALQPEDSALYLCASSE
Felis catus V7 trbv AANG04000096.1 32635452 PLDTAVSQTPKYLIAQMGTEKLLQCEQKLSHDAMYWYKQDSKKLLKIMFAYNNKELVHNETVPSRFSPKSPDKAHLNLRVRALETGDSAVYLCASS
Felis catus V8 trbv AANG04000096.1 32639086 PVDTAVTQTPKHLVAATGSNGTLKCEQRLGHNAMYWYKQSAQRPPKLMFAYSYKELAENDSVPSRFTPECSDSSHLHLHVAALQPEDSALYLCASSK
Felis catus V9 trbv AANG04000096.1 32652975 PADSGLTQTPRHLVKARGQQVTLSCFPISGHLSLYWYQQAVGQGPQLLIQYYNREERGKGNFPERFSAQQFPDSHSELNMTSLELTDSALYLCASSP
Felis catus V10 trbv AANG04000096.1 32657820 PVNAGITQTPAFQILGAGHSMTLRCEQDKDHDYMSWYRQDPGHGLRLIHYSVSAGTTERGEISNGYNVSRSNTKNFPLTLTSATPSQTSVYFCASSD
Felis catus V11 trbv AANG04000096.1 32659701 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHVGLYWYRQAVGQGPEFLVSFQNEDKVDSSGMPSNDRFQVNRSEGSYSILQIQRAEPGDSAVYLCASSP
Felis catus V12 trbv AANG04000096.1 32669348 PVEAGVTQTPRYLIKARGQQGTLRCSPISGHSSVSWYQQALNQGPQIIFEFFEYAQRTKGNFPDRFSGQQFHDYASELHVSSLEPTDSAVYLCASSL
Felis catus V13 trbv AANG04000096.1 32674621 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHVGLYWYRQAVGQGPEFLVSFQNEDKVDSSGMPSNDRFQVNRSEGSYSILQIQRAEPGDSAVYLCASSP
Felis catus V14 trbv AANG04000096.1 32681449 PAGAGVTQSPRHLVKGSGGKAVLKCRPMSGHRSVSWYQQAPGQGPQFLIELFGQETREKGNLPSHFSVEQFSDDSSQLNMSSLELGDSASYLCASSL
Felis catus V15 trbv AANG04000096.1 32686404 PMDAEITQNPRYKVTGTGKRVILKCDQTENYDYMYWYRQDPGHGLKLIYYSNGFDSINKGDVPDGYAVSRKNMEDFPLVLESATSSQTSVYFCANSY
Felis catus V16 trbv AANG04000096.1 32699028 PTDAGVTQTPRHKVTMKGQTVTLRCEPISGHASLYWYRQTSGQGLKQLVYFNNQASIDDSGMPSDRFSAKMPEKSLSTLEIQRTEPGDSATYLCASSL
Felis catus V17 trbv AANG04000096.1 32719220 HTGARVIQSPRYQVTGIGKQVSLSCSQNLNHDAMYWYQQKPNQAPKLLLYYYDTNLYTEKDTSNNFKASRDNSSFCSLDILLAGFEDTAVYLCASSK
Felis catus V18 trbv AANG04000096.1 32735693 PMNAGVTQNPEHLVRGTGQEATLRCSPEKEHNYVYWYQQLPGEGLKFMVYLQKENILDDSGMPTKRFSAEFPKEGPSVLKIRLAELGDSAVYFCASSL
Felis catus V19 trbv AANG04000096.1 32742405 GSGLGALVSQDPRTAVCKSGTYVMIQCHSVGIQAITVFWYRQFPEQGLTLMATSNVDSKAAYEQGFSETEFSISHPNTTFSSLTVRSAKPADSSLYFCSAS
Felis catus V20 trbv AANG04000096.1 32749568 SMDTQVTQSPRYLVRGKKQSAKMNCIPVKGHSYVYWYRRKLEEFKFLVYLQNEDILDKIEKFEDQFSAQCPKNSPCSLKIESTEPGDSALYFCASSK
Felis catus V21 trbv AANG04000096.1 32766527 SVDAGITQTPRNGIIETGKSIVLECSQTMDHAYMYWYRQDPELGLQLVYLSYGTDDINKGEVSNGYSASRKEREKFSLFLETAIPKQTALYFCATRD
Felis catus V22 trbv AANG04000096.1 32772405 LVDASVSQTPRHYVSGTGKKITLECSQTMGHENMYWYRQDPGKALQLIHYSYGINTTEEVEASSGSTVSRIRKEHFPLTLESTSPSQTSLYFCASSE
Felis catus V23 trbv AANG04000096.1 32778434 LKDAVVTQFPRHKILGTGKKLTLQCTQDMNHFSMYWYRQDRGSGLQLIYYSTGTEAFEKGDIPEGYHVSQNELPYFPLTLDSASTNQTSVYFCASSL
