WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Oryctolagus cuniculus AAGW00000000.2 (AAGW02) 279 97 19 41 51 58 9 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Oryctolagus cuniculus V61 igkv AAGW02007316.1 11602 ARCANVVMTQTPASVSEPVGGTVTIKCQASQSISNALAWYQQKPGQPPKLLIYSASKLASGVPSRFKGSGSGTEYTLTISGVQCDDAATYYCQ
Oryctolagus cuniculus V62 igkv AAGW02007317.1 9138 ARCADVVMTQTPASVEAAVGGTVTIKCQASESIGNALAWYQQKPGQRPKLLIYAASNLASGVPSRFSGSGSGTEYTLTISGVQCDDAATYYCQNYYGSRAG
Oryctolagus cuniculus V63 igkv AAGW02007318.1 34796 ATFAQVLTQTPSSVSEPVGGTVTINCQASENIYSSLAWYQQKPGQPPKLLIYDASDLASGVPSRFSGSGSGTEFTLTISGVQCDDAATYYCQSYYYSSVT
Oryctolagus cuniculus V64 igkv AAGW02007319.1 43917 VPMMTQTASPVSAAVGGTVTINCQASQSISSSYLAWYQQKPGQPPKLLIYYASTLASGVPSRFKGSGSGTEFTLTISGVQCDDAATYYCQGRL
Oryctolagus cuniculus V65 igkv AAGW02007319.1 54973 ARCAIDMTQTPSSVSAAVGGTITINCQASESISSWLAWYQQKPGQPPKLLIYEASKLASAVPSRFSGSRSGTEFTLTISGVQCDDAATYYCQGGYYNSGW
Oryctolagus cuniculus V66 igkv AAGW02007319.1 63734 ARCAYDMTQTPSSVSAAVGGTVTIKCQASQSISNQLSWYQQKPGQPPKLLIYWASTLASGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCQSIYSSSAG
Oryctolagus cuniculus V67 igkv AAGW02007319.1 72454 ARCADVVMTQTPSPVSAAVGGTVTINCQASQSIGSDLSWFQQKPGQPPKLLIYSASKLATGVPSRFKGSGSGKQFTLTISGVQCDDAATYYCQ
Oryctolagus cuniculus V68 igkv AAGW02007319.1 77403 ATFAQVLTQTASPVSAAVGGTVTIKCQASQSVYSNNYLSWFQQKPGQPPKQLIYDASTLASGVPSRFKGSGSGKQFTLTISGVQCDDAATYYCQ
Oryctolagus cuniculus V69 igkv AAGW02007319.1 81020 ARCALVLTQTPSSVSAAVGGTVTINCQASQSVYGNNELAWFQQKPGQPPKLLIYSASKLASGVPSRFKGSGSWTQFTLTISGVQCDDAATYYCQ
Oryctolagus cuniculus V70 igkv AAGW02007319.1 116781 VTFAQVLTQTPSPVSAAVGGTVTINCQSSQSVYNNNNLAWYQQKPGQPPKLLIYRASTLASGVPSRFKGSGSGTQFTLTISGVQCEDAATYYCAGGYYCSSADC
Oryctolagus cuniculus V71 igkv AAGW02007319.1 144457 AICDPVMTQTPSSTSAAVGGTVTINCQSSQNVYSNNYLSWFQQKPGQPPKLLIYLASTLASGVPSRFSGSGSGTQFTLTISGVQCDDAATYYCAGYYYSGS
Oryctolagus cuniculus V72 igkv AAGW02007319.1 166666 ATFAAVLIQTPSPVSVAVGGKVTINCQSSPSVYSNYLSWFQKKPGQPPKLLIYEASKLASGVPPRFSGSGSGTQFTLTISGVQCDDAATYYCQGEYSSSTE
