WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ceratotherium simum simum AKZM00000000.1 (AKZM01) 268 24 36 8 119 47 9 25
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ceratotherium simum simum V43 trdv AKZM01006927.1 144624 NDVMCNQVTQSSPDQTVASGNKVTLLCAYKTSYSNPDLYWYRMRPDHSLQFILYRDNSRSLDADFTQGRFSVQHGKTQKTFHLVISPVRTEDSAIYYCAID
Ceratotherium simum simum V137 trav AKZM01019592.1 49928 SHTQVVQVNDSMYGFIGTDVVLHCSFANLLPGVKITQVTWQKSTNGSKQNVALYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Ceratotherium simum simum V176 trbv AKZM01025499.1 172885 VRTQTIHQWPPTKMQLVDSPLSLECTVKGTSNPTLYWYRQAAGGALQLLFYSFGINQIEPKALQNFAASGTQDDQFVLTSKKLLLNDSGFYLCAWS
Ceratotherium simum simum V275 igkv AKZM01039571.1 27380 ACGDIVMTQSPASLAVSLGERVTINCKASQSVSSYLAWYQQKPGQAPKLLIYSASSRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQEHNSAP
Ceratotherium simum simum V276 igkv AKZM01039572.1 9310 ACGDIVVTQSPGSLAVSLGQRVTINCKASQSVSSELSWHQQKPGQAPKMLIYDASNRASGVPDRFSGSGSGTDFTLTISNLQAEDVAVYYCMCDYGNP
Ceratotherium simum simum V277 igkv AKZM01039572.1 37290 ARGDIVMTQSPASLAVSPGQRVTINCKASQSVSSYLAWYQQKPGQAPKQLIYAASSRASGVSDRFSGSGSGTDFTLTISSLQAEDVAVYYCQRGYSAP
Ceratotherium simum simum V278 igkv AKZM01039574.1 16355 VCGDIVMTQSPGTLAVSVGDTVTINCKSSQSLLSSANQKHLLAWHQQKPGQAAKLLIYYASTRDTGVPDRFSGGGSGTDFTLTISSLQAEDVAVYYCQQHYISP
Ceratotherium simum simum V279 igkv AKZM01039576.1 15044 STGDIVLTQSPVSLMVSSGQRAAISCRASQSVTSGSYSFINWYQQKPRQPPKLLIYVPSNRESGVPARFSGSGSGTYFSLTINPVEADDAANYYCQQSKVIT
Ceratotherium simum simum V280 igkv AKZM01039576.1 22765 VYGDIVMTQTPGSLAVSVGDTVTINCKSSQSLLSSSNQKNYLAWYQQKPGQAPKWLIYYASSRATGVPDRFSGSGSGTDFTFTISSLQAEDVAVYYCQQLYSSP
Ceratotherium simum simum V303 trgv AKZM01042563.1 48 TQASSNLEGIRMAVTRQAGSSVVMTCDIQQSNDYVHWYRYQEGMAPQRLLYYQFSSSKIVVESGVSSQKYHAYESTGKTCEFLIKILEESDSGVYYCAAWE
Ceratotherium simum simum V304 trgv AKZM01042563.1 39610 TQASSNLEGTQMAVIKPAGSSVVITCDIKQSLTYVHWYQYKEGMAPQRLLYYHYQYSRLMTDPGSNSGKYHMYGSSEKNRNIELRNLEESDSGVYYCAVWE
Ceratotherium simum simum V342 trgv AKZM01048247.1 6106 TSGDVLITQVTTFITKKKGNTAFLECKVKRGAFKENACIHWYRQKPDQPLRRILYISSNENVVHEQGVSEERYEARKRQSDLSASLRIHQVEEADAGLYYCACWD
Ceratotherium simum simum V343 trgv AKZM01048248.1 47277 TQASSNLEGIQMAVTRQAGSSVAIPCDIKQSRDYIHWYRYQEGMAPQRLLYYDFSSSKFVVDSGFSSGKYQAYKSSGRTCTFLLQNLEESDSGVYYCAAWE
Ceratotherium simum simum V344 trgv AKZM01048250.1 18845 ATQISSNLEGREMSITRQAGSSAVITCDIKQSSDYVHWYRYREGMAPQRLLYYQFSSSKVVSEPGISSWKYQAYTGTGRTCKLLIKILEENDSGVYYCAAWE
Ceratotherium simum simum V345 trgv AKZM01048251.1 45187 AELSSNLEETQMSITKQAGSSVVIICDIKQSNDYVHWYRYQEGMAPQRLLYYDFSSSKVVRESGISSSKYQAYLGTGRTCKLYINVVEESDSGVYYCAAWE
Ceratotherium simum simum V346 trgv AKZM01048251.1 106142 TQASSNLEGTQMSITRQAGSSAVITCDIQQSSDYVHWYRYQEGMAPQRLLYYQFSSSKVVRESGISSRKYHAYEGSGRTCELLINTLEERDSGVYYCAAWE
Ceratotherium simum simum V347 trgv AKZM01048253.1 3503 TQASSNLERRQMSVTKQAGSSAVITCDIKQSSDYVHWYRYQEGMAPQRLLYYEFSSSKVVVDSGVSSQKYHAYEGSGRTCELLIKILQESDSGVYYCAAWE
Ceratotherium simum simum V348 trgv AKZM01048258.1 5992 ATQISSNLEGTQMSVTRQAGSSVVITCDIKQSSYYLHWYRYQKGMAPQRLLYYEFSSSSVVRESGISSSKYQASLGTRSTGELSIKNLEERDSGVYYCAAWE
Ceratotherium simum simum V379 iglv AKZM01052027.1 14753 SWAQSALTHPPSASGALGQWVTISCAGSSSDIGGYNYISWYQQPPGTAPKLLIYDVSSRASGIPARFSGSKSGNTASLTISGLQAEDEADYYCSSYGSSNN
Ceratotherium simum simum V380 iglv AKZM01052027.1 21538 SWAQSALTQPSSVSGALGQSVTISCSGSSSDIGGYNYVSWYQQLPGTAPKLLIYAVSSRASGIPARFSGSKSGNTASLTISGLQAEDEADYYCSSYSSSNN
Ceratotherium simum simum V381 iglv AKZM01052027.1 58189 SRAQSSLSQPSSASGTLGQSVTISCTGSSSDIGKYNYVSWFQQLPGTAPKLLIYNVNSRASGIPARFSGSKSGNTASLTISGLQAEDEADYYCS
Ceratotherium simum simum V382 iglv AKZM01052029.1 26832 SWAQSALTQPPSVSGTPGQTVTISCTGSSSSYISWYQHHPGSVPKLLIYAVSSRPSGVPDRFSGSNSGNTATLTISGLQAEDEADYYCSSYIGS
Ceratotherium simum simum V383 iglv AKZM01052030.1 3787 FWAQTALTQLFSASGSLGQLVTISCAGSSSDIGSTYVSWHQEHLGTAPTLLIYYSSRWPSGIPDCFSGSKSANTASLSISGLQAEDKANYYCGSYRSSYI
Ceratotherium simum simum V384 iglv AKZM01052030.1 22946 SWAQSALTQPPSVSGALGQSVTISCAGSSSDIGGYSGVSWYQQHPGTAPKLLTYYTNMQPSGIPVPFSGSKSGNTASLTISGLQADDEADYYCGSYRSSNN
Ceratotherium simum simum V386 iglv AKZM01052031.1 27850 SLAQSALTQSPSASRILRQSVSISCAGSSSGNGGYNYISWYQQLPGIAPRLLIYNVNTWASGIPASFSGSESGNTASLTISGLEAEYKADYYCS
Ceratotherium simum simum V387 iglv AKZM01052031.1 33914 SWAQSALTQPPSASGALGQSVTISCAGSSSDIGGYSGVSWYQQHPGTAPKLLIYAVSSRASGIPARFSGSKSGNTASLTISGLQAEDEADYYCSSYGSSNN
Ceratotherium simum simum V388 iglv AKZM01052031.1 39692 SVSLTLQGSGAIGHQLLSWKSNDIGDYDCVSCYQWHRGTAPKFLIYKVHTQASGIPDLFSGSKSGSTASLMISGLQAEDEADYYCYSYRTVTL
Ceratotherium simum simum V389 iglv AKZM01052037.1 48760 SVESSELTQPPTASVVLGQTATITCQGDDIESNYVHWYQQKPGQAPVLVIYGSNNRPSGIPERFSGSNSGDTATLTISAAQDEDEADYYCQSVHILGSE
Ceratotherium simum simum V390 iglv AKZM01052037.1 88889 SVVSSELTQPAKVSVELGQTARITCQGGSFGSYSASWYQQKPGQAPVLVAYSDNYQPTGIPDRFSGSYSGNTATLTISGAQTEDEADYYCQSLDSSAN
Ceratotherium simum simum V391 iglv AKZM01052037.1 135338 SVVSSELTQPSTVTVALGQTATITCQGDGLDSYAQWYQQKPGKAPVLVIYGNDERSSGIPERFSGSNSGDTATLTITGAQAEDEADYHCQSGSAFLDE
Ceratotherium simum simum V392 iglv AKZM01052038.1 15554 SVVSSELTQPAKVSVELGQTARITCQGGSFGSYSASWYQQKPGQAPVLVAYSDNYQPTGIPDRFSGSYSGNTATLTISGAQTEDEADYYCQSLDSSAN
Ceratotherium simum simum V393 iglv AKZM01052038.1 38732 SVGSSKLTQPPVVSTALGQTARITCQGDILEKSYAQWYQQKPGQAPLIVIYKDSERPSGIPDRFSGSSSGTTNTLTICGIQTEDEADYYCYASDSSVN