Felis catus V24 trbv AANG04000096.1 32788257 PVVARVTQTPRHLITGTGKRLTVRCSQDMNHDALYWYRQDSGLGLKLIYYSRNVDFIEKGDAPDGYAVSRKEERNFPLTLESTSTSQTPLYLCASSKSS
Felis catus V25 trbv AANG04000096.1 32808222 TVFSALLSQKPHRDICQRGTSVTIHCEVDIQFTLMFWYHQLPGQSLVLMATTNQGLEATYEHGFTKDKFPISRPTLVFSTMTISNVSLEDSSFYFCSAG
Felis catus V153 trav AANG04001761.1 44009781 GLRAQSVSQPDQVTVAEGDPVTVKCNYSVSGNPYLFWYVQHRNQGLRFLLKYITGANLVKGNYGFEAEFNKSQTSFHLKKPSILGSDSAVYFCAVT
Felis catus V154 trav AANG04001761.1 44012541 GAGAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYMQHPNQGLRLLLKYISGDILVKGTKGFEAEFRKSEKTFHLRKPAVQWSDTAKYFCAVS
Felis catus V155 trav AANG04001761.1 44017586 TLSLAKTTQPVFIESYEGQEVSIPCNHTKIATNEYIHWYRQFPNQGPQFVIQGYKTNVENEVASLFISADRTSSTLSLPRAALRDTAVYYCTVSD
Felis catus V156 trav AANG04001761.1 44025465 MSRGEEVKQHPSFLSVWEGDSFVINCTYTDSASTYFFWYKQQPGKGLQLLIYTVSSMDKKQEQRLTVLLNKKDKHLSLQVTRTHPGDSATYFCAVR
Felis catus V157 trav AANG04001761.1 44032104 VSSQKMEQSPQSLNIQEGEKAVLTCNCTNFSPVVFQWYRQDPGRGLVFLLLIRENESKKQTGRLKATFDKTIKQSSFYITEPQPADSATYLCAA
Felis catus V158 trav AANG04001761.1 44045910 DTSAQSVTQLDGHVTVSEKAHLELRCNYSYGATPNLFWYVQYPNQGLQLLLKYFSGPPNVLVQGIKGFQAEFRKNETSFHLRKHSAHWSDSAKYFCAAS
Felis catus V159 trav AANG04001761.1 44050921 QASQSGLLTVTLSERASLTVNCSYETTQYPALFWCVQYPGEGPQLLLKASKANEKGSSKGFEATYHKEPNSFHLKKSSVQVSDSAVYYCALR
Felis catus V160 trav AANG04001761.1 44057951 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGIPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKKHETTFHLRKSRALGSDVAKYFCAVR
Felis catus V161 trav AANG04001761.1 44071286 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Felis catus V162 trav AANG04001761.1 44077228 LSRGENVEQHPSTLSVQEGNSCVITCSYSDSASYYFPWYKQELGKGPQLIIDIHSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V163 trav AANG04001761.1 44104323 QTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPNLFWYVQYPGEGPQLLLKAFRDKEKGSHKGFEATYDGKSKSFHLEKSSVQASDSAVYYCAAS
Felis catus V164 trav AANG04001761.1 44120935 RTHGDSVTQMEGPVTLFEGEPLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATLQSKSKTFHLEKSSVQVSDSAVYYCALM
Felis catus V165 trav AANG04001761.1 44130429 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGDGSLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Felis catus V166 trav AANG04001761.1 44147894 QTHGDSVTQMEGPVTLSKGESLTINCTYSATGYPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCVLS
Felis catus V167 trav AANG04001761.1 44153353 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGTPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKKHETTFHLRKSRALGSDAANYFCAVR
