WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mesocricetus auratus APMT00000000.1 (APMT01) 186 49 16 61 34 19 4 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mesocricetus auratus V68 trav APMT01027526.1 34523 AATEELKVIQPEKSVSVSAGESATLNCTVTSLLTVGHIVWYKHVGQHQQIFYRFTGEQFPRVQNVTDVSMGNNMDFSILISNVTFGDSGNYYCV
Mesocricetus auratus V83 ighv APMT01037653.1 7452 VLSQVQLLQSESELVKPGASVKISCKASGYTFTSYYMHWVKQRPGQGLEWIGRIYPYNGVTKYNQKFQGKATLAADKSSSTAYMDFSSLTSEDSAVYYCAR
Mesocricetus auratus V84 ighv APMT01037673.1 4526 VQSQVQLQQSGPEIGRPGSSVKLSCKASGYTFSRYNMNCVRQWPGQGLEWIGWIGTTSGNTKYAQKFQGKTTLTRDISSSTAYMELSSLTSEDSAIYFCAR
Mesocricetus auratus V85 ighv APMT01037690.1 461 VHSQVQLQQSGPDLGKPGASVKLSCKASGYTFTDYHISWVKQKPGESLEYIGYVCGGNGGTSYNQKFQGKATLTADKSSSTVYMELSSLTSEDSAIYFCA
Mesocricetus auratus V86 ighv APMT01037695.1 1250 IQSQVQLQQSGPELGKPGSSVKLSCKASGYTFTGYNMGWVKQRPGQGLEWIGWIDTSSGNTEYTQKFQGKAMLTSDISASTAFMELSSLTSDDSAIYYCA
Mesocricetus auratus V87 ighv APMT01037704.1 520 VQCEVQLVESGGVLGQPGKSLKLSCAASGFTSSDAAMTWVFQVPEKGLEWFAVIRTKLNNYATYYTDSVKGRFTISRDDSQSIVYLQMNNLRTEDTVMYYCTN
Mesocricetus auratus V88 ighv APMT01037709.1 351 VHSQVQLLQSESELVKPGAPVKLSCRASGYTFTDYNMHWVKQKPGQGLEWIGRIYPYNGDTKYNQKFQGKTTLTADKSSSTAYMDFSSLTSEDSAVYYCAR
Mesocricetus auratus V89 ighv APMT01037710.1 4273 VQSQVQLQQSGPELGKPGFSVKLSCKASGSTFTGYYMHWVKQRPGQGLEWIGWIGTSSGNTKYAQNFQGKATLSRDISSSTAYMELISLTSEDSAIYFCAR
Mesocricetus auratus V90 ighv APMT01037720.1 874 SGGGLVQPGKSLKLSCAASGFIFSDYFMNCMHQAPGKGLEWVAMIEHKPKNYLTSYGESVKGRFTISRDDSKSSVYLQMNNLRVEDTAIYYCT
Mesocricetus auratus V91 ighv APMT01037723.1 2175 VHSQVQLLQSESELVKPGASVKLSCKTSGYTFTSYTMHWVKLKPGQGLEWIGWVYPYNGDTKYNQKFQRKATMTADKSSSTAYMELSSLTSDDSAIYYCA
Mesocricetus auratus V92 ighv APMT01037731.1 6536 VHSQVQLLQSESELVKRGASVKLSCKTSGYTFTTYTMHWVKQKPGQGLEWIGRIYPYNGGTNYNQKFQGKATQTADKSSSTAYMELSSLTSEDSAIYYCAR
Mesocricetus auratus V93 ighv APMT01037746.1 978 VQSQVQLVQSGAELKQPGQSVKISCKASGYTFTSYAMNWMKQAPGQGLKWMGWINTNTGNPTYANDFKERFVFSLDTSINTAYVQISSLKNEDIATYYCAR
Mesocricetus auratus V94 ighv APMT01037752.1 30303 VHSEVQLVESGEGLVKPEGSLKLSCVASGFTFTDHAMFWIRQAPVSQLEWVASIGTKSYNYVTYYTDSVKDRFTISRDDSKSMAYLQMNNLRTEDTTTYYCAD
Mesocricetus auratus V95 ighv APMT01037754.1 6733 VLSQVQLKESGPVLMQPLQNLSLTCTVSGFSLTDYNIHWVRQPPGKGLEWMGIIWGDGNSKYISAFQSRISTSRDTSKSQLFIKIKNMQTEDSAMYYCAR
Mesocricetus auratus V96 ighv APMT01037754.1 30387 VQCKDHLVYSGGGLVQPGTSLRISCVASGFSFTRDWMKWVRQAPRKGLEWVADINGDSSSTRYVPSVRGRFSIFRDNAKNALYLQMNSLKSEDTATYYCAS
Mesocricetus auratus V97 ighv APMT01037759.1 3027 VQCEVKLVESGGGLVQPGKTLKLSCAASGFTFSDYWMNWVRQAPGKGLEWVAQIRNKGNNYATYYAASVSGRFTISRDDSKSSVYLQMNSLRADDTAIYYCTR
Mesocricetus auratus V98 ighv APMT01037763.1 10799 VLSQIQLEESGPGLLKPSQSLSLTCSVSGYSITSGYVWSWIRQSPGKKLEWMGYISSGGSTNYNPTLKSRISITRETSKNQFSLQLNSVTTEDTATYYCAR
Mesocricetus auratus V99 ighv APMT01037773.1 11498 VHCEVHLLESGGGLIQPESSLKLSCAGSGFIFSNAWMNWVRQAPGKGMEWVAQIGNKANNYATYYGDSVNGRFTILRDDSKSSIYLQMNSLRAEDTAIYYCA
Mesocricetus auratus V100 ighv APMT01037800.1 20033 VLSQVQLKESEPGQVQPSKTLSITCTVSGFSLNNHGVHWVRQPQGKGLEWLGVIWNHGVTKYNSALQSRISITRDTSKNQVLLKLNSMQTEDTGIYYCT
Mesocricetus auratus V101 ighv APMT01037802.1 8702 VHSQVKLQQSGAELMKPGASVKLSCKASGYTFTDYGITWVKQKPRQGLEWIGAINTVNGYTAYNQKFQNKTKLTVDKSSSTAYMELSSLTSEDSAVYYCAR
Mesocricetus auratus V102 ighv APMT01037806.1 1865 VHCEAQLVESGGGLVESGKSLKLSCLASGFTFSNYEMNWVRQAPGKGLEWVAYISGSSSYIEYGDAVKGQFTISRDNAKNTLYLQINNLKSEDTPTYYCTR
Mesocricetus auratus V103 ighv APMT01037808.1 9656 VLSQVQLKESGPGLVQPTQTLSLTCTVSGFSLGSYGVDWVRQTPGKGLEWMGIIWGGGSTNYNSALQSRISITKDTSKSQVFLKLNNLKTEDTAMYYCARE
