WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Jaculus jaculus AKZC00000000.1 (AKZC01) 84 9 1 42 12 20 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Jaculus jaculus V235 igkv AKZC01155968.1 2097 GRGDIVMTQSPGSLAVSSGERTSLSCKSSQSLLSGSYNYLAWYQQKPRQAPKLLIYGASTRASGVPDRFSGSGSGTDFTLTISNVQAEDAADYYCQQSYSAP
Jaculus jaculus V236 igkv AKZC01155969.1 11599 LRGQIVLTQSGSPLPASPGETVSITCRASQSLLFSDGKHYLSWYQQGPGQTFRALLYHASTRRDGVPARFSGSGSGSEFTLTIAEVEPQDFQTYYCLQTLKSP
Jaculus jaculus V238 trbv AKZC01156153.1 105 LHGSSALQQAPRSTEVLTNQSVVMSCETSLQSASSIYWLRQRRAPSKDGRYEFLASWSPSKGTTHGSGVTEENLTAFCYLTRCSLNLTSVKPADSGTYFCV
Jaculus jaculus V246 trbv AKZC01165486.1 4631 VHAQTIHQWPAAQVQPVGSPLSLHCTMKGQSNPNLYWYRQVAGGALQQLFYSIAAGQVGSLEPQNLSASRPQDGQFILSSKKLLLSDSGLYLCAWS
Jaculus jaculus V261 trav AKZC01175972.1 8595 RSNGVSVTQTKGLVTLSEGSSVILNCTYHSTDSSPSLFWYVQYLNKAPQLLLKSATENQKQENQGFEATLMKKNSSFNLHKTSLQLSDSAVYYCAVR
Jaculus jaculus V262 trav AKZC01175973.1 11696 ESSGVSLTQTEGQVTLPERASLTLNCSYETKWYPALLWYVQYPGEGPSLLFRVSKASDTGRNKGFEATYDEENTSFHLQKASVQESDSAVYYCAMG
Jaculus jaculus V263 trav AKZC01175978.1 12825 HVQAQAVTQPDLHVIVSEGASLELRCNYSYGGAFSLFWYIQYPTHGLQPLLRHFGSGDPLVQGMRGFEAEFKKSESSFHLKKSCAQGSDSAVYFCALS
Jaculus jaculus V264 trav AKZC01175990.1 3461 GSNGNSVTQTEGQVTLPERTSLTLNCSYETAGYPTLFWYVQYPDEILQLLFKVSKASDTGKNKGFKATYDEENTSFHLQKASVQESDSAVYYCAMG
Jaculus jaculus V265 trav AKZC01175995.1 1373 VSRGEKVEQHPPTLNVQEGDRIVINCTYSDSASSYFPWYKQEAGKGPQLIIDIRGNLKRKQKQRLITLLDKEAKQFSLHITATQPGDSAVYFCAAN
Jaculus jaculus V266 trav AKZC01175995.1 17279 RSNGDSVTQTEGLVTFSEGVSVILSCTYHTTYSSPSLFWYVQYLNKAPQLLLKSATENQKQENQGFEATLMKKNSSFHLHKSSLQLSDSAVYYCAVR
Jaculus jaculus V267 trav AKZC01175999.1 9272 VKGQQVKQSPESLILQERDSSVLYCNFSMAVNNVKWFYQNPGGRLISLFYNPSGTKQSGRLKSTTVSKERHSSLYISSSQTTDSGTYFCAVDSQ
Jaculus jaculus V268 trav AKZC01176001.1 8120 VSGQQKEQVNQSPPSLTVPEGTTSILNCTYENSAFDYFPWYRQFPGEAPALLVAIRSVVNQKEDGRFTIFFSKHDKQLSLLITASQPGDSATYFCAAS
Jaculus jaculus V269 trav AKZC01176001.1 13191 DTRAQSVTQPDTYITVLEGDSMELKCSYSYGEVPYIFWYVQYSSHDLQLLLRYLSGDVLVHSMRGFEAEFKSDSSFHLRKSCAQGSDSAVYFCALS