Ceratotherium simum simum V394 iglv AKZM01052038.1 59794 SVASSELTQPPTVSVALGGTARITCQGGNFGSSYANWYQQKPGLAPLTVIYKDSERPSGIPDRFSGSSSGNTATLTISGARTEDEADYYCHSSDSSSN
Ceratotherium simum simum V395 iglv AKZM01052040.1 19784 SVESSELTQPPTVSVDLGQTATITCQGENAAMLAHWYQQKPGQAPVLVIYGSNNRPSGIPERFSGSNSGDTATLTITGAQAEDEADYYCLSLDASDN
Ceratotherium simum simum V396 iglv AKZM01052047.1 3298 SVESSELTQPPTASVALGQTATITCQGGEIESSDASWYQQKPGQAPVLLIYGGSERPSGIPERFSGSTSGNTATLTISGVQAEDEADYYCQSFDSSGN
Ceratotherium simum simum V397 iglv AKZM01052068.1 13016 SVASSELAQPPAVSMALGQTARITCQGGSFGSNYAYWYQQKPGQAPVLVIHRDNKQPSGIPDRFSGSSSGNTATLTINGAQTEDEADYYCQSGVAYSSE
Ceratotherium simum simum V398 iglv AKZM01052072.1 342 SVESSELTQPPTASVALGQTATITCQGESVGTFAYWYQQKPGQAPVLLIYGDSERPSGIPERFSGSTSGNTATLTISGVQAEDEADYYCRSLDSSGN
Ceratotherium simum simum V399 iglv AKZM01052073.1 28486 SVASFELTQPPEVSVALGQTATITCQGENLDIHGHWYQHKPGQAPVLVIDETSRSPSGIPERFSGSHSGDTATLTITGVQAEDEADYYCQSIDILGGE
Ceratotherium simum simum V465 trav AKZM01006933.1 153275 VSGKNGVEQSPQDLSTQEGDFVTMNCSYSIGMNTLLWLRQSPGGGIVSLFTLSSEMKKKGRVSATINTKECHSSLHITASQPRDSALYLCAV
Ceratotherium simum simum V466 trdv AKZM01006933.1 72747 VSVDITLEPDTDTLTVLAGKAATFRCNITGGDLNNYRMSWYKKNEDNSLTLVYRPRNNSNDHLYDLRNNFKGNISTLKSQYILDIQKATTKDVGTYYCGSD
Ceratotherium simum simum V467 trav AKZM01006934.1 966 FNGEVRVEQSPPSLSTQEGEDCTLYCSYSGTTSDRLHWYRQDVGKSLESLFLLVSNGIVKQEGRFTASLDTKARRSTLHIAAAQRGLSATYFCAV
Ceratotherium simum simum V468 trav AKZM01006935.1 48576 VSGQQLNHSPQSVSIQEGEDVSMNCNSSSTFNTLHWYKQDAGEGLVLLVNLYKAGELTRNGKLVAQFGGTRQDSFLNISASEPKDAGTYFCAG
Ceratotherium simum simum V469 trav AKZM01006935.1 32453 PGRAEWIRPRETELSGTEGKTVNLLCNYGTSSMASVDLYWYRQYPNQALEYILHRGWGYSGKGDASFAKGKFYSKTTANATDLYIRNLEPADTALYYCALR
Ceratotherium simum simum V470 trdv AKZM01006935.1 15759 SIMAQTVTQPQQEMSVQEAETVTLDCTYDTRDSDYYLFWYKQPPSREMVLIIRQEAYKKENATNNRFSVNFQKENKFFSLRISDSQLEDAAVYFCALMR
Ceratotherium simum simum V471 trav AKZM01006937.1 39328 VRVQMKVEQSPGVLILQEGRNSSLMCNYSISMTSVQWFQQNLGGRLISLFYIASGMQQKGRLKSTVNIKDRYSHLYIRDSQPGDSATYFCAV
Ceratotherium simum simum V472 trdv AKZM01006937.1 18098 SSMAQKVTQTQTIMTRREGEAVTMDCTYEISWSSYYDLHWYKQPPSGEMVFLIYQDYYQSSAKQDRFSVNFQKAKNFISLTISSLQLKDSAMYFCALRD
Ceratotherium simum simum V474 trdv AKZM01006938.1 25618 SSVAQRVTQGQPTISRQEGATVTLDCQYETRESTYYIFWYKQLPNGEIIFLISQSSSRQNAKNGRYSTNLQKAAKFISLTISTLQLEDSAKYFCALEN
Ceratotherium simum simum V475 trav AKZM01006938.1 8369 VNGQQIKQIPPFLLLQEGENFTTYCNSSSTLNRLQWYKQRPGGSPVLLMILVSGGEVKKQERLTARFGETRKDSSLHITATQTADVGSYFCAG
Ceratotherium simum simum V476 trav AKZM01006939.1 14493 VRGEQVEQSPPTLSLQEGASSTLRCNFSTSGSNLQWFRQNPGGHLISLFHIPSGTKQNGRLKAVTVAKERHSSLYISSSQTTDSAIYFCAVEPQCSP
Ceratotherium simum simum V477 trav AKZM01006940.1 1620 VSSKQEVEQSPEALSVLEGDRLALNCSYTDSAIYFLQWFRQDPGKGLTSLLLIQSNQREQTSGRIKASLDKLSRHSALYIATSQPNDSATYLCAV
Ceratotherium simum simum V478 trav AKZM01006941.1 9372 MRSQQNRVEQSPGSRSVPEGATASLNCTYSDSASNYFTWYRQYSGKGPELLVYIYSNGEKDEGRFTAQHNKVSQYVSLLIRDSQPSDSATYLCAV
Ceratotherium simum simum V479 trav AKZM01006941.1 4825 GTRAQTVTQPEDHISIFEGAPVQVKCNYLYSGSPDLFWYVQYPKQGLQLLLKHTSGDSIKGFMADLNKGEKSFLLKKPSVQEEDSAMYYCALS
Ceratotherium simum simum V480 trav AKZM01006942.1 84837 MWSQQNRVEQSTGSLSVPEGAIASLNCAYSDSGSQTFTWYRQYSGKGPVLLMYTYSNGDKDEGRFTAQVNKASRNISLLIRDSQLSDSATYLCAV
Ceratotherium simum simum V481 trdv AKZM01006942.1 60191 SSNTQSVNQPTNVVYKQERESVTLDCTITVSYTYYAMYWYQQLSSGEMTYIIHLRSEDRNSRKGRYSVVFQKPTIKLTISALTPRDSAVYFCGV
Ceratotherium simum simum V482 trav AKZM01006942.1 42506 GVRGVNVEQSPSALSLQEGTSSTLRCNFSATVNNVQWFRQNPGGNLINLFFIASGMKQNGRLNSTMNSKELYSTLHITASQLEDSATYLCAVE
Ceratotherium simum simum V483 trav AKZM01006942.1 20136 GVRGVNVEQSPPALSLQEGTSSTLRCNFSTTVSNVQWFRQNPGGGLINLFFIASGMKQNGRLNSTMNSKELYSTLHITASQLEDSATYLCAV
Ceratotherium simum simum V484 trav AKZM01006942.1 13046 LSQGENVKLHPSTLSVQEGNSSIINCTYSDCNSNYIPWYKQERGKGPQFIIDIQSNMDKKVDQRLIVLLNKTAKHLSLHITATQPGDSAIYFCAT
Ceratotherium simum simum V485 trav AKZM01006942.1 8015 SSIAQKVTQAQPAMCVQEKEAVTLNCTYDTSDRSYSLFWYKQPRSGAMMFLIRQDSYSQQSATEGRYSLNFQKANKSINLVISASQLEDSAVYFCALSE
Ceratotherium simum simum V486 trav AKZM01006944.1 21568 SSTGQKVTQVQPAMLVQEKKAVTLNCRYDTSVGSYSLFWYKQPSSGAMIFLIHQDSYSQESATEGRYSLNFQKENKSINLVISSSQLEDSAVYFCALRE
Ceratotherium simum simum V487 trav AKZM01006944.1 17295 QTYGDSVTQMEGQVTLSEGASLTMNCTYSTTGYPTLFWYVQYPGEGPQLLLRATKPDEKQSNKGFEATYNKETTSCHLEKASVQESDSAVYYCALS
Ceratotherium simum simum V488 trav AKZM01006946.1 24723 GVRGAQVEQSPSAVSLQEGASSTLRCNFSTTVNSMQWFRQNPGGGLINLFFMTSGMKQNGRLNSTMNSKELYSTLHITASQVEDSATYLCAV
Ceratotherium simum simum V489 trav AKZM01006946.1 17557 SSTARKVTQAQPAMLVQEKEAMTPNCTYDTSDRSYSLFWYKQPRSGAMMFLIHQDSYSQQSATEGRYSLNFQKANKSINLVISASQLEDSAVYFCALSE
Ceratotherium simum simum V490 trav AKZM01006946.1 4569 GVRGVNVEQSPSDLSLQEGTSSTLRCNFSTIVNNVQWFRQNPGGGLINLFYMTSGMKQNGRLNSTLNSKELYSTLHITASQLEDSATYLCAV
Ceratotherium simum simum V491 trdv AKZM01006947.1 100538 SSNSQSVIQPTNVMYTKEGESVTLECTITVSYTYYAMYWYQQLSSGEMTHIIYVYSEDRNSREGRYSVVFQKPTIKLTISTLTPGDSAVYFCAV
Ceratotherium simum simum V492 trav AKZM01006947.1 84644 GVRGVKVEQSPTALSLQEGTRSTLRCNFSTTVDNVQWFRQNPVGGLINLFFMTSGMKRNGRLNSTMNSKELYSTLHITASQLEDSATYLCAVE
Ceratotherium simum simum V493 trav AKZM01006947.1 73450 SSIAQKVTQAQPAMLMQEKEAVTLKCTYNTGGGSYSLFWYKQPSSGVMIFLIHQDSYQQNASEGRYSLNFQKENKSINLVISASQLEDSAVYFCALSE