Felis catus V168 trav AANG04001761.1 44202898 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASDYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V169 trav AANG04001761.1 44207252 SSISQKVTQAPPAMLVQEKEAVILECTYDTSDPNYSLLWYKQPSRGEMIFLVRQDSHNQQNATEGRYSLNFQKARKSIHLVISASQLEDSAVYFCALRS
Felis catus V170 trav AANG04001761.1 44220082 QTHGDSVTQMEGPVTIPERKSLTINCTYSTTWTPTLFWYVQYPRESPQLLLKALRDKETGSHKGFEATYDSKSKSFHLEKSSVQASDSAVYYCAAS
Felis catus V171 trav AANG04001761.1 44227886 VSGKNQVEQHPPSQIIQEGENCTFQCNYTVSPFSHLKWYKQGTGRSPAFLIIMTDDDSKNPSGRYTVTLDATSKHSFLHITAAQLSDSAVYICVVS
Felis catus V172 trav AANG04001761.1 44240127 MKRSHQNEVKQSPVPLTVLEGVTAFLNCSYSDSASQYFVWYRQYSGKGPEFLMRMYSNGEKEEGRFTGLLNKASLYLSLFIRDSQLSDSATYLCAV
Felis catus V173 trav AANG04001761.1 44244336 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGMTYVFWYVQYPNQGLQLLLKYISGDTLVKGLNGFEAEFKKSETSFHLRKSPALGSDAAKYFCAVS
Felis catus V174 trav AANG04001761.1 44249971 GTRAQTVTQPEDHLSVFTGDPVQVKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISGGSVKGFTASLNQGEMSFHLKKPSAQEEDSAMYYCVLG
Felis catus V175 trav AANG04001761.1 44256183 VNSQQEQDHQTLSIQEGEKATMNCSYKTSINYLQWYKQDSGRGLVLLILIRLNEREKNSGRLRVTLNTSLKSSSLSITASQTADTATYFCATD
Felis catus V176 trav AANG04001761.1 44262786 GINGDSVTQTEGSVTLFEGTPLTLNCTYQSSYTVFVFWYVQYQNKAPQLLLKSLSENQRAEHHGFHASLVKSDGSFHLQKRSVRMSDSAVYYCVLG
Felis catus V177 trdv AANG04001761.1 44277630 ASMAQKVTQAQPAISMPEKEAVTLDCVYEASGYTYYLFWYKQPPSGEMILLIYQESYSEQNATEGRYSLNFQKPDRSISLTITALQLTDSAVYFCALR
Felis catus V178 trav AANG04001761.1 44307358 VSSKQKVMQSPEALNVQEGDSVVLNCSYTGSTFYSLQWFRQDPGKGLTVLLLIQSAQREETSGRIKASLDKPSKHSTLYIAASQPSDSATYLCAIE
Felis catus V179 trav AANG04001761.1 44323352 GTGAQSLTQPDGHITVSEGARLELSCNYSSSGTTYLFWYVQHPNQGLQFLLKYLSGPSDALVQGIKGFEAEFKKSEKAFHLRKHSAHWSDSAKYFCAVS
Felis catus V180 trav AANG04001761.1 44328929 VTGLMVKQSPPDLSLQEGLSCTLQCSFSTSVTRVQWFRQNPGGHLIHLFYIPSGTKQNGRLRSTTVVEDRRSLLYISSSRTTDSAIYFCAGAE
Felis catus V181 trav AANG04001761.1 44336680 KSGQEQVKQGPPSLIVQEGASSTLNCTYENTAFDYFVWYRQYPGQGPALLLAVFSVKHTKEDGRFTVFVSESAKQFSLHIMASQPGDSATYFCAAS
Felis catus V183 trav AANG04001761.1 44351210 VCSVLDVNQYPLSLHAHEGENTNFTCHFPTSSFYGLQWYRWEPAKSPKFLFTIALNGDEKEEGRVKVTLDTKKGSSSLYIKGSQPEDAATYLCALT
Felis catus V184 trav AANG04001761.1 44358625 VNGQEIKQIPQFLLLQEGENFTIYCNSSRTLNSLHWYKQRPGGSPILLITLVKSGDVKQERLTAWFGDTRKNSLLHMVATQTADSGVYFCTGAQCSQ
Felis catus V185 trav AANG04001761.1 44361001 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSGTTYVFWYVQYPNQGLQLLLKYISGDTLVKGLNGFEAEFKKSETSFHLRKSPALGSDAAEYFCAVS