Oryctolagus cuniculus V73 igkv AAGW02007319.1 173651 ATFAQVLTQTPSPVSAAVGGTVTINCQASQSVYNNRLAWYQQKPGQPPKLLIYSASTLESGVPSLFKGSGSGTQFTLTISGVQCDDAATYYCAGDYSGYI
Oryctolagus cuniculus V74 igkv AAGW02007319.1 181783 VTFAQVLTQTPSPVSAAVGGTVTINCKTSQSVYNNNFLSWYQQKPGQPPKLLIYKASTLESGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCAGEYSSSTD
Oryctolagus cuniculus V75 igkv AAGW02007319.1 189304 ATFAQVLTQTASSVSAAVGGTVTISCQSSQSVYNNNWLGWYQQKPGQPPKLLIYSASTLASGVPSRFKGSGSGTQFTLTISDLECDDAATYYCAGGYSGNI
Oryctolagus cuniculus V76 igkv AAGW02007319.1 197387 ATFAVVLTQTPSPVSAAVGGTVTINCQSSQSVYNNNWLAWYQQKPGQPPKLLIYWASKLATGVPSRFKGSGSGKQFTLTISGVQCEDAATYYCAGGYYCSSADC
Oryctolagus cuniculus V77 igkv AAGW02007319.1 216008 ATFAQVLTQTASPVSAAVGGTVTINCQSSQSVYSNWLSWYQQKPGQPPKLLIYDASTLASGVPSRFSGSGSGTQFTLTISGVQCEDAATYYCQGSYYSSGW
Oryctolagus cuniculus V79 igkv AAGW02007319.1 254375 TTFAQVLTQTPSSVSAAVGGTVSISCQSSQSVYSNYLSWYQQKPGQPPKLLIYYASTLASGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCLGEYGSSTE
Oryctolagus cuniculus V80 igkv AAGW02007319.1 262006 ATFAAVLTQTPSPVSAAVGGTVTISCQASQSVYNNNNLAWYQQKPGQPPKLLIYTASSLASGVPSRFKGSGSGTQFTLTISDLECDDAATYYCAGGYSSSAD
Oryctolagus cuniculus V81 igkv AAGW02007320.1 10021 AKCDPMLTQTASPVSAAVGSTVTISCQASQSVYNNNNLAWFQQKPGQPPKLLIYAASNLASGVPSRFKGSGSGTQFTLTINGVQCDDAATYYCAARYSGNI
Oryctolagus cuniculus V82 igkv AAGW02007321.1 4872 ARCALVMTQTPSPVSAAVGGTVTISCQSSESVYNNNWLSWFQQKPPKLLIYRASTLASGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCAGYKS
Oryctolagus cuniculus V83 igkv AAGW02007321.1 8719 ATFAQVLTQTPSPVSAAVGGTVTISCQSSKSVYSNNCLSWYQQKPGQPPKLLIYRASNLASGVPSRFKGSGSGTQFTLTISEVQCDDAATYYCQGYYSGYI
Oryctolagus cuniculus V84 igkv AAGW02007321.1 12965 ATFAAVLTQTPSPVSAAVGGTVTIKCQSSQSVYNNNELSWYQQKPGQPPKLLIYLASTLASGVPSRFKGSGSGTHCGVQCDNAATYYCQGAYSGAT
Oryctolagus cuniculus V85 igkv AAGW02007321.1 20566 ATFAQVLTQTPSSVSAAVGGTVTINCQSSQSVYSNNYLSWYQQKPGQPPKLLIYDASKLASGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCQ
Oryctolagus cuniculus V86 igkv AAGW02007321.1 42248 ATFAAVLTQTPSPVSAAVGGTVTIKCQSSQSVYNNNLLSWYQQKPGQPPKLLIYDASNLASGVPDRFSGSGSGTQFTLTISGVQCDDAATYYCLGGYDDDAD
Oryctolagus cuniculus V87 igkv AAGW02007323.1 4605 ATFAQAVLTHTPSPVSSSVGGTVTINCQSSQSVNSNNWLSWYQQKPGQPPKLLIYLSSTLASGVPNRFKGSGSGTQFTLTISSVQCDDAATYYCLGGYSSSAD
Oryctolagus cuniculus V88 igkv AAGW02007323.1 9256 ATFAAVLTQTPSPVSAAVGGTVTISCQSSQSVYNNNDLAWYQQKPGQPPKLLIYRASKLASGVPSRFSGSGSGTQFTLTISGVQCDDAATYYCLGGYDDDAD
Oryctolagus cuniculus V89 igkv AAGW02007324.1 3343 VTFAQGPTQTPSSVSAAVGGTVTINCQTSESFYSNNILSWYQQKPGQPPKLLIYDASTLASGVPSRFKGSGSGTQFTLTISDVQCDDAATYYCQGSYHSSGW
Oryctolagus cuniculus V90 igkv AAGW02007326.1 76841 VRCAIVMTQSSSSVSASVGGTVTMSCQASRTVHSSYLSWNQQKPGQPPKLLIYKAPKLQSGVPSWVSSSGSGTEFTLTISGVQPGDAATYYCLDDI
Oryctolagus cuniculus V196 trdv AAGW02024176.1 189656 QGVQCITVTQSPSEQTVASGRETILLCTYDVDFSDPDLYWYRRRPDHSFEFLLYRDDSRSQDADFVQGRFSVKRSQTQKTFHLVISAVRPEDSAVYYCAV
Oryctolagus cuniculus V294 trgv AAGW02035733.1 2783 SQTSSNSEKTMTVVTKPTGSSVTVTCSITQQSSYIHWYRYQEGKAPQRLLYYVVSSTRSIVDSGFDTEKYQAYKSTQGSYNVFLRNLGRDDSGVYYCAVWT
Oryctolagus cuniculus V295 trgv AAGW02035733.1 7001 SQTSSNSEKTMTVVTKPTGSSVTVTCSIPQQSGYIHWYRFQEGKAPQRLLYYDFSISSSIVDSGFSPVKYHAFRGTKICNFVLQNLEESDSGVYYCASAT
Oryctolagus cuniculus V296 trgv AAGW02035733.1 9919 SQTSSNSEKTMTVVTKPTGSSVAVTCSIPQQSGYIHWYRFQEGKAPQRLLYYIVSSSSSIVDSGFDAGKYQASKSTQGSYNVFLRNLGRDDSGVYYCAVWT
Oryctolagus cuniculus V297 trgv AAGW02035733.1 16767 SQTSSNSEKTMTVVTKPTGSSVAVTCSIPQQSGYIHWYRFQEGKAPQRLLYYIVSSSSSIVDSGFDAWKYEASKSTQGSYNVFLRNLGRDDSGVYYCAVWT
Oryctolagus cuniculus V298 trgv AAGW02035733.1 20646 SQTSSNSEKTMTVVTKPTGSSVTVTCSIPQQSGYIHWYRFQEGKAPQRLLYYDFSISSSIVDSGFSPVKYHAFRGTKICNFVLQNLEESDSGVYYCASST
Oryctolagus cuniculus V299 trgv AAGW02035733.1 23809 SQTSSNSEKTMTVVTKPTGSSVTVTCSIPQQSGYIHWYRFQEGKAPQRLLYYDFSRSSSTVDSGFSPGKYHAYEGSGRSYKFVARNLEESDSGVYYCAIWT
Oryctolagus cuniculus V300 trgv AAGW02035733.1 31657 GLGLSKVEQSQISVSAEVQKSVAIFCEVSSSTFESEVIHWYRQKPNQALEHLIQVSSTKTPAHANLGGKRNKVEAEKAPQNSTSILTVNFIEKGDVATYYCAGWV
