WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Trichechus manatus latirostris AHIN00000000.1 (AHIN01) 101 9 3 16 35 26 4 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Trichechus manatus latirostris V250 trbv AHIN01087838.1 15574 VGAQTILQWPVVEVRQVGSSLSLQCTVTGTSNPTLYWYWQATGGAPQLLFYSLDMDNIKGEAPKHFSAFRPRDGQFTLNADKLQPGDSGVYLCAWD
Trichechus manatus latirostris V303 iglv AHIN01116259.1 7303 SWAQYMLIQPPSVSGDLGQQITISCTRSSNNGGFCVHWYQQLPGTAPKLLIHGDSNRHSGVSDRFSYSNSGNSASLTITGLQPEDEAIYHCQSYDDSLS
Trichechus manatus latirostris V304 iglv AHIN01116328.1 21378 SVASYELIQPLSVSVALGQTASITCSGDNIGGKYTHWYQQKPGQAPVLIIYQNTNWPSGIPDRFSGSNSGNIATLTISRAQAEDEADYYCEVCDSGA
Trichechus manatus latirostris V358 igkv AHIN01133775.1 44777 CSGQVILTQAPETLVAPQGAFVSITCRSSSGVGTSMAWYHQKPMEAPRLLIFGASARTSGTPARFRGSGSGVDFSLAIHGVEAEDVGVYYCQ
Trichechus manatus latirostris V359 igkv AHIN01133782.1 11160 SSGDIVMTQTPGPLPVTLGEPATISCKSSQSLLHSDGNTYLNWYQQKPGQAPRLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVAVYYCQQDIQTP
Trichechus manatus latirostris V360 igkv AHIN01133783.1 9282 ARGDTVLTQSPAVVSVSLEESVSFICRTSQGISDYLAWYQKKPGQPPKPLIYDGDDQVSGVPARFSGIQSGTEFILTISSVEVDDAADYYCQ
Trichechus manatus latirostris V361 igkv AHIN01133788.1 49444 SSGDIVMTQTSGPLPVTLGEPVTISCKSSQGLLDSDGNTYLSWYQQKPGEAPWSLIYRVSNRFSGVPDRFIGSGSGTDFTLKISRVEAEVVAVYYCQQGTNVP
Trichechus manatus latirostris V384 trdv AHIN01142881.1 106095 EGMLCNEVIQSPTEQTVGLGGEAMLLCTYKLEISNPDLFWYRMRPDHSFQFVLYRDNSRSKDADFTQGRFSVKHSQTQKTFHLVISLVRAEDSATYYCAYA
Trichechus manatus latirostris V392 igkv AHIN01148346.1 18405 ASGDIVLTHSPASLAASPGERVTINCKSSQSASSYISWYQQKLGQAPKLLIYSASKWASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQYGYYSST
Trichechus manatus latirostris V402 trav AHIN01158254.1 266 IRVEMNGEQSPRVLILQEGRNSSLTCNVSVSTTSVQWFQQSPGGHLIPLFYIASGMQHKGRLESTVNTKERYSHLYIRDAQPGDSATYFCIVE
Trichechus manatus latirostris V403 igkv AHIN01159716.1 1222 ASGDIVLTQSPDSLAVSPAERVTINCKSSQSVSSYLHWYQQKPGQAPKLLIYKATNRASGVPDRFSGSGSGTDFTLTISSLQAEDAAVYYCQQDYSNP