Felis catus V186 trav AANG04001761.1 44378320 VRVQMNVEQSPGVLNLQEGRNTSMMCNYSSIITSVQWFQQNPEGHLVSLSFITSGMQRKGRLIFTLNFQERNSHLHITDSQPGDSGTYFCTVE
Felis catus V187 trav AANG04001761.1 44383954 VNSQQNADQQQVKQTPSLSVQEREISILNCDYNNNMFDYFIWYKKYPAKSLEFVISIRSTVDKNEDEKFTVYLNKSAKHLSLHIAASQPGDSALYFCTAN
Felis catus V188 trdv AANG04001761.1 44402076 SVMAEKVIQMQNTVIIQEGKAATMECKYETSWSNYYTLYWYKQPPSGRMHFLIYQDESKPNAKQGRLSMNFQKTEKSIALTISLVQLADSAVYFCALSS
Felis catus V189 trav AANG04001761.1 44405201 IMSDAKTTQPNAMESTEEEPVRLPCNHSTISGSEYIHWYRQIPHHGPEYLIHGLKDNVTNGMASLTIAKDRKSSTLVLPRVTLRDAAVYYCIAR
Felis catus V190 trav AANG04001761.1 44415508 VSSQELEQSPRSLIIQEGEDFTINCSSSKTFYTLGWYRQKNGEGLSSLMMLQKSGEEKTHEKITAKLDEKKQQTSLHITASQPSHSGIYLCAGD
Felis catus V192 trav AANG04001761.1 44429373 VSSEDKVIQSPPSLVVQEEDSATLNCSYQVTNFQSLLWFQQQENAPTFLFRQISNGIQKSGRLKGTLDKKALLGTLHITATQLGDSATYLCAVE
Felis catus V193 trdv AANG04001761.1 44448543 SSMAQKVTQTQPEMSVYEAETVTLDCTFDTRVSNYYLFWYKQPPSGEMVLIIRQEANKQENATNNRFSVNFQKADKSFSLRISAAQLEDAAMYLCALME
Felis catus V194 trav AANG04001761.1 44455963 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTSDSNYYLFWYKQPPSREMLLIIRQEANKQENATNNRFSVNFQKADKSFSLRISAAQLEDAAMYLCALME
Felis catus V195 trav AANG04001761.1 44489751 ASGKNGVEQSPQSLTAQEGNFVTINCSFSVGMTALHWLQQNPGGGIVSLFILSLEMKKKGRIRATINTEELHSSLYITASQPRDSAIYLCAVE
Felis catus V196 trdv AANG04001761.1 44528412 SSNTQSVTQTPGPVNKQERESVSLHCSFTLSYTYYVMSWFRQLSNGKMTEIINLYSTSTNTKKGRYSVSHQKGNKALSLTITGLMPTDSGVYFCAVGEA
Felis catus V197 trdv AANG04001761.1 44543177 SSNTQSITQSPSSVQEKEGESVTLDCRFTLNFDYYVMSWYQQLSNGKMTEIIYLVSTSTNTREGRYSVSHWARDKTLRLTITGLMPTDSGIYFCAVGEA
Felis catus V198 trdv AANG04001761.1 44555799 SSNTQSVTQYPSSVHKQEGESANLFCRFTLSYTYYVMSWFQQPSNGKMTEIIYLYSDSTNNKKGRYSVSYQARDKALRLTITGLMPTDSGVYFCAVGEA
Felis catus V199 trdv AANG04001761.1 44594190 SSNTQGITQSPSLVQEKEGESVTLNCRFTLSYTYYVMRWYQQLSNRKMTEIIYLYSASTNTRTGRYSVSHQKGNKAVSLTITGLMPTDSGIYFCAVGEA
Felis catus V200 trav AANG04001761.1 44641420 GSCKTEIIQSSNITAIIGTDVEFPCQYNIPDKNFESVYWYLQRADQRFTYIGHTSQGTVELEHYQLFVNRKLLSSTLTIKHVQPRDKAIYYCAV
Felis catus V201 trdv AANG04001761.1 44647942 VSLDIVLKPDTETLTVLVGEPATFRCSITGGDWKNYQVSWYKKNEDNSLTLVYRLSNSSNANISSNFKGNIDALKGQCILDIQRATIKDTGTYYCASD
Felis catus V228 iglv AANG04001865.1 5107 SWAQSELTQPPSVSGGLGQTVTISCAGSRSNIGIAGVNWYQQHPGKAPKLLIYGSSNRPSGVPDRFSGSKSGNTGSLTITGLQAEDEADYYCLSVDVTRGA