Mesocricetus auratus V104 ighv APMT01037811.1 8016 VQCEVQLVESGGGLVQPGSSLRLSCVASGFTFSNYWMSWFRQTQENKLEWVGEINKDSSITNYSPSLKDRFTISRDNAKNTLYLQMNNLKSDDTAIYYCA
Mesocricetus auratus V105 ighv APMT01037813.1 2665 VHSQVQLQQSGAELLRPGSSVKLSCKASGYTFTDYVMNWVKQKPGEGLEWIGWIYTWNDVTDYNQKYKGKAKLTVDKPTSTVYMELSSLTSEDSAVYYCAR
Mesocricetus auratus V106 ighv APMT01037814.1 20826 VHSQVQLQQSGPELVKPGDSVKLSCKASGYIFTSYVISWVKQKTGQGLELIGWVYPGNDGTSYNQDFQGKATVTADKSSSTAYMELRSLTSEDSAVYYCAR
Mesocricetus auratus V107 ighv APMT01037825.1 6864 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSDAAMTWVRQAPDKGLEWVAYVSTKNNNYGTSYTDSVKDRFTISRDDSQSMAYLQMNNLRTEDMATYYCTS
Mesocricetus auratus V108 ighv APMT01037828.1 1515 VQCEVQLVESGGGLVNPGGSLNLNCAASGFTFNNYWMSWVRQAPGKGLEWVANINKDSSTTNYASSVKGRFTISRDNAKNTLYLQLNSVKSEDTATYYCAR
Mesocricetus auratus V109 ighv APMT01037830.1 4529 VHSQVQLQQSLAELMKPGVSVKLSCKTSGYNFTSYNMDWVKQKPGQGLEWIGSIYPYPGNSGTSYNQKFQCKATLTADKSFSTAYMELSSLTSEDNAVYYCSR
Mesocricetus auratus V110 ighv APMT01037831.1 7136 VHSQAHLQQSAFELKTPGASLKVTCKDFDSNIFPISYMSWVRQKPGHGLEWIGNILPSIGRTNYGQTFEDRVTLTADTMLNTAYMELRSLTSEDSATYYCA
Mesocricetus auratus V111 ighv APMT01037832.1 4212 VHSQVQLQQSNPQLVKPGSSTKLSCKTSGYIFTEYNINWVKQKPGQGLEWIGYFNPNNGNTGYAEKFKGKATLNAEKSSSTAYMELSSLTFEDTAVYYCTR
Mesocricetus auratus V112 ighv APMT01037834.1 1114 IQCEAQLVESGGGLVHPGKSLKLSCEASGFTLSDYWINWFRQAPGKGLEWVGVAKNKLHNYGTEYGDSVKGRFTISRDDSKSSVYLQMNNLRADDTAIYYCIR
Mesocricetus auratus V113 ighv APMT01037835.1 5689 VLSQVQLKESGAGLVQPSQTLSLTCTVSGFSLSSYGVHWVRQPPGKGLEWMGAIWSGGSTDYNSALQSRISITRDTSKSQVFLKLNNLKTEETAMYYCAR
Mesocricetus auratus V114 ighv APMT01037840.1 11636 VYSHVQLQQSGSQLEKPGTSVKLSCKASGYTFTSNYIHWLKQRPGQGLEWMGWMYPSSGSTYYAQKFEGRVSMTRDTSSNTAYMELSSLTSEDSGIYYCARQ
Mesocricetus auratus V115 ighv APMT01037851.1 28027 VQSQLQLQQSGAQLVRPGASVKLSCKVSGITFTDYYFNWVKQKHGQGLEWIGDIDPEDGSTNYNQKFQGKATLTADKSSSTLYMELSSLTSEDSAVYYCA
Mesocricetus auratus V116 ighv APMT01037852.1 2706 VHSQVQLQQSGPELGRPGASMKLSCQASGYTFTDYYSITWVKEKPEQGMEWIGKIFPRDGDTIYNEKFQDKATLTADTSSSTAYMELSSLTSEDSAVYYCARQ
Mesocricetus auratus V117 ighv APMT01037854.1 7197 VQCEVQLVESGGSLVQPGKSLKLSCVASGFTFSDYWMNCVRQAPGKGLEWVADINYDGSTTNYISSVKGRFTISRDNAKNTLYLQMNSVKAEDTATYYCTR
Mesocricetus auratus V118 ighv APMT01037862.1 2547 AHSQVHLQQSGAELVKPGSSVKLSCKTSGYTFTDYEMNWVKQKPGQGLEWIGAIYPENDATAYNQKFQDKVTLTTDKSSSTAYMEFSRLISDDSSVYYCV
Mesocricetus auratus V119 ighv APMT01037862.1 9300 FLSQIQLQESGPGLVQSSQSLSLTCSVSDYSITSGNSYWHWVRQSPEKKLEWMGYITYGGGINYNPSLKSHISTTRETSKNNFFLHLNSVTNEDTATYYCAR
Mesocricetus auratus V120 ighv APMT01037862.1 19885 VLSQVQLKESGPGLVQPTQTLSLTCTVSGFSLSSYGVHWVRQPSGKGLEWMGVIGSGGSTNYNSALKSRVTITRDTSKSQVFLKLNNLQTEDTATYFCA
Mesocricetus auratus V121 ighv APMT01037879.1 18828 VLSQVQLKESGPSLVQPSQTLSLTCTVSGFSLTNYGVDWVRQPPGKGLEWMGAIWSNGNTNYNSALQSRISITRDTSKSQVFLKLNNLQTEDTAIYYCD
Mesocricetus auratus V122 ighv APMT01037883.1 250 VHCEVQLVESGGGLEQPGKSLKLSCAASGFTFSSYEMSWVRQASGKGLKWVAYISFGSGTIKYADAVKGRFSISRDNAKNTLYLQMNSLKSEDTAMYYCAR
Mesocricetus auratus V182 trgv APMT01065082.1 1991 RQTSPNLEERIMSIVRPMGSSVIITCDIYATDSYIHWYLFQKGKAPQYLLYYNRLKSETVVDSGLSSEKYYVYEGTDKTYKFVLRNVEESDSGLYYCACWA
Mesocricetus auratus V183 trgv APMT01065083.1 10745 GSNHTSHLMSYITKKKGNTAFLECQIKSSVLKRNTYVHWYQQKPGQPPKRMLYISKENTVYEEGFSEERHEAKKWQNGLSSILRIHQVTEEDTGIYYCAFWE
Mesocricetus auratus V184 trgv APMT01065084.1 1376 GDSWISQNQLSITRTPNKTVHISCKLSGVPLKNTIVHWYQLKEGEPLKRIFYGSAKNYKQDKPNSRLEADENDGTFNLIINNVITADEATYYCACWD
Mesocricetus auratus V185 trgv APMT01065085.1 21938 GLGQLEQTEISVTRAMDKSAQISCKVSLQDFSKVDIHWYRQKPNQQFEYLIYVRTNYNERPLEGVNKKMEASKDVQTSTSILKVNFLKKKDEGIYYCALWI