Trichechus manatus latirostris V404 trgv AHIN01160861.1 316 GGSVIRPEQPAYVLGRKGRSVTLRCLVHFTVSYVHWYRQQEGKAPERLLQLAMFKPDVRWDSILKADKITALESQDGNSCTFSVLKLEKSDEGVYYCAAWN
Trichechus manatus latirostris V405 trav AHIN01162791.1 324 KSTQQLEQSPQFLSIQEGDNFTTHCNSSSVFPTFQWYRQRPGEGPVLLLMLMKGGEVKKQKRLTAHFREAKKDSSLHITAAQPEDAGLYLCAGAQRSQ
Trichechus manatus latirostris V406 trgv AHIN01164298.1 363 GLGQWKLEQPDMSISKAASKSAHITCKVFVEDFENANIGWYRLKPNQGVEYLIYIVSTTTPNYASLGGKSKKLEASRNSHTSTSILKINSVEKEDEAVYYCAW
Trichechus manatus latirostris V590 ighv AHIN01061348.1 18782 VLSQVQLQESGPGLVKSSQTISLSCAVPRYSITSGYGWSWIRQSTEKGLQWTGYISYSGSTNYNPSLKSRSSISRDTSKYEFSLQLSSMTTDDTVVYYCAR
Trichechus manatus latirostris V591 ighv AHIN01061365.1 9866 VCAQVQLVKSGAEVKRPGQSLRITCETSGYSFTSYWISWVRQMPGKGLEWIGMIYPGDSDTRYSPSFQSQLTISRDNSISTTYLQWSSLKATDTTMYYCAR
Trichechus manatus latirostris V592 ighv AHIN01061368.1 25148 VLSQVQLQESGPGLVNPSQTLSLTCAVSGVSITSSYNYWSWIRQSTEKGLQWIGYIGYSGSTNYNPSLKSRSSISRDTSKNEFSLQLSSVTTDDTAVYYCAR
Trichechus manatus latirostris V596 ighv AHIN01061374.1 18626 VLSQVQLQESGPGLVKPSDSLTLTCTVFGFSITSSSCCHWFCQPLGKDIEWIGEICYNGSTYYSPSLKSCSTVYRDTAKNQIFLQQSSMTTKNTTMYYCARV
Trichechus manatus latirostris V597 ighv AHIN01061402.1 19081 VEAKDHIVQWGEGTVVSSQKLSLACATYTLPVSESSVSWIRLRPGKGLEWVGVIWANGNTNYSPNLQSRVSISRDTGKNQVFLQLSTVTAEDTGMYYCTQ
Trichechus manatus latirostris V599 ighv AHIN01061425.1 25251 ALSQVQLQESGPGLVKPSQTLSLTCAVSGFSLSSSAVGWVRQPPGKGLEWVGAIAGSGSAYYNPTLKSRVSITKDNSKSQVYFKLNSVNSEDTATYYCAR
Trichechus manatus latirostris V600 ighv AHIN01061427.1 31301 FPGVEVKDHIVQWGYGTVVSSQKLRLACATYTLPVSESSMSWIRLHPGKGLEWVSVISANGNTNYSPNLQSRVSISRDTRENQVFLQLSTVTAEDPGVYYCTQ
Trichechus manatus latirostris V603 ighv AHIN01061445.1 5435 AHSQVQLVQSGAEVKRLAESVKISCRASGYTFTSYAMHWVWQTPERGLQFIGWINTNTGKPKYYQGFTERYVFSMDSLVSTAYLQISGMKSEDTATYYCAR
Trichechus manatus latirostris V604 ighv AHIN01061479.1 22364 ALSQVQLQESGPGLVKPSQTLSLTCAVSGLSSSSYGVGWVRQPPGKGLEWVGAIDYDGDTYYNPTLKSRVSITRDTSKSQVYLKLNSVNSEDTAVYYCAG
Trichechus manatus latirostris V621 iglv AHIN01066960.1 20646 LHQPPSVSSSPRTTVTLACTLSKDYDVGIYSVYWYQQRPGQAPRFLLRFLSPSNKNHGHGIPSRFSGSKDVASNTGYLSISDLQAEDEAVYYCAVGAES