Felis catus V229 iglv AANG04001865.1 17162 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSHISNNFVNWYQQLPGTTPKTIILWDDSRPSGVSERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Felis catus V230 iglv AANG04001865.1 40962 SWAQSVLTQPPSVSGALGQRVTISCTGSSSNIGRGNYVSWYQQLSGTAPKLLIYGNSNRPSGVPDRFSGSKSGSTGSLTITGLQAEDEADYYCAAWDSSLN
Felis catus V265 ighv AANG04002513.1 28869 GGVWGKPGEAWRVPETNLCASGFTFSSYEMSWVHQAPGKGLQWVSAIGSGGSTYYTDSVKGRFTISRDNAKNMLYLQMNNLKTEDTATYYCARDMVRG
Felis catus V324 trgv AANG04003224.1 5097179 DVAAISVEQPAVVVARAGSWATLPCKASTSVSYIHWYRHQEGTAPKRILMLDMSSSYVTKDGVLTADKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEDQ
Felis catus V325 trgv AANG04003224.1 5146111 GVAAISLTQRAVVVERVGGLATLSCQASAYVRYIHWYLHQEGTAPKRILMLDMSRLSVQRYGGLKADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Felis catus V326 trgv AANG04003224.1 5186699 SWAAISLGQPSMVVAQAGRSATLGCKASTKVSYIHWYHHQEGAAPKRLLRLDMSGTFVQKDGGLNEDKVNAKRGKGSNSCDLSVLKLEKSDEGVYYCAAWE
Felis catus V327 trgv AANG04003224.1 5341846 GMAAISLTQRAVVVERVGGLANLSCQASASVSYIHWYLHQEGTDPKRILRLDMSRLSVERYGGLEADKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Felis catus V355 ighv AANG04003346.1 65121 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMNWVRQAPGKGLQWVSWINTDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V356 ighv AANG04003346.1 84945 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYGMSWVRQAPGKGLQWVAYIRYDGSSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Felis catus V371 igkv AANG04003404.1 1639258 ACGAITMTQSPGSLAGSPGQQVTMNCRASQSVSSYLAWYQQKPGQHPKLLIYSASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVASYYCQQYYSSP
Felis catus V376 iglv AANG04003430.1 8354 SLSQPVVTQPASLSASLGATATLTCTLSRDVSVGSKNIYWYQQKPGSPPRYFLYYYSDSSNELGPGVPSRVSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V377 ighv AANG04003490.1 195063 VQCDVQLVESAGDLVKPGGSLRLTCVASGFTFSSNSMNWVRQALGKGLQWVAYIRYDGSSTYYTDSVKGRFTISRDNAKNTLYLQMNNLRAEDMATYYCAR
Felis catus V400 ighv AANG04003826.1 20735 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYDMNWVRQAPGKGLQWVAYISSSGGSIYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAS
Felis catus V472 trbv AANG04000096.1 32852170 VSAQTIHQWPPVRVQLVGSPLSLECIVKGESNPYLYWYLQAEGGPPQLLFYSLNIHQVDPEAPRNFTASRPQDGQFILSSQKLLLSDSGFYLCAWG
Felis catus V486 iglv AANG04000189.1 75562 QSVLTQPPLVSGALGQTVTISCTVSDSSFWGGEFIHWYQQLPGAAPKLLIYGNNNRLSGVPSRFSGSKSGNSHSLTIIGLQPEDEADYYCQYFDDRVI
Felis catus V487 iglv AANG04000189.1 61993 SWTQSVVTQPSEVSKPVNKSVTISCTGSSSNVGAGGVSWYQQLPGSVPKVLIYGSSARPAGVPSRFTGSRSGNVASLSISSLQAEDEADYYCSVW