Mesocricetus auratus V249 igkv APMT01100000.1 5195 SRCDIQLTQSPSQTVSLKDPVTIRCQASQSIGTALSWYQQKPGKSPKLLIYLANRLEDGVPSRFSGSGSGTDFTLTISTLEPEDIGTYYCQQFSSY
Mesocricetus auratus V250 igkv APMT01100003.1 5197 FRCDIQMTQSPSQTVSLKDPVTIRCQASQSIRTAFNWYQQKTGISPKLLIYAASNLYPGVPSRFSGSGSGTDFTLTSSTLEPEDIGTYYCQQFSSY
Mesocricetus auratus V251 igkv APMT01100009.1 824 ARCDIHMTQSPSSLSASLGESVTITCRASQDISRYLRWFQQKPGNAPTCLIYRASTLMNGVPSRFTGSGFGIDYSLTISSLESKDMAIYYCLQYDDYP
Mesocricetus auratus V252 igkv APMT01100015.1 8222 ARCDIHMTQSPSSLSASLGDRVTITCKASQDIRGYLIWFQQKPGIAPKRLIYSASYLENGVPSRFSGSGSGTDYSLTISSLESEDMAIYYCLQYDEYP
Mesocricetus auratus V253 igkv APMT01100016.1 1162 DAVMTHTPASLPLSLGDQVSISCRYSQSLLASDGNTYLEWDMHKPGQSPQFLIYQVSSRFTGFSYRFSGSGSGTDFTIKISRVEPEHCGVYYCFQA
Mesocricetus auratus V254 igkv APMT01100017.1 12345 ARCDIQMTQSPSLLSASLGDKVTINCLASQNINNELSWYQQKSGQSPTLLIYNGNSLQSGVPSRFSGQYSGRSFTLSLSSVEAEDVANYYCLQDYSA
Mesocricetus auratus V255 igkv APMT01100018.1 8672 ARCDIQVTQTPSLLSASLGDKVTINCLASQSISDDLSWYQQKSGQSPTLLIHDGNSLQSGVPSRFSGQYSGRSFTLSLSSVEAEDVATYYCLQDYSA
Mesocricetus auratus V256 igkv APMT01100023.1 14272 SRSDVVMIQTPHFLPVSLGEQVSISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPGRFSGSGSGTDFTLKISSVEPDDFGVYYCLQ
Mesocricetus auratus V257 igkv APMT01100025.1 19228 AICDIQVTQSPPLLSVSVGDKVTLTCLVSQDIGNGLSWYQQKSGQSPTLLIYYGNFLQSGVPSRFSGQYSGRNFTLSISSLESEDFAMYYCLHDYNTC
Mesocricetus auratus V258 igkv APMT01100029.1 18101 SRGDIVMTQTPTFLPISVGEQVSISCRSSQSLVHSNGNTYLSWLLQKPDQSPQLMIYKVSNRYSGVPDRFSGSGSGTDFTLSISRMEPEDFGVYYCVQRSYYP
Mesocricetus auratus V259 igkv APMT01100030.1 14159 ARCDIQVTQSPSSLSASLGESATITCRASQDISRYLSWLQQKQGKAPKPLIYYVSNLVDGVPSRFSGSVSGTDYSLTISNLESEDTAIYYCVQYVSYP
Mesocricetus auratus V260 igkv APMT01100034.1 12966 SRGDVVMTQTPTFLHASLGEQVSISCRSSQSVVHSDGNTYLNWILQKPGQSPQGLIYKVSNQYSGVPDRFSGSGSGTDFTLKISRMEPEDFGVYYCLQA
Mesocricetus auratus V261 igkv APMT01100036.1 19865 ARCDIQMTQSPSTMSASLGDRVTITCKASQGISNYLSWYQQKPEKAPQLLIYYTDRLADGVPSRFSGSGSGTDYSLTINSLESEDIASYFCLQSYNTP
Mesocricetus auratus V262 igkv APMT01100036.1 45558 AICDIQVTQSPSHLSASLGDKVTITCLASQDISNDMSWYQQKSGQPPTLLIYYGKSLQSGVPSRFSGQYSGRRFDLSISSLESEDSATYYCLQDYST
Mesocricetus auratus V263 igkv APMT01100044.1 3192 ARCDIQMTQSPSSLSASLGDRVTITCSASQDIRKYLMWLQQKPGKPPKPLIYYASNLYAGVSSRFSGSGSGTDYSLSISNLEAEDPAIYHCVQYDKYP
Mesocricetus auratus V264 igkv APMT01100047.1 1224 ARCDIQVTQSPASLSASLGDKVSINCLASQGISNELNWYQQKSGNAPKFLIYNGNSLQSGVPSRFSGQYSGTSFTLSISSMEPEDVGTYFCLQHFSAP
Mesocricetus auratus V265 igkv APMT01100049.1 11596 SIGDIVMTQTALSNPVPLGESASISCRSSKSLLYKDGKTYLHWFLQRPGQSPQLLIYLVFNRVSGVPDRFSGSGSGTNFTLKISRVNNEDVGVYYCLHNVEYP
Mesocricetus auratus V266 igkv APMT01100049.1 20365 ARCDIQMTLSPSSLSASLGDRVSITCKVSQGINNYLNWFQQKPGKAPELLIYGANSLEDGVPSRFSGSGSGTDYPLTISNLESEDIVFYFCLQVYDTP
Mesocricetus auratus V267 igkv APMT01100049.1 32528 AICDILMTQSQTSLSASLRDSITITCQASQGISNYVNWFQQKPGKVPKLLIYAATYLADGVPSRFSGSGSGTDFTLTISSLEPEDIATYYCLQHYENP
Mesocricetus auratus V268 igkv APMT01100049.1 40123 SKCDIQMTQSPYQTASLGDTVTIKCQASQSIGNELNWYQQKPGKSPKLLIYGASSLFPGVPSKFSGSGSGRDFTLTISSVESEDIAAYYCKQDLSY
Mesocricetus auratus V269 igkv APMT01100050.1 5933 ASSDVVMTQTPLSLSVAIGQSASISCQSSQSLVHSDGKTYLNWFLQRPGHSPQRLIYQVSKLNSGVPNRFSGSGSATDFTLKISRVEAEDLGVYYCMQGTYYP
Mesocricetus auratus V270 igkv APMT01100053.1 7971 VRCDIQMTQSPGLLSASVGESVTINCQSSQNIYSNLAWYQQKPGESPKLLIYAATSLADGTPSRFSGSGSGTQFSLKITNLQPEDMANYYCQQHNTYP
Mesocricetus auratus V272 igkv APMT01100077.1 22297 ARCDIQMTQSPGSLSVSLGESVSITCRASQNIYSSLAWYQQKPGNPPNLLIYGATSLKDGVPSRFSGSGSGTQYSLKISGMHSEDVATYFCLQGRNFP
Mesocricetus auratus V273 igkv APMT01100077.1 28952 ARCDIQMTQSPGLLSASVGETVTITCQSSQNINSYLAWHQQKPGEPPKLLIYYANRLEDGVPSRFSGSGSGTQYSLKISGMQTEDVGTYYCQQGNNYP