Oryctolagus cuniculus V301 trgv AAGW02035733.1 35783 GLAQLEQPQISISRARDKSAHISCKASIQNFDNEVIHWYRQKPNEGIQYLMYVWKISTQSNLGGKANKFEASKISSTSIVDLKINFLEKEDEAMYYCAMYRRI
Oryctolagus cuniculus V302 trgv AAGW02035733.1 41061 GDTNVRLTQSHLSFTGKSGRTVQISCKLSGVSLKNVIMHWYQQKEGEPLKRILYGFGKNYKQDMPNSRLEARDNDRGIFYLVINNVIESDEATYYCACWD
Oryctolagus cuniculus V608 iglv AAGW02067712.1 89617 SWASVVFTQPQAVSGSLGETVSISCTRSSGNIGANYVYWYQQHQGHAPSQLIYQYDKRPSGVPDWFSDSKDSASNSASLTIAGLQPEDEADYYCLSGYDNY
Oryctolagus cuniculus V609 iglv AAGW02067712.1 109164 CPDSASCSVGAVGKAVTITCTGGTGNVGRGHPDWYLQLPGRPPSVLIHDGSMRPSGVPDRFTGSVSGNTASLTIAGLQPEDEADYYCAAWDSSLHA
Oryctolagus cuniculus V610 iglv AAGW02067712.1 116472 SLSQPVLTQPPSLSASLGTTARLTCTLSTGYSVGEYPLVWLQQVPGRPPRYLLGYHTDDIKHQGSGVHSRFSGSKDTSENAGVLSISGLQPEDEADYYCAT
Oryctolagus cuniculus V611 iglv AAGW02067712.1 123727 SWAQFVLTQPQSVSGSLGQTVSISCNRDSGNIEDYYVHWYQQHPGKAPTTVIYNDDQRPSGVPDRFSGSIDSTSNSASLTITGLLAEDEADYYCLSSDSSAN
Oryctolagus cuniculus V612 iglv AAGW02067713.1 791 SWAQFVLTQPQSVSGSPGQTVSISCKCDSGNIEEKYVHWYQQHPGGAPTMVIYNDDQRPSGVPDRFSGSIDSASNSASLTITGLLAEDESVYFCQSFDSDAN
Oryctolagus cuniculus V613 iglv AAGW02067713.1 13836 SLSQPVLTQSPSASAALGSSAKLTCTLSSAHKTYYIEWYQQQQGEAPRYLMQLKSDGSYTKGTGVPDRFSGSSSGADRYLIISSVQAEDEADYICGVTGSNVY
Oryctolagus cuniculus V614 iglv AAGW02067713.1 16241 SLSQPVLTQSPSVSAALGASAKLTCTLSSAHKTYTIDWYQQQQGEAPRYLMQLKSDGSYTKGTGVPDRFSGSSSGADRYLIIPSVQADDEADYYCGADYSGGY
Oryctolagus cuniculus V615 iglv AAGW02067715.1 16562 SWAQFVLTQPQSVSGSLGQTVSISCNRDSGNIEDYYVHWYQQHPGKAPTTVIYNDDQRPSGVPDRFSGSIDSTSNSASLTIAGLQAEDEADYHCQSYDSSAN
Oryctolagus cuniculus V616 iglv AAGW02067715.1 23898 SWAQFVLNQPQSVSGSLGQTVSISCNRDSGNIEEKYVHWYQQHPGKAPTTVIYSDDQRPSGVPDRFSGSINSASNSASLTITGLLAEDEADYHCQSYDSSAN
Oryctolagus cuniculus V617 iglv AAGW02067715.1 31511 SWAQFVLTQPQSVSGSLGQTVSISCNRDSGNIEDYYVHWYQQHPGKAPTTVIYNDDQRPSGVPDRFSGSIDSTSNSASLTITGLLAEDEADYYCLSSDSSAN
Oryctolagus cuniculus V618 iglv AAGW02067715.1 38779 SWAQAALTQPSAFTEAEGRTIIIPCTGSSSNVRKGYTSWYQPLPGRPPTMLLYSSSIRPSGVPDRFTGYTSGNTASLTIAGLQPEDEADYYCAAWDSSLGA