Jaculus jaculus V270 trav AKZC01176003.1 39325 KTHGDSLTQTEGQVTLSERLFLTINCTYSASGYPTLFWYVQYPGEGMRLLLKAMTAGTKEHNKGFEATYDKETTSFHLKKTSVQVSDTAVYYCALS
Jaculus jaculus V271 trav AKZC01176003.1 47012 VSSQQKVEQHSKSLLFPEGATASLNCTYSDSTFQNFVWYRQYSGKGPELLVSIYSTGDKEEGRYMAQLNKFSNYVSLHIRGSRPSDSAVYLCAVS
Jaculus jaculus V428 trav AKZC01256607.1 24279 THTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIFNPAMGVSVLAPYRERVEFLRPSFIDGTIRLSHLELEDEGVYICEF
Jaculus jaculus V500 iglv AKZC01294582.1 8112 GASQPTLHQPATASSSLGSTIHLICTLSSDHDINMYNIYWYQQRPGHPPRFLLRYFSHSDEHHGPGISPRFSGSKNMARNQGYLRISELQPEDEAVYYCAMGV
Jaculus jaculus V513 igkv AKZC01303771.1 5256 ARCDIQMTQTPSSLSASQGERVTMNCQASQYIGSWLHWYQQKPGQAPKLLIYKASNLAEGVPSRFSGVGSGTQYSLTIRSLEPEDAATYYCQQGYE
Jaculus jaculus V515 ighv AKZC01307099.1 9992 ICCEEQLVESGGCLVQPGGSLRIFCAASGFTFSSYWMSWVRQAPGKGLEWVARIRYDGGSTYDPDSAKGRFTISRDNSRNTLYLKMSNLRVEDTAMYYCAG
Jaculus jaculus V527 igkv AKZC01310490.1 14798 MRCDIQMTQTPPFMSVSLGDRVTINCQASENIYRYLAWYQQKPGAAPKLLIYGASSLEDGVPSRFSGSGSGTQYSFTISSLDPEDVATYYCQQGYKF
Jaculus jaculus V528 igkv AKZC01310492.1 6738 VRCDIQMTQTPQFLSVSQGDTVTINCLASENIYSSLAWYQQKPRAAPKLLIYGASSLVDGVPSRFSGSGSGTDFTLTISSLEPEDDADYYCQQGWSYP
Jaculus jaculus V529 igkv AKZC01310508.1 3309 AKCDIQMTQPPSLSASLGDRVTITCRASQDISKYLNWYQQKSGESPKLLIYYTSRLQSGVPSRFSGSGSGAEYSLTISSLETEDVATYHCQHGYGFP
Jaculus jaculus V530 igkv AKZC01310518.1 974 ARCDMQLNQSPSSLSASLGDRVTITCQTNQNIGNSLHWFQQKSGTSPRLLISWATNLQSGVPSRFSATRSGIDFTLTISSLESEDVATYYCQQSSSLP
Jaculus jaculus V531 igkv AKZC01310519.1 4673 SSGDVVMTQTPLVLPVSLGESTSISCKASKSLLYKDEKTYLFWYLQRPGQSPKCLIYLVSNRASGVPDRFSGSGSGTDFTLKIRTVEAEDAGVYYCMQFVEYP
Jaculus jaculus V532 igkv AKZC01310519.1 15070 SRCDIQMTQTPSFLSASLGDRVTITCKSSKGISNYLNWYQQKPGESPKLLIYYASSLHTGVPSRFSGSGSGAQYSLTISNLESEDAAIYYCQQYYEDP
Jaculus jaculus V533 igkv AKZC01310536.1 6870 ARCDIQMTQPPSLSASLGDRVTITCRASQDISNYLNWYQQKPGESPKLLIYYTSRLQSGVPSRFSGSGSGAEYSLTISSLELEDVATYYCQQYNSYP
Jaculus jaculus V534 igkv AKZC01310578.1 14683 STGEIVLTQSPASIAASRGERVAMSCTASSSVSYIHWYQQKPGASPKLLVYRTSNLASGVPARFSGSGSGTSYSLTISNMEPEDAATYYCQQWAST
Jaculus jaculus V535 igkv AKZC01310585.1 2689 DTRCDVQITQTPPALSAYQGSSVTITCQSNKDLSDWLAWYQQKPGKAPKPLIYYTYNLQAGVPPRFSGSVSGTQYSLTISSLKPEDAATYYCQQGYEDP