Trichechus manatus latirostris V672 trbv AHIN01087839.1 46114 SMDTEVTQTPRQLVITTKQRATMDCVPIRQHNRVYWYRQKLGEELKFLTYLQNKEALDKSGLPDGRFSAQCTQNSHCSMKIQSTELKDSGMYFCASSP
Trichechus manatus latirostris V673 trbv AHIN01087839.1 40659 SMDTGVTQIPRNRIAQTGKKVTLQCSQTKGHKYMYWYRQDPGLGLQLIYYSLDVNDINKGEASKGYSVFRKEQDKFSLSLEAATPNQIALYLCATSY
Trichechus manatus latirostris V674 trbv AHIN01087839.1 37933 PVKADVSQTPRHYVTGTGKKITLECSQTLGHDYMYWYRQDPGRELQLMHYFYSVNSTEKGELSSRWTVSRRRKEHFSLVLESASPAESSRYLCASSS
Trichechus manatus latirostris V675 trbv AHIN01087839.1 31486 AEDAVVTQFPRHRVLGKGKELTLECSQKMNHLVMYWYRQVPGHGLQLIYYSTGTGSIEDGDVTEGYSVSRDKTQNFPLTLASTSPSQTAVYLCASSE
Trichechus manatus latirostris V676 trbv AHIN01087839.1 27980 PAEPGVSQTPRHRIAKSGDSLTVACSQDLDYEVMYWYRQDPGRGLQLLHYSINVKIVQRGDLPDGYRVSREEKGRFLLTLESAVPNQTALYLCASSF
Trichechus manatus latirostris V677 trbv AHIN01087839.1 21151 SAFGVLVSQKPSRHICQHGTPVTIQCQVDTQVNRMFWYHQPPGQSLILIATANQGSEATYESGFTKDKFAINHPDFTFSTLTVKNSSPEDSSVYLCSAG
Trichechus manatus latirostris V678 trbv AHIN01087840.1 51780 PVLGALVSQHPSRAICKSGASVKIQCRSTGIQAWTILWYHQPPRQSFTLIATSNQGSSVTYEQGFTKAKFPISHPNLTFSTLTVTSGQAEDSSLYFCGAS
Trichechus manatus latirostris V679 trbv AHIN01087840.1 31500 SMETEVTQTPRQLVKARQQTAKMDCVPMEGHAYVFWYRQKLGEELKFLIYFQNEDAMDKSGMPNDRFSAKCPENSPCSMEIQSMEPGDSAVYFCASSQ
Trichechus manatus latirostris V680 trbv AHIN01087840.1 27544 SMDTEVTQTPRQLVKARQQIARMDCVPIKQHVHVYWYRQKLREELKFLAYLKNEETIDGSGLPDKRFSAHCSKNSSCSMEIQSTELGDSAVYFCASSL
Trichechus manatus latirostris V681 trbv AHIN01087841.1 98273 HTDARVTQTPRHKVAEMGHRVTLRCQLISGDNTLFWYRQTSAWGLELLIFFQNQAVIEQVEMLKDWSSAEMPDRSFSTLKIQHAELGDSAIYLCASSS
Trichechus manatus latirostris V682 trbv AHIN01087841.1 89917 PVLSALISQHPSRAICKSGASVKIQCHSMGIQAMTMLWYRQLPGQSFTLIATSNQGSSVTYEQGFTEAKFPISHPDLTFSTLMVTSAQVEDSSLYFCGVI
Trichechus manatus latirostris V683 trbv AHIN01087841.1 48554 HKDAGITQTPRHKVTRTGGNVTLQCSQDLNHDNVYWYQQDPGLGLLLIHYSVDVCVTDKGDIPDGYSVSISNTERFPLTLGSAVRLQTAVYFCTSSV
Trichechus manatus latirostris V684 trbv AHIN01087841.1 38139 SFDAEVTQTPRHLLKGKGQKVKMDCVPIKGHSYVYWYQQIPAKEFKFLISFQNEKIFDGNEMPKERFSAECPQDSACSLEIQPAALQDSAMYFCASRV