Mesocricetus auratus V274 igkv APMT01100079.1 19764 SRGEIVLTQSPAFKAAFHGEKVTITCSASTSVSTNYLHWYQQKPGGSPKLLIYETFNLASGVPTRFRGGGSRTSYSLTISSMQAEDAATYFCQHWSSNAC
Mesocricetus auratus V275 igkv APMT01100079.1 55900 SRGEVVLTQSPASRAASHGEKVTISCSASSSVSTSYFNWYQQKPGSSPKLLIYQTSNLASGVPTHFSGSGSGTSYSLTISSVQAEDAATYFCQQTYNYP
Mesocricetus auratus V276 igkv APMT01100092.1 6434 TWGEIVLTQSPASKAASHGETVTISCSASSSVSTSYLHWYQQKPGDSPKLLIYRTSNLASGVPNRFSGSGSGTSYYLAISSVQAEDAATYFCQQSDTYPC
Mesocricetus auratus V277 igkv APMT01100102.1 6420 ARCDIQVTQSPTSLSASLGDRVTITCRTSQDISKYMAWYQQKPGEALKLLIYYASTLQSGVPSRFSGSGSGTDYSFSITNLEPEDIATYYCQQGANL
Mesocricetus auratus V278 igkv APMT01100107.1 13223 ARCDIQMTQSPASLSVSLGETVTITCLASEDISWSLAWYQQKPEKPPKLLIYGTDSLVDGIPSRFSGSGSGTQFSFKITSLQPEDVAAYYCQQAYSTP
Mesocricetus auratus V279 igkv APMT01100125.1 1462 DIVLTQSPATLSVTPGNSITISCRTSQGISTNLHWYQQKSSEAPRLLIKYASQSITGIPSRFSGSGSGTDFTLSINNVESEDFATYYCQQSNSLP
Mesocricetus auratus V280 igkv APMT01100255.1 173 SKGQITLTQPAESLHGSPGERVSITCRASQSLLYTDGKHYLSWYQQRQGQTIKTFIYHASVRIDGVPTRFISSGSGTEFTLTIEDLKPEDFAVYYCLQ
Mesocricetus auratus V281 igkv APMT01100256.1 2032 STGDIVLTQSPALLPVSMGQKATISCKSSESVNKYNIDFMHWYQQKPGQPPKLLIYAASNLESGVPARFSGSGSGTDFTLTIHPVEADDVATYYCQQSKEFP
Mesocricetus auratus V282 igkv APMT01100257.1 8887 STGDIVLTQSPATLTMSLGQSATISCKASLRVSIVPIKPINWYQQKPGQPPKLLIYGASNLDSGVPGRFSGSGSGTDFTLTIHAAEADDAATYYCQQSKELP
Mesocricetus auratus V285 ighv APMT01100782.1 49512 ATGVHSQVQLQQSVPQLAKSGSSVKLSCKASGYILTDYVMDWEKTKPGLAWSELEVFILIMCDTAYNQKFQGKATLTADKSSSTACMLLRSLMSEDSAVYYCE
Mesocricetus auratus V308 iglv APMT01115484.1 2669 SISQAAIIQESSLSTSPGETVTLTCGLSTGTVTTSNHANWVQEKSHQVPTGLICSTSNRLSGVPPRFSGSLLGDKAALTITGAQPEDEAVYYCSMWYIDQ
Mesocricetus auratus V309 iglv APMT01115486.1 6144 AISQVFVIQESSLTTSPGGTVTFTCGSRTGAVTTSNYANWVQEKYHQVHTDLIAATSRRASGIPARFSGSVLGDKAALTITGAQPEDEAVYYCSLWNGDH
Mesocricetus auratus V310 iglv APMT01115487.1 13405 AISQTLVIQEASLSTSPGGTVTFTCASRTGAVTTSNYANWVQEKSHQVPNGLIGGTTYRAPDVPARFSGSLIGDKAALTITGAQPEDEAMYYCSLWYSDQ
Mesocricetus auratus V311 iglv APMT01115490.1 3062 TIAQTVVIQESSLTTTPGETVTLTCGSSTGTVTSSNYANWVQEKSHQVPTSLIGSTNIRAPGVPARFSGSLLRDKAALTITGVQPEDEAVYYCALFYSDH
Mesocricetus auratus V312 iglv APMT01115499.1 12937 AISQAVVTQEPSLTTTPGGTVTFTCGSRTGPVTTSNYAKWVQEKSYQVHTGLIGDTSIRVPGVPARFSGSLLGDKAALTITGAKPEDEAVYYCALWYSDH
Mesocricetus auratus V313 iglv APMT01115506.1 8655 SWAEVVFTQPQSVSGSLGKQITISCTRSSGNIGSNYVYWYQQHSSNKPRLLIYKHDQRPSSIPDRFSGSKDSSSNSGILTISGLQPEDEADYYCLSGYNNY
Mesocricetus auratus V314 iglv APMT01115508.1 6240 SCAQFVLTQPKSVSESLGRTVTISCKRSSGNIANYYVSWYQQHFGSSPKTVIYQNNKRPSGIPDQFSGSIDSSSNSASLTITDLHIEDEADYFCLSYDDNY
Mesocricetus auratus V315 iglv APMT01115512.1 14028 SYAEFVLTQPKSVSESLGRSVIISCKRSSGNIASYYVHWYQQHFGSSPKTVIYEDNKRPSGIPDRFTGSIDSSSNSASLTITDLQIEDEADYFCHSYDNSY
Mesocricetus auratus V316 iglv APMT01115519.1 4162 SCAQYVLTQPKSVSESLGRTVTISCKRSSGNIADNYVHWYQQQFGSPPTMVIYEDNERPSGVSDRFSGSIDSSSNSASLTITDLQIEDEADYFCQSSGSGF
Mesocricetus auratus V317 iglv APMT01115526.1 16458 SFSQLALTQSPSASASLGSSEKLTCTLSSQHSTYTIGWYQQHPGKAPKYMMYLKSDGGHSKGDGIPDRFSGSSSGAHRYLSISSVQPEDEADYYCGTSDSSG
Mesocricetus auratus V318 iglv APMT01115526.1 27579 SFSQPVLTQSPSASASLGATSKLTCTLSSQHSTYPIGWYQQHPDKAPKYVMYINRDGSHGRGNGIPGRFSGSSSGADRYLSISNIQPEDEADYYCGVYD
Mesocricetus auratus V319 iglv APMT01115527.1 16393 SFSQPVLTQSPSASAYLGASIKITCTLSSEHSAYTIRWYQQHPDKAPKYVMYLNSDGSHGKGDGIPDRFSGSSSGTHRYLSISNIQPEDEADYYCGAGD
Mesocricetus auratus V320 iglv APMT01115528.1 26236 SFSQPVLTQSPSASASLRGSVKLTCTLSSEHSTYNIGWHQQHPDKAPKYVMYLRSAGSSSKGDGIPDRFSGSSSGANRYLSISNVQSEDEAVYYCGAYY