Jaculus jaculus V547 igkv AKZC01316949.1 7131 LICDIHMTQTPSSLIASRGDRATINCQASENIYSSLSWYQQKPGAAPKLLIYGTSSLEDGVPSRFSGSGSGTQYSLTISSLEPEDAATYYCQQGIKY
Jaculus jaculus V548 igkv AKZC01317582.1 85 SSGEIVLTQSPASMAVSQGERVTISCRASESISYMHWYQQKSGASPKLLVYLTSNLASGVPPRFGGSGSGTSYSLTISGMEPEDAAIYFCQQGSSI
Jaculus jaculus V762 igkv AKZC01155954.1 1269 MRCDIQMTQSPASLSASLGESVSMTCRASQGISSWLAWYQQKPGNSPKLLIYAASNLQSGIPSRFRGSGSGTEFTLTISSLQSEDFATYYCQQHNSYP
Jaculus jaculus V763 igkv AKZC01155961.1 7874 GFVTTQSPVFLSFSPGETAILTCRTIQSLGSYLPWYQQKAEQVPRILIHGASTRSTDVSALFSGRRSGVDFTLINSLEPEDAAVYYCQPYQSCS
Jaculus jaculus V764 igkv AKZC01155963.1 519 SSGDIVLTQSPASLAVSPGERATISCRASQSVSIFGNNLIHWYQQKPGQPPKLLIYGASNLESGIPARFSGSGSGTEFTLTINPVEADDAAHYHCQQSKALP
Jaculus jaculus V777 trbv AKZC01165494.1 13277 HKDAVVTQFPKYKISGMGKAFTLQCSQNVHHFAMFWYRQDPGQGLQLIHYSSGPGKTNKGAVPEGYCVSRNKLNYSPLSLESAAVNQTSVYLCASSL
Jaculus jaculus V779 trbv AKZC01165495.1 35927 SVDTGVIQSPRHLVRGKEQNAKMDCVPIRGHSYVYWYHKKPEKGPELLVFFQDEDIIDKRGMISKRFSARCPSSSPCTMEIQLTEPADSAVYYCASSQ
Jaculus jaculus V780 trbv AKZC01165495.1 23584 YFDAKVIQTPRHLVKGKGQKASMICSPKQGHDTIFWYQQSQNKTMKFLIYFLSGKLMEQIDMVKERFSAECPSNSPCSLEIRSSEQGDSALYFCASRL
Jaculus jaculus V781 trbv AKZC01165495.1 19186 YFDADVIQLPRHLVKGKGQRAKMSCSPAKGHTAVYWYQQSPDKEFRFFIYFLNQDIIEQIDMVKERFSAECPSNSPCSLEIQSSEPGDSALYFCASSE
Jaculus jaculus V782 trbv AKZC01165495.1 16684 YFDANVIQMPRHLVKGKGQRANLSCTPEKGHNAVYWYQQSQDRELTFLIYFQNRKIVNQIDMVRERFSAEWPSESLCTLEIQSSEPGNSALYFCASSQ
Jaculus jaculus V783 trbv AKZC01165495.1 9334 YLDASIVQTPRHLVVGTGQKAKMSCSPEKGHASVFWYQQRQNEGLTFLIYLENQKVINQIDMVKERFAVENPSNSLCSLEIQSSEPGDAALYFCASSE
Jaculus jaculus V784 trbv AKZC01165496.1 1712 TMHGGITQTPKFLCKAERHTVTLECEQDLNHDAMYWYRQDPGQGLRLIYFSQYVKAVQKGDLAEGYSVSREKKPSFPLTVTSPQKSQTAVYLCASSL
Jaculus jaculus V786 trbv AKZC01165497.1 3012 LMNADVTQNPRHLVRGKGQRATLQCSPVKGHSHVYWYQQLPGEGLKFMIYLQKEKVIDNSGMPKKRFSAEFPKEGPNILQVEPAELGDSAVYFCASSL
Jaculus jaculus V787 trbv AKZC01165498.1 13890 LSEAGITQSPRYKIAEERQTAEFRCDPISGHITLYWYQQTQGQGPKLLLYFQYEAVTYDSELPKDRFSAERPKRTYSILKVQPAERGDSAPYLCASSAA