Trichechus manatus latirostris V685 trbv AHIN01087841.1 33484 TTDSGITQTPKYLVREEGQNVSLKCEQTFNHDSMYWYRQDPGHGLRLVYYSTITNYVQEGDAAAGYRASRKKMEHFPLVVTRAQRNQTALYLCASSL
Trichechus manatus latirostris V686 trbv AHIN01087841.1 31339 PLLSALVSQQPSRTICKSGASVKIQCRSMDIQAAVMLWYHQLPGQSFTLIATSNQGSRVTYEQGFTEAKFPISHPDLTFSTLTVTSAQAKDSSLYFCGAS
Trichechus manatus latirostris V687 trbv AHIN01087841.1 5244 SFDAEVTQTPRHLLKGKGQKVKMDCVPIKGHSYVYWYQQIPAKEFKFLISFQNEKIFDGNEMPKERFSAECPQDSACSLEIQPAGLQDSAMYFCASRV
Trichechus manatus latirostris V688 trbv AHIN01087841.1 595 TTDSGITQTPKYLVREEGQNVSLKCEQTFNHDSMYWYLQDPGHGLRLIYYSLVSNNVQEGDAAAGYRASRKKKEHFPLMVTRAQRNQTALYLCASSL
Trichechus manatus latirostris V689 trbv AHIN01087842.1 15238 SMDTEVTQTPRQLVKAREQTARMECVPIKGHEYVYWYRQKLGEELKFLIYFNNEEVFDESGMSDKRFSAQCPKNSTCSMEIQSTEPRDSAVYFCASSL
Trichechus manatus latirostris V690 trbv AHIN01087843.1 13034 TTDSGITQTPKYLVQEEGQDVTLKCEQTFNHDSMYWYRQDLGKEAGLVYYSPITNDVQGGDAAAGYSTSQGKKECFPFVVTWAQRNQTALYLCASSL
Trichechus manatus latirostris V691 trbv AHIN01087845.1 8915 SMGAMVIQSPKYRVTSVGKLVSLSCSQNLNHDTMYWYQQKQSQAPKLLFYYYETNFNKEADTSDNFQPQRPNTSFCGLDIGSPGLADSAVYLCASSR
Trichechus manatus latirostris V692 trbv AHIN01087847.1 31358 HTDAGITQTPRHQITRTGRYVTLQCTQDMNHENMYWYRQDPGLELWLIHYAPDVGDTYKGEIPSGYSVSRSNAEHFPLTLESAIPSKTAVYFCTSGASK
Trichechus manatus latirostris V693 trbv AHIN01087847.1 8980 HSEAGVVQTPRHKITEVRQSVALWCDPVSSHNTLYWYRQMPGQGPELLVNFQNEAVLDDAQLPKNRFSAERLKGADSTLRIQAAEPGDSAVYLCASSL
Trichechus manatus latirostris V695 trbv AHIN01087851.1 50338 SADSGITQRPKYLVVGMGIKKSLICEQHLGHNSMYWYKQVPEKPPELMFQFNYKELVTNETTSSRFSPKCRDSSHLYLHVDALEPNDSAVYLCASSK
Trichechus manatus latirostris V696 trbv AHIN01087851.1 27766 HTDAGVTQTPRHKVTRTGGNVTLQCAQDMNHECMYWYRQDPGLGLRLIHYSVLIGDTQKGDIPDGYSVSRSNKEHFPLTLGSAAPSQTAVYFCASSV
Trichechus manatus latirostris V697 trbv AHIN01087851.1 15492 SVSAGHTGAGVSQVPRHRVTKKGQAVALSCDPISGHVGLYWYRQNLGQGLELLTYFQNKFPGDTSGMPEARFSADRPDGSSSTLRIQPVEPGDSAVYLCASSL