Ceratotherium simum simum V494 trav AKZM01006947.1 61175 QTYGDSVTQMEGQVTLSEGASLTMNCTYSTTGYPTLFWYVQHPGEGPELLLRATKPNEKQSNKGFEATYNKETTSFHLEKTSVQESDSAVYYCALS
Ceratotherium simum simum V495 trav AKZM01006947.1 35352 MRSQQNRVEQSPGSLSVPEGAIASLNCTYSDRASQYFTWYRQYSGKGLELLMYIYSNGDKDEGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAV
Ceratotherium simum simum V496 trdv AKZM01006947.1 9896 SSNSQSVNQPTSVMYTKEGESVTLDCTITVSYAYYVMYWFRQLSSGEMTHVIYLLSDSWNSRQGRYSVVFQNPTLKLTISTLTLRDSAVYFCAV
Ceratotherium simum simum V497 trav AKZM01006948.1 84592 SSTAQTVTQPLPEMSVQEAATVTLDCTYDTTESDYYLFWYKQPPSGEMIFIIRQQAYKEENAMNNRFSVNFQKANKFFGLRISDSQLEDAVMYFCALMR
Ceratotherium simum simum V498 trav AKZM01006948.1 77752 SSMAQMVTQPQPEMFVQEAETVTLDCMYDISESNYYLFWYKQPPSREMVLIIHQEAYKQQNATNNRFSVNFQKANKFFGLRISDSQLEDAVMYFCALMR
Ceratotherium simum simum V499 trav AKZM01006948.1 55932 FNGEVRVEQSPPSLSTQEGEDCTLYCSYSGTTSDRLHWYRQDVGKSLESLFLLVSNGIVKQEGRFTASLDTKARRSTLHIAATQRGLSATYFCAV
Ceratotherium simum simum V500 trav AKZM01006948.1 34165 VSGKNGVEQSPQDLSAQEGDFVTINCTYSIGITTLHWLQQSPAGDIVTLFTLSSEMKKKGRVSATISTKERHSSLHITASHPRDSALYFCAV
Ceratotherium simum simum V501 trdv AKZM01006949.1 9306 SSMAQKVTQAQTIITRREGEAVTMGCTYEISWGSYYDLYWYKQPPSGEMVFLIYQNPDKPSAKQGRFSVNFQKGKKSISLTISPLQLADSANYFCALRY
Ceratotherium simum simum V502 trdv AKZM01006950.1 42999 SSVAQRITQGQQATSRQEGETVTLDCRYETSDSMYYIFWYQQLPNGEIIFLISQSSSRQNAKNGRYSTNLEKAAKFISLTISTLQLEDSAKYFCALEE
Ceratotherium simum simum V503 trav AKZM01006950.1 19719 TAIDAKTTQPSSMDYAEGDDVNLPCNHSTISVDDYIHWYRQNPNQSLQYIIHGLRNTVNNSIASLTFATDRKSSTLILRQVTLRDTAVYYCIVR
Ceratotherium simum simum V504 trav AKZM01006950.1 3050 GTRAQSVTQPDDYITVSEGDPLELRCNYSYGATPSLFWYIQYPSQGLQLLLKYTSGSTLVKGIKGFQAEFKKSETSFHLKKPSAHWSDSAEYFCALS
Ceratotherium simum simum V505 trav AKZM01006952.1 108344 LRVQMKVEQSPGVLIPQEGRNTSLMCNYTISMTSVHWFQQNPGGRLIYLFYIASGMQQKGRLKSTVNFKDHYSHLYITDSQPWDSATYFCAV
Ceratotherium simum simum V506 trdv AKZM01006952.1 88521 SSMAQKVIQAPTTITRQEGEAVTLDCKYEIGWSSYYDLYWYKQSPSGRMVFFIYQDSDKPSAKQDHFSVNFQKAEKFMSLTISSLQLADSAIYFCVLWE
Ceratotherium simum simum V507 trdv AKZM01006952.1 64821 SSNTQRIIQPTNEVYRQEGDSVTLDCKITVSYAYYMMYWYQQLSSGEMTHIIQLHSDRRLSREGRYSVVFQKPTLELTISALTSRDSAVYFCAV
Ceratotherium simum simum V508 trav AKZM01006952.1 58427 GVRGVKVEQSPSALSLQEGTSSTLRCNFCTTVSYMQWLQQNPGGSLISLFFMTSGMKQNGRLNSTMNSKELYSTLNITASQLEDSATYLCAVE
Ceratotherium simum simum V509 trav AKZM01006952.1 55341 LSRGENVEQHPSTLSVQEGNSSVINCTYSNSASIYFSWYKQERGKGPQHVIDIHSIMKEKEDQRLTVLLDKTAKHLSLHIAATHPGDSAVYFCAAS
Ceratotherium simum simum V510 trav AKZM01006952.1 41799 QTYGDSVTQMESQVTLSEGASLTINCTYSPTGYPILFWYVQYPDEGPQLLLRATKANEKGSNKGFEATYDTETTSFHLEKASIQESDSAVYYCALS
Ceratotherium simum simum V511 trav AKZM01006952.1 33395 VSGKNQVEQSPPSLIIVEGENCTFQCNYTVSPFSNLRWYKLDTGRGPVSLITMTRSGSKKLNGRYTVTVDTTTQHSFLHITAAQLSDPAFYICVVG
Ceratotherium simum simum V512 trav AKZM01006952.1 23579 GLSGEDQVEQSPQTLSFQEGDSLSLNCSYTVSYFRGLQWYRQDPGRGPELLFLLYSVGDEKQKERLRATLSKEGSSLHITAPKPEDSATYLCAVE
Ceratotherium simum simum V513 trav AKZM01006952.1 9328 VSGKQEVEQSPEALSAREGEISALNCSYTDSAIFSLQWFRQDPGKGLISLLLLQSNQREQTSERIKASLDKSSRRSTLYIATSQPSDSATYLCAV
Ceratotherium simum simum V514 trav AKZM01006952.1 2237 MRAAQVEQSPPTLSHQEGASSTLWCNFSTSMRSVQWFRQNPGGRLISLFHVPSGTQQNGRLKAMTVAKERHSSLYISSSQTTDSAIYFCAVEPQCSP
Ceratotherium simum simum V515 trdv AKZM01006953.1 166278 SSMAQKVTQAQTIITRREGEAVTMDCTYETSWSRYRLYWYKQPPSGEMVFLIYQDSDKPSAKQDRFSVNFQKGKKSISLTISSLQLADSATYFCALWD
Ceratotherium simum simum V516 trav AKZM01006953.1 156303 IMGDTKTTKLNAMESTEEELVHLPCNHSTISGNEYIYEYIYWYQQIPHQSLEYVIHGLKNIVTNGMTSLTITTDRKSSTLILPQVTPRDTAVYYCIVR
Ceratotherium simum simum V517 trdv AKZM01006953.1 142027 SSNTQTVIQPTSVVYRQEGDSVTLDCKITVSYAYYVMYWYQQLSTGEMTYIIRIYSTSRNSREGRYSVVFQKPTLKLTISALTSRDSAVYFCAVVEV
Ceratotherium simum simum V518 trav AKZM01006953.1 106601 QTYGDSVTQMEGQVTLSEGASLTMNCTYSTTTYVTLFWYVQYPGEGPQLLLKAMTANEKGSNKGFEATYNKETTSFHLEKDSVQQSDSAVYYCALS
Ceratotherium simum simum V519 trav AKZM01006953.1 67526 VNSQQEEQTLQVLSVQEGENATMNCSYKTDTTNLQWYRQDSGRGLALLILIRSNEREKHSGRLRVTLDTPSKSSSLSIRASRAADAAAYFCAVD
Ceratotherium simum simum V520 trav AKZM01006953.1 56661 VRGQQVEQSPSTLSLQEGASSTLRCNFSTSGSNVQWFRQNPGGHLISLFYIPSGTKQNGRLKATTVMKERHSSLYISSSQTTDSAIYFCAVEPQFSQ
Ceratotherium simum simum V521 trav AKZM01006953.1 21840 VNGQQIKQIPPFRLLQEGENFTTYCNSSSTLSSFQWYKQRPGGSPVLLMKLVTGGDVKKQERLMAWIGETRKDSSLHITAAQTTDVGTYFCAG
Ceratotherium simum simum V522 trav AKZM01006953.1 15406 ILIDAKTAQPNSMDYAEGEDVNLPCNHSTISGEEYIHWYRQNPSQSPQYIIHGLRNTVNNSMASLTIATDRKSSTLILPQVTLRDSAVYYCIVR
Ceratotherium simum simum V523 trav AKZM01006953.1 5554 GTRAQSVTQPDDHITVSEGDHLELKCNYSYSRSLYLFWYVQYPSQGLQLLLKYMTGATLVKGIKGFQAEFKKSETSFHLRKMSAHWSDSAEYFCALS
Ceratotherium simum simum V524 trdv AKZM01006956.1 60615 SSVAQRVTQVQTATSRQEGATVTLDCRYETSQSVYYIFWYKQLPNGEIIFLISQGSSGQNAKSGRYFTNLETAAKFISLTISTLELEDSAKYFCALQE
Ceratotherium simum simum V525 trav AKZM01006956.1 42727 VNGQQIKQLPPFLLLQEGENFTTYCNSSSTLSSFQWYKQRPGGSPVLLMILATGGDVKKQKRLTAQFGETRKDGSLHIMATETEDVGTYFCAG
Ceratotherium simum simum V526 trav AKZM01006956.1 35980 TVIDAKTTQPNSMDYAEGEDVNLPCNHSTISGGDYIHWYRQNLNQSPQYIIHGLQSTVNNSIASLTIATDRKSSTLILPQVTLRDSAVYYCIMR
Ceratotherium simum simum V527 trav AKZM01006957.1 27495 GVRGLKIEQSPSALSLQEGTSSTLRCNFSTTVYKAQWFRQNPWGGLINLFFMTSGTKQNGRLNCTMNSKELYSTLHITASQLEDSATYLCAVE