Oryctolagus cuniculus V619 iglv AAGW02067715.1 43967 SLSQPVLTQPPSLSASLDTTARLTCTLSTGYSVGSYVIGWYQQVPGRPPRYLLTYHTEEIKHQGSGVHSRFSGSKDDSANAGVLSISGLQPEDEADYYCAT
Oryctolagus cuniculus V620 iglv AAGW02067715.1 81499 SLSQPVLTQPPSLSASLDTTARLTCTLSTGYSVGEYPLVWLQQVPGRPPRYLLGYHTDDIKHQGSGVPSRFSGSKDDSANAGVLSISGLQPEDEADYYCAVG
Oryctolagus cuniculus V621 iglv AAGW02067717.1 59305 SWAQPALTQPSSAFGALGGSVTISCTGTSDDVGYTNAVYWYRQLPGMSPTLLIYYDSKRPSGIPERFSGSKSGNTASLTISWLQPEDEAAYYCSSYRNP
Oryctolagus cuniculus V622 iglv AAGW02067717.1 62425 SWAQPALTQPSSVSGALGGSVTITCAGSNSDIGYNSLISWYQQLPGSVPKLLMFRVDRLASGIPERFSGSKSGTTASLTISGLQPEDEADYYCVSYTSS
Oryctolagus cuniculus V623 iglv AAGW02067717.1 84352 CVASYELTQLPSVSVSLGQTARITCGGNSIGSKAVHWYQQKPGLAPGLLIYNDDERPSGVPDRFSGSNSGDTATLTISGAQAGDEADYYCQLWDSSAG
Oryctolagus cuniculus V624 iglv AAGW02067717.1 101811 SVASHELTKLPSVSVSLGQTARITCGGDSIEEYSVHWYQKRPGQAPVLLIYRDSNRLSGIPDHFSGSNSGNTATLTISGAQAGDEADYYCQVWDDNNE
Oryctolagus cuniculus V625 iglv AAGW02067717.1 115980 CVASYELTQLPSVSVSLGQTARITCGGDSIESYAVSWYQQKPGLAPVLLIYRDSKWPSGIPDRFSGSNSGNTATLTISRAQAGDEADYYCQVFNSGFG
Oryctolagus cuniculus V634 trbv AAGW02068537.1 10943 HTDPGVIQTPSHQVTKIGQGVTLRCDPVSNHLYFYWYRQILGQKMDFLVSFYNDKLSEKSEIFSDRFSIERPDGSYLILKIQPTQLGDSAVYLCASSL
Oryctolagus cuniculus V635 trbv AAGW02068537.1 21715 PLDTAVFQTPKYLISQVGNKKTIKCEQKLGYDAMYWYKQDSKKSLKILFCYNNKELILNETVPSRFSPESPDKAHLNLHVRSLERDDSAVYLCASSL
Oryctolagus cuniculus V636 trbv AAGW02068537.1 22854 SMDTKITQTPRHLVMGTANKKSLKCEQHLGHNAMYWYKQNAPKPPELMFLFNHKELIENNSVPSHFSPECPENSRLLLHLANLQPGDSAVYLCASSQ
Oryctolagus cuniculus V637 trbv AAGW02068538.1 1332 PVEAGVTQTPRHLIQTRGQQVSLRCTPHSGHNRVLWYQQVLGQGLQFLFDYYNERQSSKGNVPGRFSAHQFSDFTSEMNVSALELQDAAVYLCASSL
Oryctolagus cuniculus V638 trbv AAGW02068538.1 7391 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHVGLYWYRQSQGQGLQFMMYFQGKNPVDESGMPGSHFSAERPGGSSSTLKIQPAQPGDSAVYLCASSL
Oryctolagus cuniculus V639 trbv AAGW02068538.1 12313 PVEAGVTQMPRHLIQTRGQQVSLRCTPHSGDDRVLWYQQVLGQGLKFLFEYYRGSQTSKGNVSGRFSAHQFSDFSSEMNVSSLELQDAAVYLCASSL