Trichechus manatus latirostris V720 trgv AHIN01098980.1 946 SLKASILEMKSVSITMQSGESVEIICDLKQDIYYIHWYRYQEGKTLQRILHFYFPSSKVVLDSGFSSEKYYAYKNTQRICKLVLENLQESDSGVYYCAAWD
Trichechus manatus latirostris V786 trav AHIN01118646.1 18388 WMGKILVVLQARGALTLQVGDTLTHPCVVSSLTPIGPVKWIMKGPERGQITVWDFRTTGSNRVTPMADTTQSHNREFSITVSDTTLSDTGTYYCVKYKKG
Trichechus manatus latirostris V827 igkv AHIN01133806.1 15244 SCLPICISRRNGHHQPQVQSECEQLKFSQSVSSSLAWYQQKPGQAFNLFVYSVSTQASEAPIWFSGSGFGTDFTLGINSLRSEDVTDYYCQQHYDFP
Trichechus manatus latirostris V828 igkv AHIN01133813.1 13835 SSGDTVMTQSPASLAVSPGETATINCKSSQSVSSYYLYWYQQKPGQAPKLLIYAASNRASGVPDQFSGSGSGTDFTLTNSSLQAEDATVYYCQHSY
Trichechus manatus latirostris V829 igkv AHIN01133814.1 8301 ASGGIVLTQSPASLAVSPGETATINCKSSQSVSKYLAWYQQKPGQAPKLLIYGASNRASGVPDRFSGSGSGTDFTLTISSLQAEDAAVYYCQQYYSST
Trichechus manatus latirostris V830 igkv AHIN01133823.1 1110 TSGENMMIQSLPSLAASPGETVTINCKSSQSESSCIPWYQQIPGQALKLRVYSTFTKASGVPIWFCDSGSGTYFALTSSSLQSEDVADYYCQQHYGFH
Trichechus manatus latirostris V831 igkv AHIN01133825.1 61825 GASGDIMMTQSPISLAASSGETVIINCKSSNSVRSISAWYQQKQEQAPKWLMSWASNQASGVPDQFRGSRSGTDITLTIDHPQAEDVADYYCQQYHSYP
Trichechus manatus latirostris V832 igkv AHIN01133825.1 52516 ASGDIVLTQSPASLAASPGERVTINCKSSQSVSNYLAWYQQKPGQAPKLLIYYASNRASGVPDRFSGSGSGTDYTLTISNLQAEDVAVYYCQNSYGSYT
Trichechus manatus latirostris V833 igkv AHIN01133829.1 4881 ASGDIVLTQSPASLAASPGERVTINCKSSQSVSNYLAWYQQKPGQAPKLLIYYASNRASGVPDQFSGSGSGTDFTLTISSLQAEDTAVYYCQQYSSYE
Trichechus manatus latirostris V834 igkv AHIN01133837.1 43609 ASGDIVLTQSPASLAASPGETATINCKSSQSVRKYLAWYQQKPGQAPKLLIYSASNRASGVPDRFSGSGSGTDFTLTISNLQAEDVAVYYCQQYYSST
Trichechus manatus latirostris V835 igkv AHIN01133837.1 30774 ASRDIMMTQSSAFLAASPGGMITINCKSSESLFYSPNQKNYLAWYQQKPGQPPKLLMSWTSFHLVIYGLDWLSSSGSGTEFTVTLSSLQAEVMEGYYCEQN
Trichechus manatus latirostris V836 igkv AHIN01133841.1 2641 ASGDVVVTQSPASLAASPGKPATINCKSSESVDSNYISWYQQKAGQAPKLLIYGASDPASGVPDRFSGSGSGTDFTLTISSFQAEDAAVYYCLYGYGYSYG
Trichechus manatus latirostris V849 trav AHIN01142888.1 23471 ISGKNEVEQSPPYLSVQEGELVTINCSYSTGMTTLQWLQKNPGGGIVSLFILSLEMKKKERLSATINTEERHSSLHITASQPRDSATYLCAVE