Ceratotherium simum simum V528 trav AKZM01006957.1 19862 LSGGENVEQHPSTLSVQEGNNCVINCTYSDYFPWYKQEHGKHPQLIIDIHSNMDKKEDQRLTVLLNKMAKYLSLHVTDTQPGDSADYFCAANTHCLL
Ceratotherium simum simum V529 trav AKZM01006957.1 12883 SSIAQKVTQAQPAMLVQEKEAVTLNCRYDASDGSYSLFWYKQPSSGVMMFLIRQDSYNQQSATEGHYSLNFQKANKSIKLVISASQTEDSAVYFCSLRE
Ceratotherium simum simum V530 trav AKZM01006957.1 7153 GTNGDSVTQTEGPVTLHEGASLTLNCTYQSSYSLSLFWYVQYQNKEPELLLKSSSENQELDSRGFRANLVKSDSSFHLQKPSVQMSDSAVYYCALR
Ceratotherium simum simum V531 trav AKZM01006958.1 5541 QTYGDSVTQMEGQVTLSEGDSLTINCTYSATGYPALFWYVQYPGVGPQLLLKAVTAKEKGSNKGFEATYNKETTSFHLEKASVQESDAAVYYCALS
Ceratotherium simum simum V532 trav AKZM01006960.1 65924 GLRAQSVTQPEDQVTVTEGDPMTVKCTYSIPGSPNLFWYVQYPNQGLQFLLKYFTGDNLVKGSNGFVAEFNKSQTSFHLKKPSVLSSDSAVYFCAGS
Ceratotherium simum simum V534 trav AKZM01006960.1 50209 GVRGVNVAQSPPALSLQEGASSTLRCSFSTTVNNVQWFRQNPGGGLINLFFLTSEMKQSGRLNSTLNSKELYSTLHITASQLEDSATYLCAVE
Ceratotherium simum simum V535 trav AKZM01006960.1 40802 MSRGEVVEQHPSFLSVREGDSLVINCTYTDSTSTYFFWYKQEPGTGLQLLIYTLSTVDKKQEQRLTVLLNNKDKHLSLNITDTHPGDSATYFCAAR
Ceratotherium simum simum V536 trav AKZM01006960.1 32943 VSSQKMEQTPQSLSIQEGEKAILTCNYTNYSPVSLQWYRQDLGKGLIFLLLIRENEREKQTGRLRATFDTTTKQGSFHITASQPADSATYLCAA
Ceratotherium simum simum V537 trav AKZM01006960.1 28641 DARAQSVTQPDVHLVVSEGSSLELRCNYSYGGAPDLFWYVQYPNQGLQFLLKYFGGDTLVKGIRDFEAEFRKSESSFNLRKSSAHWSDSAVYFCVLS
Ceratotherium simum simum V538 trav AKZM01006960.1 11905 GVRGMNVEQSPSPLSLQEGASSTLRCNFSTSTRSVQWFRQNPGGGLITLFYVTSGMKQNGRLNCTMNSKELYSTLHITASQLEDSATYLCAVE
Ceratotherium simum simum V539 trdv AKZM01006960.1 3193 SSVAQKVTQTQLAKLVQEKEAVTLNCRYDTSDGSYSLFWYKQPSSGAMIFLIGQESYQQNATEGRYSLNFQKANKSINLVISASEIKDSAVYFCALRE
Ceratotherium simum simum V540 trav AKZM01006962.1 168112 GTNGDSVTQTEGPVILSDGAPVILNCTYQTSDSMPFLSWYVQYLNKAPQLLLKSSTENQRTEHQGFQANLVKSDSSFHLQKPSVQMSDLAVYYCALR
Ceratotherium simum simum V541 trav AKZM01006962.1 162498 SSMAQKVTQAQPAVSVLEKEAATLDCVYETSSYGYYLFWYKQTPSGEMIFLIHQDSYSEQNATKYRYFLNFRKPASSISLSITASQLGDSAVYFCALRE
Ceratotherium simum simum V542 trav AKZM01006962.1 123494 VNGQQIKQLPPFRLLQEGENFTTYCNSSSTLNGLQWYKQRPGGSPVLLMILVSGGEVKKQERLTARFGETRKDSSLHITAAQTTDEGTYFCAG
Ceratotherium simum simum V543 trav AKZM01006962.1 116573 TVIEAKTTQPNSMDYAEGEDVNLPCNHSTISGDEYIHWYRQNPNQSPQYIIHGLQNTVNNSIASLTIATDRKSNTLILPQVTLRDTAVYYCIVRR
Ceratotherium simum simum V544 trav AKZM01006962.1 107308 GTGAQSVTQPDDHTTVSEGDPLELKCNYSYSGAPYLFWYVQYPSQGLQLLLKYTSGATLVKGIKGFQAEFKKSETSFHLWKPSAHLSDSAEYFCALS
Ceratotherium simum simum V545 trav AKZM01006962.1 84924 KNTQQLEQSPRFLSIQEGENVTVYCNSSSVFTSFQWYRQEPGEGPVLLMTLTKGGEMKEQKRLRAQFGKERKDSSLLITAAHPGDAGIYLCAG
Ceratotherium simum simum V546 trdv AKZM01006962.1 72015 SSMAQKVTQSQTMITRQEGEAVTMDCKCETSWSDYYTLYWYKQPPSEGMVFLIYQGYDKPSAKQGRFSVSFQKAKQIISLTISSLKLEDSAPYFCALWD
Ceratotherium simum simum V547 trav AKZM01006962.1 61736 IMSDAKTTQPKAIESIEEDPVRLPCNHSTISGSEYIYWYQQTPTQGPEYVIHGLKSGVTNGMTSLTIATDRQSNTLTLTQATLRDTAVYYCIVR
Ceratotherium simum simum V548 trdv AKZM01006962.1 49048 SSDTQSVNQPTNVVYRQEGDSVTLDCTITVSFTSYLMYWYQQLSTGEMTYIIQLHSTSSNLRQGRYSVVFQKPTLKLTISALTPRDSAVYFCAV
Ceratotherium simum simum V549 trav AKZM01006962.1 30353 GVRGVNVEQSPSALSLQEGTSSTLRCNFSTTVSYMQWFRQNPGGGLINLFYMTSGMKQNGRLNCTVNSKERYSTLHITASQVEDSATYLCAVE
Ceratotherium simum simum V550 trdv AKZM01006962.1 5842 SSIAQNIIQVQTTITRREGETVTMNCNYEISWGRYDDFYWYKQPPSGEMVFLIYHDYSKPNAKQDCFSVNFQSAKKFISLIISPLQLADSATYFCALLD
Ceratotherium simum simum V551 trav AKZM01006963.1 37311 MRSQQNRVEQSPGSLSVPERAIASLNCTYSDRASQNFMWYRQYSGKGPELLMYIYSDGDKDEGRFTAQLNKASLYVSLLIRDSQPSDSATYLCAV
Ceratotherium simum simum V552 trav AKZM01006963.1 32652 GTGAQSVTQPDVHITVSEGAPLELRCNYRFSLPSSLFWYVQYPNQGLQLLLKYISGNSLVSGIKSFEAEFKKSETSFHLRKPSAHWSDLAEYFCALS
Ceratotherium simum simum V553 trav AKZM01006963.1 25223 ETSPQTVTQPEDHMSVFEGAPVQVKCNYSYSGSPDLFWYVQYPKQGLQLLLKHISRETIKGFTADLNKGDRSFHLKKPSAQEEDSAVYYCALS
Ceratotherium simum simum V554 trav AKZM01006963.1 16722 VNSQQGKQNLQALSVQEGENATMNCSYKTTITILQWYRQDAGRGLALLFLIRSNEREKHSGRLRVTLDTSSKSSSLSIRASRAADAAAYFCAVD
Ceratotherium simum simum V555 trav AKZM01006963.1 11144 GTNGDSVTQTEGPVTLPEGASLTLNCTYQSIYSVFLFWFVQYQNKEPELLLKSSSENQEVGSRGFWANLVKSDSSFHLQKPSVQMTDSAVYYCALR
Ceratotherium simum simum V556 trdv AKZM01006964.1 7147 SSVAQKVTQAQQAMFVQEKEVMTLNCRYDTSSSGYNLFWYKQPSSGAMMFLIHQNSYNQQNASEGRYSLNFQKANKSINLAISASQLEDSAVYFCALRE
Ceratotherium simum simum V557 trav AKZM01006964.1 1462 QTYGDSVTQMEGQVTLSEGDSLTVNCTYSTTGYPTLFWYVQYPGKGPQLLLRATKANEKGSNKGFEATYNEGTTSFHLEKDSVQDSDSAVYYCAMS
Ceratotherium simum simum V559 trav AKZM01006965.1 37310 GLRAQSVTQPEDQITVTEGDPLTVKCTYSFSGSPNLFWHVQYPNQGLQFLLKYFTGDNLVKGSNGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAGS
Ceratotherium simum simum V560 trav AKZM01006965.1 29108 TLSLAKTTQPLFTDAYEGQEVNIPCNHSNIATNEYIFWYRQFPNKGPQFVIRGFKTNETNEVASLFIPADRKSSTLSLPQVALRDSAVYYCIVS
Ceratotherium simum simum V561 trav AKZM01006965.1 17522 GTGAQSVTQPDVHITVSEGAHLELRCSYSSSVPPYLFWYVQYPNRGLQLLLKYTSGNSLVSGIKSFEAEFKKSETSFHLRKPSAHWSDSAKYFCALS
Ceratotherium simum simum V562 trav AKZM01006965.1 8959 GMQGMNVEQSPSALSLQEGTSSTLRCNFSTSMRNVQWFRQNPGAGLFSLFFIASGTKQNGRLNATVNSKELYSTLHITASQLEDSTTYFCAVE
Ceratotherium simum simum V563 trav AKZM01006966.1 63091 GTRAQSVTQPDDHTAVSEGDPLELRCNYTYGGAVYLFWYVQYPSQGLQLLLKYLSGATLVKGIKGFQAEFKKSDTSFHLWKQSAHLSDSAEYFCALS