Jaculus jaculus V788 trbv AKZC01165498.1 935 STNVGVTQLPRHQVTEKGQKVALRCEPISGHMSVSWYKQTMAQGLEFMMNFRNQDPIDDSGMPKDRFSATMPDAKLSILSIQPAEPSDSAVYLCASSL
Jaculus jaculus V789 trbv AKZC01165500.1 4552 LAGARVSQSPKHLIKAKGERSNLKCVPISGHSNVIWYQQVTGQGPQFLIQYYEKTVVDKGNMPSRFSAQQFDDYHSEMNMSALELGDSAVYLCASSL
Jaculus jaculus V790 trbv AKZC01165500.1 1606 HTEAAITQSPRHKVTETGGKVTLGCYQSYKHDCMYWYRQDPGHGLRLIHYSYALNSTGKGEVPDGYRVSRSRMEDFPLTLESATRSQTSVYFCASSY
Jaculus jaculus V791 trbv AKZC01165504.1 9105 LVNAGVTQTPKLQVLKVGQRMTIRCSQDMGHDCMYWYRQDPGLRLRLIHYSYAFDSTDKGEVPDGYRVSRSKMEDLPLTLESATRSQTSVYFCASSY
Jaculus jaculus V792 trbv AKZC01165504.1 5522 HTDAGVIQSPMHRVIERGQNATLRCDPISGHTALYWYRQNMGRGLEFLVYFQGEYAADKTGMPNHRFFVEQPKGSFSTLKLQPLEQGDSAVYFCASSS
Jaculus jaculus V793 trbv AKZC01165504.1 2655 LAHAEIIQKPRYCIAVSGKAVTLQCFQFMDHYLMFWYRQDPGQGVRLIHYSGSVRGTGKGAIPEGYSVSRNETQQFSLTLDSASPSQSSLYLCASS
Jaculus jaculus V794 trbv AKZC01165505.1 11097 LAEPRITQTPKYLVTVMGDERTLKCEQYLGHKSMFWFRQSDRRSLEFMFSFGYTKLFENKTSSGRFQPDNPDDSHLNLHIAALEPGDSAVYFCASGQ
Jaculus jaculus V795 trbv AKZC01165505.1 9681 YSGPGVSQIPSHQVTEMGHLVTLSCEPIVGHLYFNWYKQILGQRIEFLVCFYNDKPLQKSELFNDRFSVEKPSGSYFTLKIHPAKPEDSAVYLCASSL
Jaculus jaculus V796 trbv AKZC01165505.1 2260 PSQTAIFQTPKFLVAQVGNKKSLKCEQNLGHNTMYWYKQDSKKSLKILFSYTNQKLILNETVSRRFAPEPSSKANLNLRVQSLELDDTAVYLCASSQ
Jaculus jaculus V885 ighv AKZC01234754.1 2832 VQCEVRLVESGGGLVQPSGSLKLSCEASGFTFSSYGMNWIRQAPEKGLEWVATIWYDGSQQRYANSVKGRFTISRDNSKNMVYLQMNSLKNEDTAMYYCAK
Jaculus jaculus V886 ighv AKZC01234756.1 13707 ILAQVHLQESGPSLVKPTETLSLTCTVSGYSITSGYYWSWIRQPPEKTLEWMGYISYSGGTNYSPSLKSRVTISRDTSKNQFSLHLTSVTTEDTATYYCA
Jaculus jaculus V887 ighv AKZC01234758.1 2200 ILSQVQLQESGPGLLNPSHTLSLTCTVSGFSVTSNNYCWHWIRQFPGKGLEWMAVICYNDYTNYSPSLKSRTSISRDTSANKFSLQLSSVTTEDTAVYYCA
Jaculus jaculus V888 ighv AKZC01234761.1 11758 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLMDYSVSWIRQPVGKGLQWMGVIWYSGSTDYNSALKSRLSISRDTSKDQVFLKMNNMEPEDTAMYYCAR
Jaculus jaculus V889 ighv AKZC01234766.1 2198 VQCEVQLVESGGSLAQPGGSLRISCAASGFTFSDYYMSWIRQTPGKQLEWLSYISGSSGSTNYAASVKGRFTISRDNSRNTLYLQMNSLKLEDTAMYYCAR