Trichechus manatus latirostris V850 trav AHIN01142890.1 434 YSTAQTVTQSQRQMSIRETESVTLDCTYDTKDSNYYLFWYKQFPRGGMIFIIRQDGFKQQSATKNRFSVNFRKAAKSFSLRISDSQLEDTAMYFCVYSS
Trichechus manatus latirostris V851 trav AHIN01142891.1 3470 SSAAQMVTQSKQQKSVRETESVTLDCTYDTKDSNYYLFWYKQLPRGKMIFIILQEAFKQQNATENRFSVNFQKAAKSFSLKIADSQLEDAAMYFCALSG
Trichechus manatus latirostris V852 trav AHIN01142893.1 11150 SRRAGWIRPQETEMSVTEGKSVNLLCYYDASTGGAVDLYWYRQYPNQAPEYILYRGWGYTGKGDASFAVERFYSKSAADTTNLYIRNLLLADTATYYCALRD
Trichechus manatus latirostris V853 trav AHIN01142900.1 1596 STGDAKTTQPNSLENTEGEPVNLPCNHSTITGDECIYWYRQTPHQGPEYVIHGINNNVTNEMASLTTPTGRKSSALILPHVTLRDIAVYYCMVR
Trichechus manatus latirostris V854 trav AHIN01142902.1 21000 NQRKTMTSRFKQSPPSLKTQEVEISILNCDYNNNLFDYLVWHKKSPAKGLALLIPIRSGVNRNQVGRLTVFLNKNTKHLSLHIAGSQPGDSATYFCAAS
Trichechus manatus latirostris V855 trav AHIN01142906.1 25387 VNSQVEQNPETLPIQEGENATKSCSYKTSIDSLQWYRQDSGRGFVLLILIRSNEKETSAGRLRATLDINSKRSFLFITTSQAADTAAYFCAID
Trichechus manatus latirostris V856 trav AHIN01142912.1 2956 TPSQQKKVEQSPESLSIPEGTIASLNCTYEDRASQYFMWYRQYSGKGPELLMSIYSKDDKKEGRFTAQLNKGSQYVSLLITDSQPSDSATYLCVV
Trichechus manatus latirostris V857 trav AHIN01142913.1 702 GVRGVKVEQSPSALSLQEGTNSTLRCNYSTTTNNVQWFRQTPGGGLISLFFIASGTKQNGRLKSTINSKELYSTLHIATSQLEDSATYLCAVE
Trichechus manatus latirostris V858 trav AHIN01142919.1 6853 ITGDAKTTQPNSMESTEGKRVNLLCNHSTISGNEYIYWYRQIPHQGPQYVIHGINNNVTNEMASLTIPTGRKTSTLILPHVTLRDTAVYYCMVR
Trichechus manatus latirostris V859 trdv AHIN01142920.1 2536 RSMTEKVNQAQITITMQEGEAVTLGCTYETRWSSHALYWYKQPPSGEMVFLIQQEYSKPNAKQDRYSVNFQKANKSIILTISSLQLADSAKYFCAVWD
Trichechus manatus latirostris V860 trav AHIN01142928.1 17366 VSSKVNVEQSPRSLHIQEGESTNFTCSFPSSSFYALHWYSWEPATGPKVLFVLLSNGDEQEEKRIRATLNTIEGYSYLYIKGSQSEHLATYLCAFDPVLF
Trichechus manatus latirostris V861 trdv AHIN01142929.1 6320 SIVAQKVTQVNSATSAQEGETVTLDCLYETSETVYVILWYKQLPSGKIIFLIHQSSSGENAKKGRYSIKFQKEKKSIGLIISTLQLEDSAKYFCALRE
Trichechus manatus latirostris V862 trav AHIN01142930.1 710 MRGVQVEQSPLVLSLQEGASCTLRCNFSTSVSILQWFRQDPGERLTTLFYIPSGTKQNGRLNVTTGTKERHSSLYISSSQTTDSAIYFCAVSHSAPQ