Ceratotherium simum simum V565 trdv AKZM01006966.1 34602 SSMAQKVTQSQTIITRQEGEAVTMDCKYETGWSSYGLYWYKQPSGGEMVFLIYQGYDKPSAKQHRFSVNFQKAKKIISLTISSLQLADSATYFCALWD
Ceratotherium simum simum V566 trdv AKZM01006966.1 22324 SSNSQSVNQPTNVVYRQEGDSVTLDCTITVSYTYYIMYWYQQLSNGEMTHIIQLHSTNSNSKQGRYSVVFQKPNLRLTISTLTRKDSAVYFCAV
Ceratotherium simum simum V567 trav AKZM01006966.1 6057 EVRGVNVEQSPSALRLQEGTGSTLRCNFSTTVTSMQWFRQNPGGGLINLFYMTSGMKQNGRLNCTMNSKELYSTLHITASQLEDSATYLCAV
Ceratotherium simum simum V568 trav AKZM01006967.1 12676 VNGQQIKQLPPFLLLQEGENFTTYCNSSSTLNGLQWYKQRPGGSPVLLMILVSGGEVKKQERLTAQFGETRKDGSLHITAAQTADEGTYFCAG
Ceratotherium simum simum V569 trav AKZM01006967.1 5708 TVINAKTTQPNSMDYAEGEDVNLPCNHSTISRNEYIHWYRQNPSQSPQYIIHGLQNTVNNSMASLIIATDRKSSTLTLPQVTLGDTAVYYCIVRG
Ceratotherium simum simum V570 trdv AKZM01006969.1 174848 SSTAQKVTQSQTMITRQEGAAVTMDCQYETSWSSYDLYWYKQPSCGGMVFLIYQGYDKPSAKHGRFSVIFQKGKKFTSLTISSLQPADSATYFCALWD
Ceratotherium simum simum V571 trdv AKZM01006969.1 161694 SSNSQRVIQPTDVVYRQEGDSVTLECTIIVSYDYYTMYWYQQLSNGEMTHIIQLYFTSRNSREGRYSVVFQKPNLKLTISALTPRDSAVYFCAV
Ceratotherium simum simum V572 trav AKZM01006969.1 144830 GVRGMNVEQSPSALSLQEGTSSTLRCNFSTSMKSVQWFQQNPGGSLFSLFFIASGTKQNGRLNATVNSKELYSTLHITASQLEDSATYLCAV
Ceratotherium simum simum V573 trdv AKZM01006969.1 137924 SSMAQKVTQAQTIMTRREGEAVTMDCTYETSWSRYYLYWYKQPPSGEMVFLIHQDSDKPSAKQDRFSVNFQKAKTIISLTISSLQLADSATYFCALL
Ceratotherium simum simum V574 trav AKZM01006969.1 108282 GLRAQSVTQPEDQITVAEGDPLTVKCTYSISGSPYLFWYVQYPNQGLQFLLKYITGDSLVKGSYGFEAEFNKSQASFHLKKPSVLRSDSAVYFCAGS
Ceratotherium simum simum V575 trav AKZM01006969.1 100170 TLSLAKTTQPLFTDAYEGQEVNIPCNHSNIATNEYIFWYRQFPNKGPQFVIQGFKTNVTNEAASLFIPADRKSSILSLPQAALRDSAVYYCIVS
Ceratotherium simum simum V576 trav AKZM01006969.1 88057 GTGAQSVTQPDVHITVSEGARLELSCKYSSSVPPNLFWYVQYPNRGLQLLLKYTSGNSLVSGIKSFEAEFKKSETSFHLRKPSADWSDSAKYFCALS
Ceratotherium simum simum V577 trav AKZM01006969.1 85743 GVRGVNVAQSPSALSLQEGTSSTLRCNFSTTVTVVQWFQQNPGGGLINLFFLTSGMKQNGRLNSTLNSKELYSTLHITASQVEDSATYLCAVE
Ceratotherium simum simum V578 trav AKZM01006969.1 78689 GVRGVNVEQNPSALSLQEGSSSTLRCNFSTSLGSVQWFQQNPVGGLFSLFFIASGTKQNGRLSTTVNSKELYSTLHITASQVEDSATYLCAVE
Ceratotherium simum simum V579 trav AKZM01006969.1 71299 VSQGENVEQRPTLSVQEGNSCVINCTYSDSYSNYFLWYKQESGKGPQLIIDIRSNVDKKEEQRLTVLLNKTAKHLSLHIAATQARDSAVYFCVAS
Ceratotherium simum simum V580 trav AKZM01006969.1 48562 GRRAQSVTQPEDNISVFEGTLVQVKCNYSYSGSPVLFWYVQYPKQALRLLLKHTSGESIKGFTANLNKGERSFHLKKPSAQEEDSAMYYCALE
Ceratotherium simum simum V581 trav AKZM01006969.1 39547 VNSQQGEQNLQVLSVQEGENATMNCGYKTTITVLQWYRQDAGRGLALLILLRSNEKEKHSGRLRVTLDTSSKSSSLSIRASRAADAAAYFCAVD
Ceratotherium simum simum V582 trav AKZM01006969.1 30143 GTNGDSVTQTEGPITLSEGAPVILNCTYQTSYSAPFLFWYVQYPNKAPQLLLKSSIENQRTEHQGFQADLLMSDSSFHLQKPSVQMSDSAVYYCALR
Ceratotherium simum simum V583 trav AKZM01006969.1 24728 SSMAQKVTQAQPAVSVLEKEAATLDCVYEANSYSYSYYLFWYKQTPSGEMIFLIHQDSYNEQNTTKDRYFLNFQKPASSISLSITASQLGDSAVYFCALRE
Ceratotherium simum simum V584 trav AKZM01006969.1 16890 LSGEDQVEQSPQTLRIQEGDSLSLNCSYQVRSFRGLQWYRQDPGKGPELLFLLYSVGDEKHKERLRATVSKERSTLHITAPKPEDSATYLCAVE
Ceratotherium simum simum V585 trav AKZM01006970.1 17654 TVTEAKTTQPNSTDYAEGEDVNLPCNHSTISGNDYIHWYRQNRSQSPQYIIHGLQNTVNNSMASLIIATDRKSSTLILPQVTLRDTAVYYCIVR
Ceratotherium simum simum V586 trav AKZM01006970.1 7850 GTRAQSVTQPDDHITVSEGDPLQLRCNYSYGRAPSLFWYVQYPSQGLQLLLKYISGATLVKSIKGFQAEFKKSETSFHLWKPSAHLSDSAEYFCALS
Ceratotherium simum simum V587 trav AKZM01006971.1 1666 VNGQQIKQLPPFLLLQEGENFTTYCNSSSTVDRLQWYKQRPGGSPVLLMILVSGGDVKKQERLRAQFGETRKDSSLHITATQTADEGTYFCAG
Ceratotherium simum simum V588 trav AKZM01006972.1 1597 VRGQQVEQSPPILSLQEGANSTLQCNFSTSGSNVQWFRQNPGGHLSSLFYIPSGTKQNGRLKAVTVAKERHSSLYISSSQTTDSAIYFCAVEPQCSP
Ceratotherium simum simum V589 trav AKZM01006973.1 99256 QTYGDSVTQMEGQVTLSEGTSLTINCTYSASRYPTLFWYVQYPGEGPRLLLRATKANEKGSDNGFEATYDTETTSFHLEKASVQESDSAVYYCALS
Ceratotherium simum simum V590 trav AKZM01006973.1 90013 GVRGVNVEQSPSALSLQEGTSSTLRCNFSTTANRVQWFRQNPGDGLINLFFLTSGMKQSGRLNSTVNSKELYSTLHITASQLEDSATYLCAVE
Ceratotherium simum simum V591 trav AKZM01006973.1 84264 ENVEQHPSTLSVQEGNSCVINCTYSDSYSNYFLWYKQEPGKGPQLITDILSNVDNKDQRLTVLLNKTAKHLSLCIAATQAGDSAVYFCVASTHCFP
Ceratotherium simum simum V592 trav AKZM01006973.1 75210 QTYGDSVTQMEGQVTLSEGTSLTINCTYSATGYPTLFWYVQYPGEGPQLLLRATKANEKGSNNGFEATYDTETTSFHLEKDSIQESDSAVYYCALS
Ceratotherium simum simum V593 trav AKZM01006973.1 62750 VSGKNQVEQSPPSLIILEGENCTFQCNYTVSPFNNLRWYKQDTGRGPVSLITMTYSDSKKSNGTYTATLDTTTKCSSLYITAAQLSDPAFYICVVG
Ceratotherium simum simum V594 trav AKZM01006973.1 49001 MRSQQNRVEQSPGSLSVPEGAVASLNCTYSDRASQSFVWYRQYSGKGPELLMYIYSNGDKDEGRFTAKLNEASQYVSLPIRDSQPSDSATYLCAV
Ceratotherium simum simum V595 trav AKZM01006973.1 44369 GTGAQSVTQPDVHITVSEGAPLELRCNYSTSLPSYLCWYVQYPNQGLQLLLKYTSGNSLVSGIESFEAEFKKSETSFHLRKPSARWSDSAEYFCVLV
Ceratotherium simum simum V596 trav AKZM01006973.1 36963 GTRAHTVTQPEDHISVFEGALLQVKCNYSYSGSPMLFWYVQYPKQGLQLLLKDTSQESIKGFTANLNKGERSFHLKKPSAQEEDSALYYCALS
Ceratotherium simum simum V597 trav AKZM01006973.1 28361 VSSQQGEQTLQVVSIQEGENAIVNCSYKTSIENLQWYRQDAGRGLALLILIRSNEREKHSGRLRVTLDTSSKSSSLSIRASRAADAAAYFCAVG
Ceratotherium simum simum V598 trav AKZM01006973.1 22504 GTNGDSVTQTEGPVTLPEGASLTLNCTYQSSYSVFLFWYVQYQNKEPELLLKSSSENQEVDSRGFQAKHVKSDSSFHLQKPSVQMSDSAMYYCALR
Ceratotherium simum simum V599 trav AKZM01006973.1 9632 LSGEDQVEQSPQTLRVQEGDSLSLNCSYTVSYFGGLQWYRQDPGKGPELLFLLYSVGDEKQKERLRATVSKERSTLHITAPKPEDSATYLCAVK