Mesocricetus auratus V321 iglv APMT01115530.1 9908 SVASYILTQPPSVSVALGQKATITCSGENLSDKYVHWYQQKPSQAPVMVIYEDNNRPSGIPDKFSGSNSENRATLTISKTEAGDEADYYCQIWD
Mesocricetus auratus V322 iglv APMT01115533.1 33606 SFSQPVLTQSPSASASLGASVKLTCTLSSEHSTYDIEWYQQHPDKAPKYVMYLNSDGSHGKGDGIPDRFSGSSSGAHRYLSISNIQSEDEAIYYCGVSD
Mesocricetus auratus V323 iglv APMT01115541.1 13516 SVASYELTQPPSASVTVGETVKITCTGDQLPKNYAHWFQQKPDQTILPLIYKDSERPSGIPDRFSGSSSGTTATLTISGALAENEGDYYCLSSYGEGSN
Mesocricetus auratus V399 trbv APMT01165298.1 14489 VGAQIIHQWPASRVQPVGSPLLLECTIKGQSNPNLYWYWQATGGPLQQLFYSISKGEVDSVLSRNLSASRPQDGKFTLSSEKALLSHTGFYFCAWS
Mesocricetus auratus V437 trav APMT01182426.1 1374 KINGDSVTQTEGLVTVTEGSSVMLNCTYQTAYSVSTVLWYVQYISKAPQLLLRSSTDNKRTEQQGFHATLHKSSSSFHLQKSSVQLSDSALYYCAVS
Mesocricetus auratus V438 trav APMT01182429.1 7476 VSSQQRVQQNSESFSVQEGAMASLNCTFSDRNTDYFWWYRQHPGKSPKALMTIISNGEKEEGRFTIHLNKASLHVSLNIRDSQPSDSAVYLCAV
Mesocricetus auratus V439 trav APMT01182431.1 6834 VSSQQKVQQTRESLSFPEGATASLNCTFSDSASQYFSWYRQHPGKNPKALMSILSNGKKEEGRFTVHLNKTSLHISLHIRDSQPSGSAVYLCAV
Mesocricetus auratus V440 trav APMT01182431.1 11820 VNSLQGEENPWALSIQEGENVTVNCSYKTSIRNLQWYRQDLGRGPAMLILMHSNEKEKQSGRLRVTLNTSTQSSSLSITAARPEDTAVYFCATD
Mesocricetus auratus V441 trav APMT01182431.1 31189 DVQAQSVSQADAHVTIFEGDSVELRCNYSYGGASYLFWYMQPHGHSLQFLLKYISGDPVVHGVNGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALS
Mesocricetus auratus V442 trav APMT01182431.1 38563 ESIGEQVEQQPSTLSVQEGDSAIINCTYTDIAFLYFPWYKQEVGKSLHLIIDILENVDRKQNKKLTILLDKKAKQLSLHIRATQPGDSAMYFCAA
Mesocricetus auratus V443 trav APMT01182432.1 5924 AAGKTQVEQSPQALAVLQGENCILQCNYNVSPANNLRWYRQDTGRSLVSLAVMTRKENRKSNGRYSATLNTDTQHSTLHIKATQLEDTATYICVVG
Mesocricetus auratus V444 trav APMT01182453.1 2065 VKGQQVEQSPVSLVLQEGESAELQCNFSTTATQMQWLHQIPGGHLISLLSNPSGTKQSGRLKSTTVIQERRSSLYISSSQTTDSGTYFCAMNAQC
Mesocricetus auratus V445 trav APMT01182468.1 5990 VSRGEHLVQHPSLLSVQEGGSALINCTYTDTTNYYFYWYKQEPGAGLQLLINVLSNVDRKEEQGLIVLLNKKDKHLSLNITAAHPGDSATYFCAAS
Mesocricetus auratus V446 trav APMT01182468.1 7277 KSNGEPITQTEGPVTLTVGAPLILNCNYQTSYSEPLLLWYVQSLNKAPQLLLRSATDNKRTEQQGFHATLHKSSGSFHLQKSSVQLSDSALYYCALS
Mesocricetus auratus V447 trav APMT01182470.1 5023 GSRAQSVVQSDAHLTVSEGSSLELKCSYSYGATPYLFWYIQYPGQSLQLLLRYFGGDTLVKGIKGFEAEFMKSNSSFNLRKNPAHWSDSAKYFCALS
Mesocricetus auratus V448 trav APMT01182470.1 34368 LGTQQLEQNPQFLSVPQGQDLTVYCNSSSTLPQFYWYRQMPREGPVFLMTLVKSREVKEQNRMTAKFGEARKDSSLSIVKAQPGDAGIYFCAG
Mesocricetus auratus V449 trav APMT01182472.1 3947 KNGGQQVKQNSPSLTVQEGGISILNCDYNNNVFDYFAWYKKYPSKSPTFLISLCLNMNKNEDRRFTIFLNKTGQHFSLHTAASQPGDSAVYFCAAG
Mesocricetus auratus V450 trav APMT01182475.1 2417 VSGQANTVIQTPSILDIWEKETAVINCTYTNAAFNYFPWYKRDRRKGLTVLADIRSNVNRRTEGRFTVILDKNAKLVSLHITAAQAEDSASYLCAP
Mesocricetus auratus V453 trav APMT01182475.1 32586 VNGQVLSQSVQYISIPEGKNASMSCNSSSTLNNVLWYKQDPEGGLVLLVAIYKSGELVRNGKVTAEFGGTRKDSVLTISASEPADSSTYFCAG
Mesocricetus auratus V455 trav APMT01182477.1 30327 ASVAQTVTQPQQEKSVQEAESATLECTYDISDTNYNLFWYRQQRGQMTLVIRQEAYKQQNATENCFSVNFQKAAKSFSLEISDSQLEDAAMYFCALMER
Mesocricetus auratus V456 trav APMT01182477.1 42277 ASMAQTVTQLQQEKSVQEAESATLECTYDTSDTNYNLFWYRQQRGQMTLVIRQEAYKQQNATENHFSVNFQKAAKSFSLEISDSQLEDAAMYFCALMER
Mesocricetus auratus V457 trdv APMT01182485.1 27576 VSLDVILEQVDQITVSDGNSAKFYCTVTGGDLKNYQMSWYKKSEDNALILVYNLNNSSPDDPMGNFKGEIDASKSQFILGIEKATMKDIGTYYCGSD
Mesocricetus auratus V473 trav APMT01196684.1 270 VSQVERVEQHPSTLRVQEGVSAVINCTYTDSALSYFPWYKQEPGKHPQFIIDIRSNVERKQSQRLTLLLDKKDKHLSLLIREPGDSAIYFCAAD
Mesocricetus auratus V474 trav APMT01196700.1 7081 SFRGDCRAQSVTQPEARITVTEESSLQLRCNYSSSVTHNLFWYVQYPWQGLQLLLKYYSGDPVVLGLRGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALS
Mesocricetus auratus V475 trav APMT01196720.1 1542 VSSQQKVQQTPEFLIVPEGAVASLNCTFSDSASLNFLWYRQHPGKGLELLVSIYSNGEKEEGRFTVHTNTASLHVSLHIRNSQTSDSAVYLCAV
Mesocricetus auratus V476 trav APMT01196720.1 5871 VNSLQGEENPWVLSIQEGENVTVNCSYKTSIRNLQWYRQDSGRGPAMLILIRSNEKEKQSGRLRVTLSTSTQSSSLSITAARPEDTAAYFCATD
Mesocricetus auratus V478 trav APMT01196737.1 9686 KTHVDSVTQKQGHMTLSEDAFLFINCTYSSSWYLTLFWYVQYHGEGPELLLKVTTANNKGSSRGFKATYDQGSISFHLQKASVQESDSAVYYCALS
Mesocricetus auratus V479 trav APMT01196740.1 756 VSSKQKVQQTPESLSVQEGAIVSLNCTPTDQNFQYFWWYRQHPWNRPKALMSIISNGKKEEGRFTVYFNKASLHVSLHIRDSQPSDSAVYLCAV
Mesocricetus auratus V480 trav APMT01197985.1 891 VSQGERVEQHPSTLRVQEGASAVINCTYTDSASSYFPWYKQEPGKHPQFIIDIHSNVERKQSQRFTLILDKKDKHLSLLIREPGDSAIYFCAED
Mesocricetus auratus V487 trdv APMT01201338.1 2832 ASMAQKVTQAQTAIYVKEKKTVTLDCVYETRESTYYLFWYKQMTSGEMVFLINQESYKKENATKGRYSLNFQNSESSIRLIITATQMEDSAVYFCAMRE
Mesocricetus auratus V488 trav APMT01201352.1 7714 KINGDSVTQTSGLVTVKEGLPVIMNCTYQTTFPNIFLYWYVQHLNKAPQLLLKSTTDNKRTEQQGFHATLHKSSSSFHLQKSSVQLSDSALYYCALS
Mesocricetus auratus V489 trav APMT01201358.1 7997 VNSLQGEENPWTLSMQEGENVTVNCSYKTSIITLRWYRQDSGRDPAMLILIRSNEKEKQSGRLRVTLNTSTKSSSLSINAAWPEDTASYFCATD
Mesocricetus auratus V491 trav APMT01202945.1 165 VKGQQVEQSPESLVLQEGASAEMQCNFSTVFNSMQWFYQSPGGHLISVFYNPSGKKQSGRLTSTTVTKDRHSSLQISSSQITDSGTYFCAMNAQCS
Mesocricetus auratus V493 ighv APMT01204274.1 695 VHSQVQLLQSESELVKPGASVKLSCKASGYMFTDYTMHWVVQKPGQGLEWIGWIYPNYDNTKYNQKFQGKATLTADKSSSTAFMELSSLTSEDSAVYYCAR
Mesocricetus auratus V496 ighv APMT01209935.1 7380 FHCDVQLMESGGSLVQPGKTLKLSCEASGFTFSDYSMHWVRQAPGKGLEWVSLINYDSSYIEYANTVKGRFTISRDNAKKTMYLQMNSLKSEDTAMYYCAR
Mesocricetus auratus V506 igkv APMT01216533.1 454 TRCDIQLTQLPSSLYASPGDKVTITCKASQNINQYLHWYQQKPAEAPKLLIYRASNLQTGIPSRFSGSGSGTDYSLTISSLDPEDVAVYYCQQGYIP
Mesocricetus auratus V511 ighv APMT01229800.1 555 VHSQVQLQQSGAELVKPGASVKISCKTSGYTFTDGYMHWVKQKPGQGLEGIGRIDPDSGNTKYEEKFQGKATLTRDKSSRTLYMELSSLTSDDSAVYYCA
Mesocricetus auratus V707 igkv APMT01100077.1 12552 AKCDIQMTQSPSTLSASLGESVTITCHASQNINSWLAWHQQKPGDAPKLLIYKTSKLHKDILPKFSGSGSGTDYSLTISNLQAEDVATYYCQQDLSVP
Mesocricetus auratus V708 igkv APMT01100093.1 53018 ARCDIQMTQSPASLSASLGDSVTITCQSSQDIFSYLAWFQQKPGKAPKRLIYSASSLVDGVPSRFGGSGSGTRYSLKISSIQPEDMANYYCLQYSNAP
Mesocricetus auratus V709 igkv APMT01100093.1 28960 ARCDTQMTQSPASLSISLGDSVTITCQSSEDIYTKLAWYQQETGKPPKLLIYDANRLEDGVPSRFSGSGSGTQYSLKISSLQPEDVSTYFCQQYDNYP
Mesocricetus auratus V710 igkv APMT01100093.1 23252 SRCDIQMIQSPASLSASLGDIVTITCQASQNIGAWLAWYQQKPGKAPKLLIYSASSLANGIPSRFSGRGSGTQFSLKINSLQSEDFATYYCQQG
Mesocricetus auratus V711 igkv APMT01100094.1 3768 SNGDIILTQSPESLAISQGEKVTITCSASSSISSNYLHWYQQKPGASPNLMVYSSSYRASGVPSRFSGSGSGTSYSFEISSIEPEDAATYYCIQGSGR
Mesocricetus auratus V712 igkv APMT01100102.1 37066 ARCDIQMTQSPSSLSVSLGESVTITCLANENINGHIAWYQQKPEKLKLLIYGISILADGVPPRFSGSGSGTHYSLKITNLQPEDVTTYYCQQVWST
Mesocricetus auratus V713 igkv APMT01100108.1 6263 SKGEIVLTQSPTYMTASNGEKVTITCRASSSISSNYLHWYQQKPGAPPKLLIYSTSYLAAGVHGSFIGSGSETSYYLTISCMQAENAATYYCQQGSSS
Mesocricetus auratus V714 igkv APMT01100112.1 6933 AKCDIQLTQSTELLSASLEDTVTITCQSSQNIYNALAWYQQKPEEPPKLLIYNSKSLADGIPSRFSGSGSGTQYSLKISSLQPEDVATYFCQQAFST
Mesocricetus auratus V715 igkv APMT01100120.1 1181 SRGDIVLTQSPATLSVTPGSSATITCKASQDISTSLHWYQQKSSEAPRLFIKYASQSITGIPSRFSGSGSGTDFTLSINNVESEDFAIYYCQQSYSYP
Mesocricetus auratus V717 igkv APMT01100129.1 5360 SRGDIVLTQTPATLSVVPGERVTMTCKTSQNIGTILHWYHQKPKEAPRALIKYASQSIPGIPSRFSGSGSGTDFTLSINNLEPDDTGIYYCQQSSSWP