Trichechus manatus latirostris V863 trdv AHIN01142931.1 6514 STMVQEVTQDQPATSVVEKEAVTLDCVYKTQDTSYALFWYKQPPSGEMVFLIHQESYKEQNTRQGRYSLNFQKEAKSISLTITASQPGDSAVYFCALRD
Trichechus manatus latirostris V864 trav AHIN01142932.1 18297 TRAQRVTQPEDHIFVFEGAPEQIKCNYSYSGSPVLSWFVQYPKKGLHLLLGHISGDSIKGFSADLDKGKMTFHLKKPSAQEEDSAMYYCAVS
Trichechus manatus latirostris V865 trav AHIN01142932.1 4454 VNSQVEQNPEALTILENEHATMNCSCNTSINNLQWYRQDSGRGVVLLILIHSNEKETPNERLKATLDTSTKSSFLFITASQAADTAAYFCAID
Trichechus manatus latirostris V866 trgv AHIN01142938.1 6305 SRRAGWIRPQETEVLGTEGKSVNLLCYYGASTAPIVDLYWYQQYLTRAPKYTLYKRRSYTGKGDASFAIEWFYSKSAANMTNLCTRNLVPADTAKYYCALRN
Trichechus manatus latirostris V867 trav AHIN01142943.1 25321 GNGQQVKQIPQFLLVQEGENFTTYCNSTSTFNNLRWYKQKPGGCPVLLMMLVKTGEVKEQKRLTAQFGKTRKDSFLHITAAQAADVGTYFCAI
Trichechus manatus latirostris V869 trav AHIN01142950.1 2305 GNGQQVKQIPQFLLVQEGENFTTFCNSTSTFSNLQWYKQKPGGCPVLLMMLVKAGEVKEQKRLTSQFGKTRKDSSLHITATQAADVSTYFCAM
Trichechus manatus latirostris V870 trdv AHIN01142952.1 6437 SIVAQKVTQVKSATSTQEGEAVTLDCLYETSATVYYIFWYKQLPSGKIIFLIHQSSSSQNAEEGRYSINFQKEDKFISLIISTLQMEDSAKYFCALWE
Trichechus manatus latirostris V871 trav AHIN01142954.1 12897 VSSKQEVQQSPAALNVQEGNSFILNCSYTDSAVYFIQWYRQDLGKGLTPLLLIQSNQREQMSGRLKVSLDKSARHSALYLAASQTGDSATYLCAV
Trichechus manatus latirostris V872 trav AHIN01142957.1 3274 GTNGDSVTQTEGLVTVSEGASMNLNCNYRTNYTTSPLLFWYVQYLNKAPHLLLKSSTESQGTEDQGFQANLVKSENSFHLQKRSLQISDSALYYCAMR
Trichechus manatus latirostris V873 trav AHIN01142961.1 6439 VNSQVEQNPEALTIQEGENATMNCSYKTSINYLQWYRQDSGRGLVLLILIRSNEKKKPNGRLTATLDTSTTSSFLFITASQATDTASYFCAID
Trichechus manatus latirostris V874 trav AHIN01142963.1 3335 ASGNNQVEQSPGSLIVLEGENCTLQCNYSVSSFNSLRWYKEDTGRGPVSLIIMTYSESKKSNGRYAVTLDATAKFSFLHLTASQLSDSASYICAVG
Trichechus manatus latirostris V875 trav AHIN01142965.1 5071 GNNGDTVTQTEGQVTLSEGAFLTVNCSYETTGYPVLFWYVQYSHEGLQLLLKATKAKETGSNKSFEATYNKETSSFHLKKASVQESDSAVYYCVLG
Trichechus manatus latirostris V876 trav AHIN01142966.1 4894 GWIRPQETEVFGTEEKSVNLLCYYGASAVHFIGLYWYRQYPTRAPEYTLYKGWGYTGKGDAGFAIDRFYSKSAANTTSRYIRNLVPADTATYYCALE