Ceratotherium simum simum V600 trav AKZM01006974.1 93561 GLRAQSVTQPEDQVTVAEGDPLTVKCTYSFSGSPYLFWYVQYPNQGLQFLLKYITGDNLVKGSNGFEAEFNKSQTSFHLKKPSVFGSDSAVYFCAGS
Ceratotherium simum simum V601 trav AKZM01006974.1 85349 TLSLAKTTQPAFIDTYEGQEVNIPCNHSNIATDEYIFWYRQFPSKGPQFFIQGFKKNVTNEVASLSIPADRKSSTLSLPQAALRDSAVYYCIVS
Ceratotherium simum simum V602 trav AKZM01006974.1 74606 GTGAQSVTQPDVHITVSEGARLELRCKYTSSVSPYLFWYVQYPNQGLQLLLKYTSGNSLVSGIKSFEAEFRKNETSFHLRKPSALWSDSAKYFCALS
Ceratotherium simum simum V603 trav AKZM01006974.1 72279 GVRGVNVEQSPSALSLQEGTSYTLRCNFSTIVNRVQWFRQNPGGGLISLFFLTSGIKQNGRLNSTMNSKELYSTLLITASQLEDSATYLCAVE
Ceratotherium simum simum V604 trav AKZM01006974.1 63077 MSRGEVVEQHPSFLSVREGDSLVINCTYTDSASTYFFWYKQEPGTGLQLLIYTLSTVDKKQEQRLTVLLNKKNKHFSLNLTATHPGDSATYFCATR
Ceratotherium simum simum V605 trav AKZM01006974.1 55840 VSSQRMEQTPQSLSIQEGEKAILTCNYTNYSPESLQWYRQDMGKGLIFLLLIRENEPEKQTGRLRATFDTTTKQGSFHITASQPADSVTYLCAA
Ceratotherium simum simum V606 trav AKZM01006974.1 27025 DTRAQSVTQPDGHVLVSEEASLELRCNYSYGATPYLFWYIQYPSQGLQLLIKHFSGDTLVQGIKGFEAEFRKSDSSFNLKKSSAHWSDSAEYFCALS
Ceratotherium simum simum V607 trav AKZM01006974.1 13539 LSQGENVEQHPSTLSVQEGNSCVISCTYSDSASNYFPWYKQEPGKGLQLIIDIRSNVDKKEEKRLTVLLNKTAKHLSLHIATTQPGDTAVYFCAAS
Ceratotherium simum simum V608 trav AKZM01006974.1 6068 FSVAQKVTQAQLLMLVQEKEAVTLNCRYDASVGTYSLFWYKQPSSGAMIFFIRQDFYNQQNATEGRYLLNFQKANKSINLVISASQLEDSAVYFCSLRE
Ceratotherium simum simum V609 trav AKZM01006975.1 89331 TAGQGIHQPTELTAMEGASVQVNCMYQTSGFNGLSWYQQPGGGAPMFLSYNVLDGWERRGRFSSFLRRSDTYSYFLLKELQMKDSASYLCAVI
Ceratotherium simum simum V610 trav AKZM01006975.1 7499 GLRAQSVTQPEDQVTVAEGDPLTVKCTYSIPGSPYLFWYVQYPNQGLQFLLKYTTGDNLVKGSNGFEAEFNKSQTSFHLKKPSVFGSDSAVYFCAGS
Ceratotherium simum simum V719 iglv AKZM01023963.1 52573 SWAQSALTQPLSVSGDLGQSVTISCAGSSLSIGGYISLSWYQQLPGTAPKLLIYYTNRRPSGIPDRFSGSMSGNTASLTISGLHVEDEADYYCGSYAGS
Ceratotherium simum simum V720 iglv AKZM01023963.1 29713 SWVQSALSQPSSASGSLGQLVTISCTGSSSDIGGYNDVSWYQQHLGTAPKLLIYNVNTQASGIPARFSGSKSGNTASLTISGLEAAEEADYYCGSLRGG
Ceratotherium simum simum V721 iglv AKZM01023965.1 17007 SWAQSALTQLPSASGALDQSVTISCAGSSSDIGGYNYVSWHQRHLGTAPKLLIYDVSSWVSGIPACFSGSKSGNTASLTISGIQAEDEADYYCSSYVGS
Ceratotherium simum simum V722 iglv AKZM01023976.1 22008 FTSQAEVIQETSLTTTPGGTVTLTCGSNAGAVTTTNYADWVQQKPNQVPRGLIGDNTYRDPSVPERFSGSLLGGKAALTIKEAHPEDAAFYYCALW
Ceratotherium simum simum V723 iglv AKZM01023976.1 18454 ATSQAVVTQESSLTATPGGTVTLTCGSSTGAVTTSNYASWVQQKPYEGLQGSIGGISNQVSGVPARLSGSLLGNKAALTIMGPQPEDEAEYYCALWFSNR
Ceratotherium simum simum V724 iglv AKZM01023978.1 47074 SWAQSMLTQAASVSGALGQRVTISCTGSSSNIGGNYVSWYQQLPGTAPKTLIYSNSQRPSGVPDRFPGSKSGNSASLTITGLKSEDEADYYCVSYDDSLSA
Ceratotherium simum simum V725 iglv AKZM01023978.1 37681 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPFWFQQTPGQARRMLIYSTSSRASGVPNRFSGSISGNKATLTITGAQAEDEADYYCALYTGSS
Ceratotherium simum simum V727 iglv AKZM01023979.1 134590 WADTGSLSARIGGAEVHPPLHWKQQECWNLHCGLVSADFSWCPQSCDAWKFSALSVPSQFSGSKSGNTASLTMSGIQAEDEADYYCSV
Ceratotherium simum simum V728 iglv AKZM01023979.1 118003 SWSEVVLTQPHPVSESLGQKAIISCTRSSGYIGDKYVQWYQQRPGCSPTTLIYRDDQRPSGVPNRFSGSIDSSSSAAYLTVSGLQPEHKADYYCQSSYDSGY
Ceratotherium simum simum V729 iglv AKZM01023979.1 95260 SWAQSVLTQPPSVSGTLGQRVTISCTGSSSNIGGYAVSWYQQLPGTAPQTLIYYDNNRPSGIPHQFSGSKSDNSASLTITGLQDEDEADYYCQSYDSSLN
Ceratotherium simum simum V730 iglv AKZM01023979.1 25501 SLSQPVLTQPPSFSASPGSLARLTCTLSSDISVDSKSIYWYQQKPGSPPRYLLYYYSDSSTQLGSEVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Ceratotherium simum simum V731 iglv AKZM01023979.1 7985 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPSWFQQTPDQAPRTLIYNTNSRASGVPNCFSGSISGNKAALTITGAQAEDEADYYCVLGTGS
Ceratotherium simum simum V750 trbv AKZM01025500.1 239131 HTSAGVTQFPSHRVIEKERAVTLRCDPISGHEGLYWYRRAVGKEIKFLVYFLGESKWDESGMPKDMFSAERTEGTYSTLKIQPAELEDSGVYFCASSQ
Ceratotherium simum simum V751 trbv AKZM01025500.1 237253 HMSTMVTQNPRYQVTRKGKAVTLSCSQNLDHEYMYWYQQRLSQAPKLLFYYYNKQFNNETDTSDNFQPSRPNTSLCSLGIRSPGLRDSAVYLCASSM
Ceratotherium simum simum V752 trbv AKZM01025500.1 232782 ALDAEVTQTPGHLVKGKGQTGKMYCVPKEGHRYVFWYQQIRAKEFKFLISFQDENSFGETEMPKERFSAKCPPNSPCSLEIQPTELQDSAIYLCASSE
Ceratotherium simum simum V753 trbv AKZM01025500.1 219908 SMDGGITQSPKYVSKEEGQVVILDCEKNFNSDSTYWYRQDPGQGLRLIYYSKVVNNTEKGDISEGYSASREEKAFFPLTATSTQKNQIALYLCASSR
Ceratotherium simum simum V755 trbv AKZM01025500.1 206912 GSVLGALVSQHPSRVLCKNGSSVEIKCQAMDFEARTMCWYRQLPKQGLTLIVTSNQGSKPTYEQGFEEEKFPLSPPSPTFSTLTVKSARPEDSSLYFCGAS
Ceratotherium simum simum V756 trbv AKZM01025500.1 194903 GSGLGVLVSQHPSRTLCKNGTSVEIKCRAMDFDATVMLWYRQLPKQGLTLIVTSNQGSTPTYEQGFSEDKFPINHPNLTFSSLTVAGTHPADSSLYFCAAS
Ceratotherium simum simum V757 trbv AKZM01025500.1 155497 SMDTKVTQSPGHLIKGKEQKAKMDCVPIKGHSYIYWYRQKLEGEFEFLVYLEDENIIDKSKVLDQRFLAQCPQNSACSLQINSTELEDSALYFCASSQ
Ceratotherium simum simum V758 trbv AKZM01025500.1 146675 SIDAKVTQTPGHLVKGKRQRARMDCNPKKGHTFVSWYQQIQKKEFKFLIYFQNENILNQIDLVKERFSAQCPKNSPCSLEIQSSELGDSALYFCASSQ
Ceratotherium simum simum V759 trbv AKZM01025500.1 138966 TMDVRITQSSKYLLREEGQEVTLECEQNLDYDYMYWYRQDPGQGLRLIYYSRFVNDIQKGDVSEGYNASRVKKAFFPLTVASTQKNQTALYLCASSR
Ceratotherium simum simum V760 trbv AKZM01025500.1 125661 SMDTEVTQSPGHLVKGKEQKAKMDCVPIKTHTHVYWYRQKLEGEFEFLVYLQNKNIIDKSKVLDQQFLAQCPQNSACSLQINSTELEDSALYFCASSQ