Mesocricetus auratus V719 igkv APMT01100134.1 8794 SRGDIVLNQSPSILSMTPGERVTITCKASQGISSYLHWYQQKSNEAPRLLIKYASQTITGIPSRFSGSGSGTDFTLSINNPEPEDIGIYYCQQGNSWP
Mesocricetus auratus V720 igkv APMT01100134.1 2553 SRGDIVLTQSPATLSVTPGEKVSLSCTSSQGISDYLHWYQQKPNEAPRLLVKYASQPVSGIPSRFSGRGSGTDFTLNINSLESEDVAMYFCLQTDSLP
Mesocricetus auratus V721 igkv APMT01100136.1 5623 TSGDVVLTQTPLSLPVMIGKSVSISCRSSQSLLDSDGKTYLFWLLQRPGQSPQGLIYQVFKLKEGVSDRFSVSGSGTDFTLKISRVEAEDLGVYYCVQATHDP
Mesocricetus auratus V722 igkv APMT01100137.1 51477 ACGEIVMTQSPSFLAVSGGEKVTINCRSSQSLLYSKNQKNYLVWFQQKPGQSPKLLIYWASTRHTGVPDRFIGSGSGTDFTLTISSVQAEDMADYYCMQNYDTP
Mesocricetus auratus V723 igkv APMT01100141.1 14445 ACSDTVMTQSPSFLSESVGAKVTISCKSSQNLLYSKNQKNYLAWYQQKPRQAPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNIQAEDMGDYYCFQHYYIP
Mesocricetus auratus V724 igkv APMT01100142.1 18407 ACGDIVMTQSPSSLAVSAGDKVTISCRSSQSVYYSGNNKNLLAWYQQKPGQSPKLLIYFASTRFTGVPDRFIGSGDRTDFTLTISNAQDDDLAHYYCQQGISF
Mesocricetus auratus V725 igkv APMT01100146.1 32511 ACGDIVLTQSPSSLAASVGEKITISCRSSQSLFYDANNKHLLAWYQQKPGQSPKLLIYYASTQFTGVPDRFIGSGSGTDFTLTINSVQADDLADYYCQQDFIPI
Mesocricetus auratus V726 igkv APMT01100146.1 3264 TCADIVMTQSPSSLAVSAGEKVTISCSSSQNLLYSEDQKNYLNWYQQKPGQSPKLLIYWGSTRPTGVPHRFIGSGSGTDFTFTISSVQDEDQADYYCMQSYSYP
Mesocricetus auratus V727 igkv APMT01100147.1 23633 ACADVRMTQSPTSLAMSAGDKVTISCKSSESLSFSSYNLLAWYQQKPGQPPKLLIYYASTRHTGVPDRFIGSGSGTDFTLTISSVQAEDMGDYYCMQFYVNP
Mesocricetus auratus V728 igkv APMT01100150.1 14119 ACADILMAQSPSSLAVSAGEKVTISCQSSQSLLSGSTNYLSWYQQKPGQAPKLLIYYASNRGTGVPDRFTGFGSGTDFTLTISSVQDDDMGDYFCQQGRSYP
Mesocricetus auratus V729 igkv APMT01100157.1 923 VCADIMMTQSPSFLAVSAGETISLSCKSSQSLLSGSINRLNWFQQKPGQAPKLLIYHASTRHTGVPDRFTGSGSGTDFTLTISSFQDEDVGDYFCQQHYIVP
Mesocricetus auratus V730 igkv APMT01100161.1 5884 ACGDIMMTQSPTSLAVSSGEKVTIICKSSQSLSLGSNNYLAWYQQKPGQSPKLLIYLASTRHTGVPARFTGSGSGTDFTLTISSVQAEDMGDYYCLQDHSIP
Mesocricetus auratus V731 igkv APMT01100181.1 7102 ACADIVMTQSPSSLAVSVGEKVPISCKSSQSLLSGSTNYLAWYQQKPGQSPKLLIYHASTRHTGIPDRFIGSGSGTDFTLTISSVQAEDMADYFCQNYYSTP
Mesocricetus auratus V732 igkv APMT01100193.1 5434 ARADIVMTQSPSTLALSPGEKVTISCKSSQSLLYSANQKNYLAWYQQKAGQSPKLLIYWASTQHTGIPDRFIGSGSGTDFTLTISSVQAEDMGDYFCQHHYGTP
Mesocricetus auratus V733 igkv APMT01100208.1 1843 ACADIMMTQSPTSLAVSSGGKVTITCKSSQSLLHSANQKNYLAWYQQKPGQSPKLLIYLASTRHTGVPDRFTGSGSGTDFTLTISSVQAEDMGDYYCLQGLSSP
Mesocricetus auratus V734 igkv APMT01100223.1 5208 ACADIVMTQSPSSLAVSVGEKVTISCKSSQSLLYGSSNYLAWYQQKVGQSPKLLIYWASTRHTGIPDRFIGSGSGTDFTLSISSVQAEDMADYFCQHYYSTP
Mesocricetus auratus V840 trbv APMT01165306.1 11124 SVEAQVTQTPRHIITEPGKKLIITCSQNMNHDSMYWYRQDLGLGLKLIYYSVNIDITDKGEVSDGYSVSRKEKKAFPLTLESTRINQTSLYLCASS
Mesocricetus auratus V841 trbv APMT01165306.1 3118 SVFSVLLYQKPKRDICQSGTSLKIQCVVDTQVAGMFWYRQFQGQSLVLMAAANQGSDATYERGFTKEKFPISRPNLTFSTLTVNNAGPEDSSFYFCSSG
Mesocricetus auratus V843 trbv APMT01165308.1 14494 SMDTEVIQNPRYLVKGKEQKAKMDCTGIKGHSYIYWYHKKLGEELRFLVYFQNADIIDKTDKIGKNISAKCPRGLPCTLEIQSSELADSAVYFCASSQ
Mesocricetus auratus V844 trbv APMT01165308.1 4740 SSDGQVIQTPQHLFKGKGQKAKMNCTPENGHTFVYWYQQKQSKELQFLISFQRQEVRENTDLVKERFLADCPLNSPCSLEIQSSEAGDSALYLCASSL
Mesocricetus auratus V845 trbv APMT01165308.1 828 SFDAKVTQNPRYLVKEKGQRANMSCNPEKGHTAYYWYQQNQNGELKLLINFRNADIIEQTDVVKKRFSAECPSNSPCRLDIQSSEAGDSALYLCASSQ
Mesocricetus auratus V846 trbv APMT01165309.1 3944 TTRGGVTQTPKFLIGRQGQRLTFECKQDFNHDTMYWYRQDPGKGLSLIYYSITEKDIQKGDLSEGYEVSREKKLFFPLTLTSAQKNHMAVYLCASSI
Mesocricetus auratus V847 trbv APMT01165310.1 28703 PMEAAVTQNPRNKVAVTGGEVTLNCHQTDNHDYMYWYRQDPGHGLRLIHYSYIAGNTENGDIPDGYKATRPRTEAFSLVVETASPSQTAVYFCASSY