Jaculus jaculus V890 ighv AKZC01234767.1 9854 VQCEVYLVESGGSLVQPEGSLRLSCAASGFTFSDYWMSWIRQAPGEGLEWIGEVNPNGGSTNYGTNMKGRFTISRDNSRNTLYLQMSSVRPEDTAMYYCT
Jaculus jaculus V891 ighv AKZC01234778.1 6579 VLSQVQLQENGPGLIKPTQTLSLTCTVSGYSISSGNWWSWIRQHQGKGLEWMGSIYSDGDTRYNPSLKSRLTMTVDTAKNQFSLKLSSVTSGDTAVYYCASE
Jaculus jaculus V892 ighv AKZC01234785.1 1831 VCCEEQLVESGGSLVQPGGSLRISCAASGFTFSSYWMSWVRQAPGKGLEWVAQISNTGGSTYYPDSVKGRFTISRDNSRNTLYLQMSNLRVEDTAMYYCAR
Jaculus jaculus V1000 igkv AKZC01310498.1 2105 ARCDIQMTQPPSLSASLGDRVTITCRASQDISKYLNWYQEKPGESPKLLIYYTSKLQSGVPSRFSGSGSGAEYSLTISSLKSEDVATYYCQQGYSGF
Jaculus jaculus V1001 igkv AKZC01310504.1 1059 AKCDIQMTQPPSLSASLGDRVTITCRASQDISKNLHWYQQKPGQSPKPLIYYTSRLQSGVPSRFSGSGSGAEYSLTISSLETDDAATYHCQHGYGFP
Jaculus jaculus V1002 igkv AKZC01310510.1 11356 SRCDIQMSQTPSFLSASLGDRVTISCRASQDIDNYLSWYQKKPGESPKLLIYYTSNLETGVPSRFSGSGSGAEYSLTISNLESEDAATYYCLQYDEYP
Jaculus jaculus V1003 igkv AKZC01310512.1 16134 SRCDIQMTQTPSFLPASLGERVSISCRASQDISKYLSWYQQKPGESPKLLIYCTSNLETGVPSRFSGSGSGAEYSLTISNLESEDAATYFCLQYDETPY
Jaculus jaculus V1004 igkv AKZC01310545.1 3270 VRCDIRMTQTPPSLTASQGDTVTITCQASESIVTALAWYQQKPGAAPMLLIYGASSLVDGVPSRFSGRGSGTDFTLTISSLEPEDDADYYCQQGWSYP
Jaculus jaculus V1005 igkv AKZC01310546.1 5669 VRCDIQMTQTPPSLTASQGDTVTITCQASESIGTALAWYQQKPGAAPKLLIYDASSLVDGVPPRFSGRGSGTDFTLTISSLEPEDDADYYCQQSWYYP
Jaculus jaculus V1006 igkv AKZC01310547.1 8117 VSCVYEMTQSPSSLSAYLGDRVTMTCQASQGIHTWVAWYQQKAGESPKLLVYGASNLQPGIPSRFIGSGSERDFTLTISSLEPEDTATYYCAQYSIGY
Jaculus jaculus V1007 igkv AKZC01310548.1 1068 VKCDIQMTQSPSSLSTSLRERVTITCHASQGISDYLAWYQQRPGESPKLLIYEASSLQPGVPSRFSGSGSGTDFTLTISSLEPEDIATYYCQQYNNWP
Jaculus jaculus V1008 igkv AKZC01310554.1 3806 SIGDVVMTQTPLSLPVTAGEPASISCRSSQSLLHSNGNTYLDWYLQRPGQSPRLLIYKVSNRYSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCFQG
Jaculus jaculus V1009 igkv AKZC01310569.1 2119 VRCDIQMIQTPSSLSASLGDRVTVNCRASENIYNALSWYQQKPGAAPKLLIYSTSSLAGGVPSRFSGSGSGTQYSLTISSLKSEDAAIYYCQQRKKFP
Jaculus jaculus V1010 igkv AKZC01310573.1 33317 SIGDVVVTQTPLSLSVTAGEPASISCRSSQSLLHSDGNTYLSWYLQRPGQSPRLLIYKVSTRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCGQGLYLP
Jaculus jaculus V1011 igkv AKZC01310573.1 9749 CRGQIILTQSPETLAVSRGVFVSITCQSSMELGTSMAWYQQKPMEAPRLLLFGASARAAGTPYRFRGTGSGLDFSLSIHGVEDEDTGVYYCQ
Jaculus jaculus V1012 igkv AKZC01310573.1 2860 ARCDIQLTQSPSFLSAYLGDRVTITCQASEDISISLNWYQQKPGEAPKILIYSATELANGVPSKFSGDGHETDFTLSINNVVPEDAATYYCQQRY
Jaculus jaculus V1013 igkv AKZC01310574.1 19990 SIGDVVMTQTPLSLSVTPGEPASISCRSSQSLLYSDGYTYLHWYLQRPGQSPRLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCSQD
Jaculus jaculus V1014 igkv AKZC01310578.1 10020 TRESAVLTQSPASISASLGDTISITCRASESISDYLTWYQQKSGQPPKILIYDADNQYSGVSDRFTGIQDGTEFVFKISKVTVDDAASYYCQQDYSVP
Jaculus jaculus V1015 igkv AKZC01310586.1 19325 SSEEVVLTQSPASLAASQGERVTISCTASSSVSTTYLHWYQQKPGASPKLLIYGTSYLASGVPTRFSGSGSWTSLSLTISGMEPEDAATYYCQQWHRDP
Jaculus jaculus V1016 igkv AKZC01310587.1 4999 SRGDIVMTQSPDVLPVTPGERATISCRASQGIGTYLYWYQQKPNQAPKLLIKYASQSIPGVPSRFSGSGSGTDFTLTISGVEPEDAATYYCQQGYTP
Jaculus jaculus V1017 igkv AKZC01310590.1 572 SRSDIVLTQSPAVLPVTPGERATISCRASQGINKNLHWYQQKPNQAPKLLIKYASDSIPGVPSRFSGSGSGTDFTLTISSVEAEDAATYYCQQYYNFP
Jaculus jaculus V1018 igkv AKZC01310592.1 3564 CTGDIVLTQSPAVLPVTPGQRVSISCKASEGISTSLHWYQQKPNQAPKLLIKYASGSIPGVPSRFSGSGSGTDFTFIISSLEPEDVADYYCQQSWSYP
Jaculus jaculus V1019 igkv AKZC01310593.1 6889 TRGDIVLTQSPAVLPVTPGERATISCRASQGISTSLHWYQQKPNQALKLLIKYASDSMSGVPSRFSGSGSGADFTLTISSLEPEDAAIYYCQQSYSYP
Jaculus jaculus V1020 igkv AKZC01310610.1 1055 MRCDIQMTQSPASLSASLGESVSMTCRASQGISSWLAWYQQKPGNSPKLLIYRASTLVSGIPARFSGSGSGTEFTLTISSLQSEDLATYYCQQHDSYP
Jaculus jaculus V1026 igkv AKZC01315506.1 537 STGDVVMTQTPLSLSVTAGEPASISCRSSQSLLYSDGYTYLSWYLQRPGQSPRLLIYEVSNRDSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCSQSTKYP
Jaculus jaculus V1027 igkv AKZC01315519.1 662 VRCDIHMTQTPSSLSASLGERVTINCLASEDIYNALAWYQQKPGASPKLLIYAASSLEDGVPSRFSGSGSGAQYSLTISSLEPEDVGSYFCQQYSEYP
Jaculus jaculus V1028 igkv AKZC01315522.1 666 VRCDIHMTQTPSSLSASRGDRVTINCQASEDIDNALAWYQQKPGASPKLLIYATSSLEDGVPSRFSGSGSGTQYSLTISSLEPEDVGSYFCQQYRNYP
Jaculus jaculus V1032 igkv AKZC01319955.1 945 SIGDVVMTQTPLTLPVTPGEPASISCRSSQSLLHSNGYTYLHWYLQRPDQSPRLLIYGVSNRFSGVPDRFIGSGSGTDFTLKISRVEPEDIGVYYCLQTIHYP