Ceratotherium simum simum V761 trbv AKZM01025500.1 116153 RVDAKVTQTPGHLVKGKVQKARMECIPKKGHTFVSWYQQIQKKEFMFLIYFQNEKFPDQIELVKERFSAQCPKNSPCSLVMQSSGPGDSALYFCASSQ
Ceratotherium simum simum V762 trbv AKZM01025500.1 108708 SMDTGVTQTPRNRITKTGKRVVLECSQTKSHDRMYWYRQDPGLGLRLIYYSYDVKDTNKGEVFYGYSVSRKEQVKFSLSLETAAPNQTALYFCASSY
Ceratotherium simum simum V763 trbv AKZM01025500.1 102130 LMDADVSQTPKHCIAGTGKKITLECSQTMNHDNMYWYRQDAGRELQLLHYSYGVNTTEKEEFSSGSTVSRLRKEHFPLTLESASPSQTSLYLCASS
Ceratotherium simum simum V764 trbv AKZM01025500.1 78862 LKDAVVTQFPRHRVSGTGKELTLECSQDLSHNSMYWYHQDSGFGLLLIYYSTSTGAIEKGHVPKGYRVSINELKYFPQTLESASTNQTSVYICASSL
Ceratotherium simum simum V765 trbv AKZM01025500.1 60132 PTEAEVTQTPRTLITEMGKKLTLNCSQNMNHDAMYWYRQDPGLGLKLIYYSISVVDSQKGDVSEGYIASREEENFYLTLESASTNQTSLYFCASSE
Ceratotherium simum simum V766 trbv AKZM01025500.1 47472 LMEAEVTQTPRHLITETGKKLTLNCSQNMNHYCMYWYRQDPGLGLKLIYYSTNVETFDKGDVSEGYNVSRKETTKFPLTLESASTNQTSLYFCASSE
Ceratotherium simum simum V767 trbv AKZM01025500.1 35460 FMDATVTQTERYLVKRTGDKVVMECLQNMSHDRMFWYRQDPVLGLRLLHMSYGVDTNEKGDVPEGYHVSRKKKEGFTLILDSASTNQTSVYLCASSL
Ceratotherium simum simum V768 trbv AKZM01025500.1 23362 SVFGALLSQKPSRAICQRGTSMSIQCQADTQLTLMFWYRQLPGQSLILIATANQGSEATYESGFVKDKFPISRPNPTFSILSVNNTSVEDSSFYFCSAG
Ceratotherium simum simum V769 trbv AKZM01025502.1 20950 PVDPGVPQIPRHLIKTRGQQMTMRCSPISGHNSISWYQQALGQGPQFLVQYYDGEENDKRNIPDRFSGQQFSNYSSELNVSILQLMDSPLYLCASSV
Ceratotherium simum simum V770 trbv AKZM01025502.1 17202 PADSGVIQTPRHLIKATGQQVTMRCSPMATHLSVYWYQQAYSQGPKFLFQYYNGKENEKGAIPARFAGQQFLDQSSELNVSILEPTDSALYLCASSL
Ceratotherium simum simum V771 trbv AKZM01025502.1 11808 PVNAGVTQSPNFQVLGTGEKRTLRCTQDMSHDSMYWYRQDLGHGLRLIHYSTSAGFTEKGDVPKGYNVSRPITENFLLELESATHSQTSVYFCASSY
Ceratotherium simum simum V772 trbv AKZM01025502.1 1341 PMDAAITQKPRYHIIQRRQEMILECSQNMNRLSMFWYRQDPRQGPRLIHYSSGVGRTAKGDISEGYSVSRNKTEDFSLTLESASINQTSLYLCASSE
Ceratotherium simum simum V773 trbv AKZM01025503.1 126089 PVDSGVTQTPRHLIKARRQQVTMRCSPSSGHTRVFWYQQTLNQSPQFLFQYYEGEENDKGNISDRFSGQQFSNYSSELNVSILEVADSALYLCASSV
Ceratotherium simum simum V774 trbv AKZM01025503.1 117440 PVNAGVTQSPNFQVLGTGENTTLRCAQDMSHNYMYWYRQDLGHGLRLIHYSTRAGFTENGDIPEGYNASRPNTDNFLLELESATPSQTSVYFCASSY
Ceratotherium simum simum V775 trbv AKZM01025503.1 84069 HVDSSAGITQSPHKITGTGKRVTLTCHQTQNHDYMYWYRQDLGHGLRLLHYSRAAGFTEKGDVPDGHNVSRTNTENFSLMLESATPSQTSVYFCASSY
Ceratotherium simum simum V776 trbv AKZM01025503.1 61126 HTSAGVTQFPSHRVIEKERAVTLRCDPISGHEGLYWYRRAVGKEIKFLVYFLRESKRDESGMPKDRFSAERTEGTYSTLKIQPAELDDSGVYFCASSQ
Ceratotherium simum simum V777 trbv AKZM01025503.1 59238 YMSAMVTQNPRYQVTREGKPVTLSCSQNLNHDTMYWYQQKLSQAPKLLFYYYAQKIYNETDTSDNFQPRWFNTSFCSLGIRSPGLRDSAVYLCASSM
Ceratotherium simum simum V778 trbv AKZM01025503.1 54633 TLDAEVTQTPGHLVKGKGQEVKMYCAPKEGHSYVFWYQHIQGKEFKFLIAFQNKNIWDETQMPKERFSAKCPPNSPCSLEIQRTELQDSAMYLCASSE
Ceratotherium simum simum V779 trbv AKZM01025503.1 36950 GSVLGALVSQHPSMALCKNGTSMKIECRAMGFEAQTVCWYRQLPKQGLTLIATSNQGFDPTYEQSFRQEKFPISHPNRTYSSLKVKSAHPTDSGLYFCGAS
Ceratotherium simum simum V780 trbv AKZM01025503.1 24854 GSGLGALVSQHPSRAVCKNGTSMKIECHAMGFQAQTVFWYRQLPKQGLTLIVTSNRGSTPTYEQDFGEKKFLINHSSLTFSTLTVESARPADSSLYFCAAS
Ceratotherium simum simum V781 trbv AKZM01025503.1 5737 PLDTAVSQTPKYLVTRVGNKMSLKCEQNLSHNAMYWYKQDSKQLLKIMFSYSNKEVIVNETIPIRFSPESPDNAHLNLHVDSLEPGDSAVYFCASSK
Ceratotherium simum simum V782 trbv AKZM01025503.1 1537 LPMDTGITQSPKHLVMGMRNKKSLKCGQHLGHNAMYWYKQSAQKPLELMFVYNYKKLTENESVPSRFSPECPDDSLLYLHMDALEPEDSAVYFCASSK
Ceratotherium simum simum V783 trbv AKZM01025504.1 23933 TMDGGITQSPKYLLREERRDVTLECEQNLDYNAMYWYRQDPGQGLRLIYYSQFVNNTQKGDISEGYSASREKKAFFPLSVTLTRKNQTALYLCASSR
Ceratotherium simum simum V784 trbv AKZM01025504.1 18077 GSVLGALVSQHPSRALCKNGTSVEIKCRAMDFQAQTVFWYRQLPKQGLTLIATSDQGSLPTYEQGFSKDKFPISHPDRTFSTLTVTGAHPADSSFYICGAS
Ceratotherium simum simum V785 trbv AKZM01025504.1 3101 PLDTAVSQTPKYLVTWVGNKMSLKCEQNLGHDAMYWYKQDSKQSLKIMFTYNYKELIVNETVPSRFSPESPDKAHLNLHVDSLEPGDSAVYFCASSQ
Ceratotherium simum simum V786 trbv AKZM01025505.1 12163 HTSAGVIQFPSHTVIEKEQAVTLRCDPISGHEGLYWYRRVVGKEIKFLVYFLRESKQDESEMPKDRFSAERTEGTYSTLKIQPAELEDSGVYFCASSQ
Ceratotherium simum simum V787 trbv AKZM01025505.1 10304 HLSAMLIQNPRYQITRKGKAVTLSCSQNLNHDTMYWYQQKLSQAPKLLFYYYDQEFYNETDTSDNFHPSRPNTSFCSLGIRSPGLRDSAVYLCASSM
Ceratotherium simum simum V788 trbv AKZM01025505.1 5813 ALDAEVTQTPGHLVKGKGQTGKMYCVPKEGHRYVFWYQHIQAKEVKFLIAFQNEDIYGETEMPKERFSAKCPQNSPCSLEIQPTELQDSAVYLCASSE
Ceratotherium simum simum V789 trbv AKZM01025507.1 9868 SVDAGVIQSPRHLIKGRRGKAVLKCYPSSGHRSIRWFQQPLGQSPQFLIEYYEKEQGDKGNIPDRFSAQQFSDYSSELDMSSLELEDSALYLCASSS
Ceratotherium simum simum V790 trbv AKZM01025508.1 857 PTDSGVTQTPRHLMKARGQQVTLRCSPSSGHKNIFWYQQALGKGPEFLIQYYDGKENEKGGISHRFSGQQFTNHSSELNVSSLELTDSALYLCASSV
Ceratotherium simum simum V791 trbv AKZM01025513.1 557 PLDSAVSQTPKYLIIRVGNKMSLKCEQNLGHNAMYWYKQDSKKLLKVMFTYSNTDIIVNETVPSRFFPESPDKAHLNLHVDSLEPGDSAVYFCASSQ
Ceratotherium simum simum V792 trbv AKZM01025517.1 16625 HTGAGVSQSPRHRVTERGQAVSPGCDPISDHAPLYWYRQTLDQGLEFLIHFFNKNATDMSGMPYDWFSAERCKCSSSTLKIQPMEQGNSALYLCASYSAIAWH
Ceratotherium simum simum V793 trbv AKZM01025517.1 3067 PMDSGITQNPKHLVMGMRNKKCLQCDQHLGYDYMYWYKQSAQKPLGLMFVYSYKKLAASVPSRFLPECPDSSLLYLHMDDLEPEDSAVYFCTSSK
Ceratotherium simum simum V794 trbv AKZM01025517.1 1573 HTEPEVRQTPSHQVTEIGQEVILSCDPISGHLYLYWYRQILGQKVEFLISFYNQKFSEKSEILKDRFSAERPDGSFSTLKIQLTELGDSAVYLCASSV