Mesocricetus auratus V848 trbv APMT01165310.1 19381 LSEVGVTQSPRHAIIQERQEVSFWCDPVSGHATLYWYQQLRDQGPQLLVYFQNEAVMDDSKLPKDRFSAARTRGVNSTLKIQSAEQSDSATYLCASSL
Mesocricetus auratus V849 trbv APMT01165310.1 8693 PTVAGVTQTPRSKVTEKGQEATLRCEPISGHDSVFWYKQTTMQGMEFLIFFRNQAPIDDKGMPKERFSAQMPNSKLSTLMIQAAQPQDSAVYLCASSL
Mesocricetus auratus V850 trbv APMT01165310.1 3882 CVDGMVIQNPRFKVARVGKPVNLSCSQNLNHNAMYWYHQKPSQGLKFLLYYYDTTLNRETDTSDNFQSSRPNNSFCSLDIRSAGLGDSAMYLCASSR
Mesocricetus auratus V851 trbv APMT01165311.1 6560 PMEAAVTQSPRSKVTATGGKVELSCHQTFNHNNMYWYRQDPGHGLRLIHYSYGADNTQRGDVPDGYKATRPTKERFSLALETASPSQTAVYFCASSD
Mesocricetus auratus V852 trbv APMT01165320.1 5317 HTKAGVSQSPTHRLTKNGQNVSFWCNPISGHNLLYWYRQRSGQGPEFLAYFQNEVALDKSGLPSGHFSAERPEGSYSFLKIEPAKQEDSAVYLCASSL
Mesocricetus auratus V853 trbv APMT01165323.1 6484 PASAGIIQTPRSMLLKTGQQVTMKCTQDMKHDCMFWYRQDPGLGLRLIYYSYDVGITDKGDVSEGYSVSRSNTEDFSLTLESVTHSQTSVYLCASSY
Mesocricetus auratus V854 trbv APMT01165323.1 1015 LTDAGITQTPRYWITQTGRKMVLGCSQNMDHYGMFWYRQDAGQGVLRLIHYSGSVGSTTEGDVPEGYSVSRNKIDHFPLTLDSARPSQTSMYFCASS
Mesocricetus auratus V855 trbv APMT01165325.1 22512 PVDPRIDQTPKHLVTLTGNERTLTCAQHLNHNAMYWYRQSAKKSLELMFSYNYRALVENQTVPHRFQPHNPEKSQLDLRISALEPDDSATYFCASSQ
Mesocricetus auratus V856 trbv APMT01165325.1 20851 HAGPEVIQFPSHQVTHVGQSVTLSCDPVSSHLYFFWYKQTLGQQMEFLVSFYNGNTMDKSELFKEDRFSVERQDDSYFTLKIQPTTLKDSALYLCASSL
Mesocricetus auratus V857 trbv APMT01165325.1 9121 VLETAVFQTPQFLVTQVGNKASLKCEQDLGHDTMYWYKQDSKQLLKVLFSYNNKQLIVNESVPSRFSPQSSDKAHLSLHVKSVEPDDSAVYFCASS
Mesocricetus auratus V858 trbv APMT01165325.1 5504 LVNTKTIQTPRYLVMGRTDKKSLKCEQHLGNNAMYWYKQNAEKPPELMFLYNLKELIRNETVPSRFFPECPETSQLLLHLSALGPEDSAVYFCASSK
Mesocricetus auratus V874 ighv APMT01174611.1 424 VQCEVQLVETGGGLVQPGKTLKLSCAASGFTFSDAAMHWVRQAPGKGLEWIARIRTKPNNYATYYADSVKGRFTISRDDSQSMVYLQMNNLRTEDTATYYCNK
Mesocricetus auratus V875 ighv APMT01174614.1 4568 VHTQVQLLQSESELVKPGASVKLSCKTSGYTFTDYYMHWVKQKPGQGLEWIGLINPNNDGTNYNQKFQGKATLTADKSSSTAYMELNSLTSDDSAIYYCAR
Mesocricetus auratus V876 ighv APMT01174617.1 4032 GGVQPGGSLRLSCEGSGFTFSDYYIHWHCQAPGKSLEWVGFIRDKPRQHTTEYATSVKERFSISRDDSKNTDYLQMSSLRAEDTAMYYCARER
Mesocricetus auratus V894 trdv APMT01182488.1 35709 KGALCITLTQSSPDKTVASGSQVTLFCTYEGNFPNPDLFWYRKRQDLSFEFILYRDNTRFHNADFVQGRFSVQHSKAYRTFHLVISPVWLEDSGTYYCASG
Mesocricetus auratus V909 trav APMT01202997.1 648 QSVSQGDAHVTVFEGDSVELTCNYSHGGTIYLFWYMQRRGHTLQLLLKYYSRDPVVHGLSGFEAEFRKSDSSFHLKKGSVNLSDSAVYYCALG
Mesocricetus auratus V910 trav APMT01203004.1 2360 HIQAQSVSQGDAHVTVFEEDSVELRCNYSYGGTTYLFWYMQRHGHSLQLLLKYYSGGPVVHGLNGFEAEFRKSDSSFHLKKASVHLSDSAVYFCALG
Mesocricetus auratus V911 trav APMT01203138.1 400 LSSQPKVQQNSESFILPEGAMASLNCTFSDRNTDYFWWYRQYLGKSPKALMTIISNCEKEEGRFTIHLNKTSLHVSLNIRDSHPSVSAFYLCAV
Mesocricetus auratus V912 trav APMT01203379.1 3369 VSSQQKVQQNPESLSVQEGAMASLKCTFSDSASDIYRWYRQYSGKGLELLVSIFSSGEKKEDRFTVHLNTASLHVSLHIGDSQPSDSSVYLCAV
Mesocricetus auratus V914 igkv APMT01205216.1 14560 ARCDIQMTQSPSSLSASLGESVTITCRASQDISRYLNWFQQKPGNAPKRLIYGTSNLENGVPSRFSGSGSGTDYSLTISSVEYEDMAIYYCLQYDKYP
Mesocricetus auratus V915 trav APMT01206916.1 2816 VNSLQGEENPWALSIQEGENVTVNCSYKTSIAAIQWYRQDSGKGPTMLILIRSNEKEKQSGRLRVTLNTSSESSSLSITAAWPEDTGAYFCATD
Mesocricetus auratus V916 trav APMT01206925.1 1416 SFTGYCRAQSVTQPEAWVTVIEGSSLQLRCNYSSSAAPYLFWYVQYPRQGFQLLLKYYSGDPVVRGLIGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALS
Mesocricetus auratus V917 ighv APMT01209936.1 7021 FHCDVQLMESGGSLVQPGKTLKLSCEASGFTFSDYSMHWVRQAPGKGLEWVSLINYDSSYIEYANTVKGRFTISRDNAKKTMYLQMNSLKSEDTAMYYCAR
Mesocricetus auratus V928 ighv APMT01222083.1 3809 VLSQVQLKESGPSMVQPSETLPLTCTVSGISLSSIAVSWIRQPPGKGLEWMGEIWSNGNTYYNSALQSRISITRDTSKSQVFFKLNNLKTEDTAIYYCAR