Felis catus V488 iglv AANG04000189.1 55792 SLSQPVLTQPASLSASLGATARLTCTLSRDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V489 iglv AANG04000189.1 45673 SWAQSELTQPPSVSGGLGQTVTISCAGSANNIGRIGVNWYQQFPGKAPKLLISAYSNQPSRVSGRFSGSTSGNTGSLTITGLQAEDEADYYCTSADPIQS
Felis catus V490 iglv AANG04000189.1 27234 SLSQPVVTQPASLSASLGATARLTCTLSRDINVGGYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V501 trdv AANG04000369.1 11580645 AHAQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Felis catus V597 ighv AANG04001730.1 11587 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSSSMNWVRQAPGKGLQWVAYIYDDGSSTYYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAR
Felis catus V607 trdv AANG04001761.1 44725141 RGVLCDHVTQSPPYQTVASGSKVTLFCTYHTTYSNPDLYWYRIRPDRSFQFILYRDNTRSKDADFTQGRFWVWHSQSQKTFHLVISVEPEDSATYYCAIY
Felis catus V646 trav AANG04001847.1 30299 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVTYVQWFRQNPGDGSLTRLFYITSGMKQDGRLNCTVNPKDRHSSLHIMASQQEDSATYLCAVE
Felis catus V647 trav AANG04001847.1 25535 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASDYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Felis catus V648 trav AANG04001847.1 14852 QTHGDSVTQMEGPVTLSKGESLTINCTYSATGYPTLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCAAS
Felis catus V649 trav AANG04001847.1 2850 GVRGIDVEQTPAALSLQEGASSTLRCNFSSSVNSVQWFRQNPRGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Felis catus V735 iglv AANG04003056.1 54422 SWAQSVLTQPPSVSGALGQTVTISCAGSRSNIGIAGVNWYQQLPGKAPKLLSMLIDRNNPHGFPERIRESPGSKSGNTGSLTITGLQAEDEADYYCSAWDAILK
Felis catus V736 iglv AANG04003056.1 37136 SLSQPVVTQPPSLSASLGATARLTCTLSREVSVGSKSIYWYQQKPGSPPRYFLYYYSDSSNELGPGVPSRVSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V737 iglv AANG04003056.1 27397 SLSQPVLTQPSSLSASPGTTARLTCTLSSGFSVGGYYINWFQQKPGSPPRYLLYYYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGPQPEDEADYYCAI
Felis catus V738 iglv AANG04003056.1 17641 SLSQPVVTQPPSLSASLGATARLTCTLSREVSVGSKSIYWYQQKPGSPPRYFLYYYSDSSNELGPGVPSRVSGSKDASANAGLLLISGLQPEDEADYYCAI
Felis catus V754 trgv AANG04003224.1 5319556 GLGQGNLEQPEISISRARGKSAHVSCKMSTEVIDRAIHWYRQKPDQEIEHLTLVSTQPVRVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAVYFCASWGW
Felis catus V755 trgv AANG04003224.1 5312095 TSGGIFITQFVPSITKKKGNTAFLECQVKTGVLKKNVNIHWYRQRPDQPLKRILYISSNENVVHEQGISEEKYEARKRQRDLPASLRIHKISEEDAGLYYCACWD
Felis catus V796 igkv AANG04003404.1 1767970 SGGWHVLTQTPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Felis catus V797 igkv AANG04003404.1 1759823 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYRASTLQTGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQSSNLP
Felis catus V798 igkv AANG04003404.1 1752167 ASGTAELTQSPTHLSVSLTDSVSLICRANESVSDYLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSDTEFILKISTVEADDAAIYYCQQDYALP
Felis catus V799 igkv AANG04003404.1 1729535 SGADVVMTQTPLSLPVTPGEPASISCRASQSLLHSDGNTYLNWYLQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCLQGTKYP
Felis catus V800 igkv AANG04003404.1 1716662 SSGDIVMTQTPLSLSVTPGEPASISCRASQSLLHSDGNTYLNWYLQKPGQSPRRLIYLVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQALQYP
Felis catus V801 igkv AANG04003404.1 1711753 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Felis catus V802 igkv AANG04003404.1 1707052 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYRASTLQTGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQHNSG
Felis catus V803 igkv AANG04003404.1 1701897 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRRLIYRVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCLQG
Felis catus V804 igkv AANG04003404.1 1686732 SSGEVVLTQSSAFLSRTLKEKATITCRANQGISTILHWYQQKPNQAPKLLVKYASQSVSGAPSRFSGSGSGTDFTLTISSPEPEDAATYYCQQSNNLP
Felis catus V805 igkv AANG04003404.1 1675870 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLNWYLQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Felis catus V806 igkv AANG04003404.1 1662088 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLNWYLQKPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQG
Felis catus V807 igkv AANG04003404.1 1655355 AGGTTELTQSPTHLSVSLTDSVSVICRASESISDHLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDAAAYYCQQGYALP
Felis catus V852 iglv AANG04003942.1 582923 SWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPKTIIYLNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSGSA
Felis catus V853 iglv AANG04003942.1 562514 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVSWYQQVPGTAPRLLIYENNKRPSGVPDRFSGSKSGSSGSLTITGLQADDEADYYCASWDNSLS
Felis catus V854 iglv AANG04003942.1 549162 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSGSA
Felis catus V855 iglv AANG04003942.1 538209 SWAQSVLTQPPSVSGTLGQRITISCTGSSSNIGGGNAVSWYQQVPGMGPKTVIYWNNSKPSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCSAWDDSLS
Felis catus V856 iglv AANG04003942.1 516471 SWAQSVLSQPPSVSGALGQTVTIPCAGGANNIGIAGGNWYQQLPGKAPKLLIYDSSDRPSGVPERFSGSKSGNTGSLTITGLQAEDEADYYCQSLDFTQGA
Felis catus V857 iglv AANG04003942.1 499651 SWAQSRLTQPPSVSGSLGQRVTISCAGSSSNIGGYGVNWHQQFPGMAPKTIIYGNSNRPSGVPDRFSGSKSGNTGTLTITGLQAEDEADYYCSSWDSSSSA