Ceratotherium simum simum V795 trbv AKZM01025518.1 27281 PMDSGVIQIPRQLTKARGQQATLSCSPSSEHDTVSWYKQALGQGPQFLVQYYNEEERQKGDISGRFLGRQFPDRSSELNVSVLELTDSALYLCASSL
Ceratotherium simum simum V796 trbv AKZM01025518.1 22874 PVNAGVTQTPKFQVLGKGQNTTLRCAQDMSHDSMYWYRLDLGHGLRLIHYSARAGSNAKGDVLEGYGVSRPNTENFLLMLKSTTPSQTSLYFCASSY
Ceratotherium simum simum V860 ighv AKZM01033308.1 49163 AAGGVWGRLGAAWGSLRLSCAASGLTLSSSGTIWVRQAPGKGLECVSYISSIVGSTYYADSVKGRFTISRDNSKNTLNLQMNSLRTEDMAVYYCAS
Ceratotherium simum simum V861 ighv AKZM01033309.1 49219 VLSQVQLQESGPGLVKPSQTLSLTCTVSGSSITSSSYGWSWIRQPKGKGLEYVGSISYGDSTYYNPSLKSRTSISGDTSKNQFSLQLRSVTTEDTAVYYCAR
Ceratotherium simum simum V862 ighv AKZM01033309.1 44638 VQCEVQLVESGGGLVKPGGSLRLSCVASGFTFDDYAMSWVCQAPGKGLEWVSSIISVFDSTNYADSVKGRFTISTDDSKNTLNLQMNSLRTEDTAVYYCAT
Ceratotherium simum simum V863 ighv AKZM01033310.1 14016 VLSQVQLQESGPGLVKPSQTLSLTCAVSGSSITTCYHYWIWVRQPPGKSLEYMGHIYSNGNTNYKPSLTTWISISIGTSKNQFSLQLNLVTAEDTVLYYCA
Ceratotherium simum simum V864 ighv AKZM01033311.1 55605 VLSQVQLQELGPGLVKPSQTLSLTCTVSGFSLTSYYVGWIRQAPGKGLEWVGVTRGSGSIYYNPTLKSRLSITRDTSKSQVYLTLRSLTGDDTAVYYCAR
Ceratotherium simum simum V866 ighv AKZM01033311.1 4157 VLSQVQLQESGPGLVKPSQTLSLTCAVTGDSISSGYGWSWIRQPPGKGLEWLGAGCYYSSSWNTNYSPSFKGRISITADTSKNQFSLQLSSVTTQDTAVYYCAR
Ceratotherium simum simum V867 ighv AKZM01033312.1 79290 ALSQAELQESGPTLVKTSQTFSLTCTVSGSSITTSDYYYDWIHESPGKELEWIGHISYSGSTTYNPSLKSRISISRDTSKNQFSLQLSSATTEDTGLYYCA
Ceratotherium simum simum V868 ighv AKZM01033312.1 75438 VQCEMQFVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKWLELVSDIGSSGSCTYYADSVQGQFTISRDNSKNTVNLQMNSLRTKDRSVYYCAT
Ceratotherium simum simum V869 ighv AKZM01033312.1 13129 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSASMSWVRQAPGKGPQWVSYINKDGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCTI
Ceratotherium simum simum V870 ighv AKZM01033315.1 177115 VQCEVQLVESGGGLVKPGGSLRLSCVASGFTYSSYYMYWVRQAPGKGLEWVSNIYSDGSNTNYADSVKGRFTISIDSSKSTLYLQMNSLRTEDTAVYYCAT
Ceratotherium simum simum V871 ighv AKZM01033315.1 155609 PAGGVWGRLGAAWGSLRLSCVSSGFTFSSYAASWVRQAPGKGPQWVSYINIDGSSTYYADSVKGRFTISRDKSKNTLYLQTNSLRTENTAVYYCAI
Ceratotherium simum simum V872 ighv AKZM01033315.1 126648 VLSQVQLQESGPGLVKPSQTLSLTCAVSGGSVTDSYYWSWIRQRPGEGLEWMGYWSGSPSYNSAFQSHISITADTSKNQFSLQLSSVTTEDTAVYYCAR
Ceratotherium simum simum V873 ighv AKZM01033315.1 87252 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTFSSYAMNWVHQSPGKGPQWVSGIIYDGSSTYYADSVKGRFIISRDNSKNTLYLQINSLRTEDTAVYYCAI
Ceratotherium simum simum V874 ighv AKZM01033315.1 55411 VLSDLTLQESGPGLVKPSQTLSLTCTVSGVSITTSSYYWNWIRQLPGKSLEYIGFISYIGSAYYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAG
Ceratotherium simum simum V875 ighv AKZM01033315.1 50814 AAGGVWGRCSLGGSLRLSCAASGFTFSSYGMSWVCQAPGKGLDWVSSIYCDGSSTYYADSVRGRFTISRDNCKNMLYLQINILRTKDTAVYYCAT
Ceratotherium simum simum V876 ighv AKZM01033315.1 39112 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSYSDWSWIRQPPGKGLEYMGGINYNGNTYYNPSLKSRTTISRDTSKNQFSLQLSSVTAEDTALYYCAG
Ceratotherium simum simum V877 ighv AKZM01033315.1 28426 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYNVGWIRQAPGKGLEFIDVIWNSGSTYYSPTLKSRLSITRDTSKSRVYLTLSSVTGDDTAVYYCAR
Ceratotherium simum simum V878 ighv AKZM01033315.1 20034 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSITSSYYGWSWIRQPPGKGLEWIGVISYSGSTSYNPSLKSRTSISRDTSKNQLSLQLNSVTTDDTAVYYCAG
Ceratotherium simum simum V879 ighv AKZM01033315.1 12372 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMYWVRQSPGKGLEWVSVINYDGSSTYYADSMKGRFTISRDNSKNTLNLQMNSLRTEDTAVYYCAT
Ceratotherium simum simum V880 ighv AKZM01033316.1 137091 IWSWAGESHPAPYTDLLLLWVLTDHFWCGCRLDLSTGKALEWLSNSDWEDDKCYNPSLKSWLTVSKDTSKNQVVLTMTSVDPADTATYYCARG
Ceratotherium simum simum V881 ighv AKZM01033316.1 78571 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSIDWVRQAPGKGLEWVSSINKDGSSTYYADSVKGRFTASRDNSKNTLYLQMNSLRTEDMAVYYCAT
Ceratotherium simum simum V882 ighv AKZM01033316.1 55246 VLSQVQLQESGPGLVKPSQTLSLTCIASGFSLTSYNVGWIRQAPGKGLEFIGVIWRSGSTYYNPTLKSRLSITRDTSKSQVYLTLNSVTGDDTAVYYCAR
Ceratotherium simum simum V883 ighv AKZM01033316.1 14186 AAGGVWGRLGEAWGVSLRLSCAASGFTFSSYAMSWLRQAPGKGLEWVSVINYEGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRTEYTAVYYCAT
Ceratotherium simum simum V906 igkv AKZM01036054.1 71107 SSGDIVMTQSPLSLPVTPRVPASISCRSSQSLLRRDGYTYLDWYLQKPGQPPQLLIYEVSKRVSGVSDRFSGSGSEKDFTLNISRVEAEDVGVYYCMQG
Ceratotherium simum simum V907 igkv AKZM01036054.1 33004 VCGDIVMTQTPGSLAASVGDTVTINCKSSQSLLYSSNQKNYLSWHQQKPGQAPKLLIYFASTRGTGVPDRFTGSGSGTDFTLTISRFQAEDAAVYYCQQYISTP
Ceratotherium simum simum V1034 iglv AKZM01051483.1 9948 SQPALAQPESLLVFPGQVAQLSCTISPRHPIGDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPSDIPDRFSAAADTAHNTCILTISPVQPEDDADYYCSVG
Ceratotherium simum simum V1044 iglv AKZM01053883.1 6851 SRAQSSLSQPSSASGTLGQSVTISCTGSSSDIGKYNYVSWFQQLPGTAPKLLIYNVNSRASGIPARFSGSKSGNTASLTISGLQAEDEADYYCS
Ceratotherium simum simum V1045 iglv AKZM01053884.1 7232 SWAQSALTQPSSASGALGQSVTISCSGSSSDIGGYNYIYWYQQHPGTAPKLLIYNVNSRASGIPARFSGSKSGNTASLTISGLQAEDEGDYYCSSYVGS
Ceratotherium simum simum V1046 iglv AKZM01053885.1 27339 SWAQSAPTQPPSASGTLGQTVTISCTGSSSSYFSWYQQHPGSAPKLLIYAVSSRASGIPDRFSGSKSGNTATLTISGLQAEDEADYYCSSYTGS
Ceratotherium simum simum V1047 ighv AKZM01054578.1 4982 VLSQVQLQELGPGLVKPSQTLSLTCTVSGFSLTSYYVGWIRQAPGKGLEWVGVTRGSGSIYYNPTLKSRLSITRDTSKSQVYLTLRSLTGDDTAVYYCAR