Trichechus manatus latirostris V877 trav AHIN01142971.1 5712 ITGDAKTTQPNSMESTEGKPVNLPCNHSTIGGSEYIYWYRQTPHQGPEYVIHGMNNNVTNEMASLTIPTGRKSSTLILPHVTLRDTAVYYCMVR
Trichechus manatus latirostris V878 trav AHIN01142972.1 29393 IRVEMNVEQSPRVLILQEGRNSSMTCNVSVSITSVQWFQQSPGGHLIPLFYIASGMQQKGRLESTVNTNELYSHLHIRDAQPGDSATYFCIVE
Trichechus manatus latirostris V879 trav AHIN01142972.1 1076 VSGQKEDIVQSPSILNVWEREMAVINCSYKEEALNYFPWYKKEAGKGLNLLIEIRSNVDRNQDGRFTVLLNKKAKHVSLHISATQPGDSALYLCAA
Trichechus manatus latirostris V882 trdv AHIN01143521.1 5178 SIVAQKVTQVNSATSAQEGEAVTLDCLYETSETAYSILWYKQLPSGKIIFLIRQSSSSQNAKEDRYSINFQKEDKSISLIISTLQMEDSAKYFCALWE
Trichechus manatus latirostris V883 trav AHIN01143533.1 4376 STGKDQVEQSPRALILQEGDNVSLNCSYSVSKFGGLQWYKQDPGNGPDLLFLLYSVGDEEQKERLRGTLSKKESSLHITASKPEDSATYLCAV
Trichechus manatus latirostris V884 trav AHIN01143539.1 2382 VNSQVEQNPEALTIQEGENATMNCSYKASINNLQWYRQDSGRGLVQLILIHSNEKEKTNGRLRATLDTSTKSSFLFITASQAADTAAYFCAID
Trichechus manatus latirostris V885 trav AHIN01143541.1 4823 GTRAQRVTQPEDHIFVFEGAPVKIKCNYSYSGSPVLSWYVQYPKKGLQLLLGHISGDSIKGFSADLDKGKMTFHLKKPSAQEEDSAMYYCAVS
Trichechus manatus latirostris V886 trav AHIN01143562.1 489 EIRAQSVTQPDVPVSVSEGDSLELRCIYSYSGTVYLYWYVQYPHKVPQLLLKYFPGDTLVKGIKGFEAEFRKNESSFNLRKHSAHWNDSADYFCAVS
Trichechus manatus latirostris V887 trav AHIN01143566.1 6807 GTNGDSVIQTEGLVTLSEGAAMILNCTYQISYTTTPFLFWYVQYLNKAPQLLLKSSTESQGTDSRGFQANHVKSNSSFHLKKASVQTSDSAVYYCALS
Trichechus manatus latirostris V888 trav AHIN01143568.1 10247 MGRGEKVEQSPPLLSIQDGESSFSNCTYTDSASTYFLWYKQEPGRGPQLLIQILGNADKKQDQRFTVLLNKKEKHFSLHIADPHPGDSATYFCAVR
Trichechus manatus latirostris V889 trav AHIN01143573.1 5914 TVGQDIQQPTELTAMEGNFVQVNCTYQTSGFNGLFWYQQSDGGAPTFLSYNVLDGLEKRGHFSSFLSLSSASSYLLLTELQMNDSARYLCAVR
Trichechus manatus latirostris V903 trdv AHIN01159650.1 1342 SIVAQKVTQVKSATSAQEGAAVTLDCLFETSATVYSIFWYKQLPSGKIIFLIYQSSSGQNANKGRYSIKFQAENKSISLIISTLQLEDSAKYFCALWE
Trichechus manatus latirostris V904 trdv AHIN01164553.1 413 CSMAEKVNQAQITITMQEGEAVTLGCMYETKWSSYGLYWYKQPPSGEMVFLIQQEYSKPNAKQDRYSVNFQKANKSINLTISSLQLADSAKYFCALWD