Felis catus V858 iglv AANG04003942.1 486520 SLSQPVVTQPASLSASLGATARLTCTLSRDINAGGYYIYWYQQKPGSPPRYLLYYYSDSNKHQGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Felis catus V859 iglv AANG04003942.1 462757 SWAQSVLAQPSSVSGSLGQRVTISCSGSSSNIGSNYVSWYQQLPGTTPKTIIYWDNSRPSGVSERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDGSLR
Felis catus V860 iglv AANG04003942.1 415165 ATSQEVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYASWVQQKPYQRFQGLIGGTSYRNPGVPARFSGSLVGQKAVLTITGAQSEDEAEYYCVLWFSNH
Felis catus V862 iglv AANG04003942.1 313513 SWAQSALNQPPSLSGDLGRTVTISCAGSSNDIGRYSDVSWYQQLEGTSPKLLIHNVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYASSNT
Felis catus V863 iglv AANG04003942.1 304993 SMASYVLTQPPSVSMNLGKTARITCGGNNIGSKYAYWYQQKPGRAPMMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWGGNSD
Felis catus V864 iglv AANG04003942.1 270575 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSSYAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDNSGN
Felis catus V865 iglv AANG04003942.1 249172 CPASVSRSAWALGQIITISCSGSNNDIQGYKDVPWYQQLSATSPKLLFYHVHSQASGIPDRFSGSKSGNTASLTISGLRAEDEADYHCSSCAGSSI
Felis catus V866 iglv AANG04003942.1 227009 SVTASELTQPPAVSVALGQTATITCEGDSFESSMINWYQQKSGQAPVLVIYEDSEQPTGIPDRFSGSNSGDAATLTITGAQAEDEADYYCQSYDNSGD
Felis catus V867 iglv AANG04003942.1 181451 SVASYVLTQPPSVAVNLGQTARITCGGNNIGSSYAYWYQQKSGQAPVLIIYKDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQSYDSNYD
Felis catus V868 iglv AANG04003942.1 162004 FVASSEVTQPPSVSVALGQTARITCSGDMMEKKYTNWHQQKPGQAPIQIIYKDSERPSGIPDRFSSSSSGKTVTLTISGARAEDEADYYCQSYDISSN
Felis catus V869 iglv AANG04003942.1 99448 SIASYVLTQPPSVSVSLGQTARTTCGGNNIESKSVHWYQQKSGQTPVLIIYSDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSSSD
Felis catus V870 iglv AANG04003942.1 87338 SVASYELTQPPSVSVNLGQTARITCGGNNIGNKDAYWYQQKSGQAPMLIIYEDSKRPSGIPDRFSGTNSGNMATLTISGARAEDEADYYCQVWDSSSD
Felis catus V871 iglv AANG04003942.1 79891 SVTSNRVTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKPNQVPLMIIYQDSNRPSGIPDRFSGSNSGNTATLTVSGARAEDEADYYCLS
Felis catus V872 iglv AANG04003942.1 70629 SLASSMPTQSPYILVTLTQTARITCRGNNSGSKSVYWYQQKPGQAPMLVICYGRNQPSRTPDRFSGTNSGNTATLIISEAQTEDEADYYCQVWDSGN
Felis catus V873 iglv AANG04003942.1 51923 SMASYVLTQPPSVSVNLGQTARITCGGNNIGSKHAYWYQQKPGQAPMLVIYYSSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQVWDNSGN
Felis catus V925 ighv AANG04004659.1 28339171 VLSQLTLRESGPGLVKPSQSLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWLGYWSGSTSYNPAFQGRISITADTAQNQFSLQLSSMTTEDTAVYYCAR