Oryctolagus cuniculus V640 trbv AAGW02068538.1 17073 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHYTLYWYRQSQGQGLQLMMYFQDKDPADESGLPGAHFSAERPGGSSSTLKIQPAQPGDSAVYFCASSL
Oryctolagus cuniculus V641 trbv AAGW02068538.1 24379 PANAGVTQSPKFQVLKTGQSLTLRCAQDMSHNYMYWYRQDPGLGLKLIYYSAGRDIYEKGDVPDGYNVSRPSTEEFPLTLPSAVPSQTSVYLCASS
Oryctolagus cuniculus V642 trbv AAGW02068538.1 26383 PGEAGVTQTPRHLIQTRGQQVSLRCTPDSGHDRVFWYQQVLGQGLQFLFDYYRGSQTSKGNVSGRFSALQFSDFSSEMNVSALELQDLAVYLCASSL
Oryctolagus cuniculus V643 trbv AAGW02068538.1 28769 PANAGVTQSPKFQVLKTGQSLTLRCAQDMNYDYMCWYRQDPGLGLKLIYYSAVQGTHEKGDDPDGYNASRPSTKEFPLTLLSAVPSQTSVYLCAAI
Oryctolagus cuniculus V644 trbv AAGW02068538.1 39801 PVEAGVTQTPRHLIQTRGQQVSLRCTPHSGHNRVFWYQQVLGQGLHFLFYYYNERQSSKGNVSGRFSAHQFSDFSSEMNVSALELQDSAVYLCASSL
Oryctolagus cuniculus V645 trbv AAGW02068538.1 53273 PANAGVTQSPKFQVLKTGQSLTLTCAQDMNYDNMYWYRQDPGLGLKLIYYSVVQGTHEKGDIPDGYNVSRPSTEEFPLTLTSAVPSQTSVYFCAAV
Oryctolagus cuniculus V646 trbv AAGW02068538.1 58956 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHYTLYWYRQSQGQGLQLMMYFQGKDPADESGLPGAHFSAERPGGSSSTLKIQPAQPGDSAVYLCASSL
Oryctolagus cuniculus V647 trbv AAGW02068538.1 63851 PVEAGVTQTPRHLIQTRGQQVSLRCTPDSGHDRVVWYQQVLGQGLQFLFDYYNEIQRSKGNVSGRFSAHQFSDFSSEMNVSALELQDSAVYLCASSL
Oryctolagus cuniculus V648 trbv AAGW02068538.1 67072 PANAGVTQSPKFQVLKTGQSLTLRCAQDMNYDYMCWYRQDPGLGLKLIYYSVDRDIYEIGEVSDGYNVSRPSTEEFPLTLLSAVPSQTSVYFCAAI
Oryctolagus cuniculus V649 trbv AAGW02068538.1 77216 PVEAGVTQTPRHLIQTRGQQVSLRCTPHSGHDRVLWYQQVLGQGLQFLFEYYNERQSSKGNVSGRFSARQFPDFTSEMNVSALELQDAAVYLCASSL
Oryctolagus cuniculus V650 trbv AAGW02068538.1 79655 PANAGVTQRPKFQVLKTGQSLTLRCAQDMSHNYMYWYRQDPGLGLKLIYYSAGQGTPEKGDLPDGYNVSRTSTEEFPLTLPSAVPSQTSVYFCAAV
Oryctolagus cuniculus V651 trbv AAGW02068540.1 5814 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHNTLYWYRQSQGQGLQFMMYFQGKNPADDSGMPGAHFSAERPGGSSSTLKIQPAQPGDSAVYLCAGSL
Oryctolagus cuniculus V652 trbv AAGW02068540.1 10739 PVEAGVTQTPRHLIQTRGQQVSLRCAPDSGHNRVLWYQHVLGQGLQFLFEYYNERQSSKGNVPGRFSAHQFSDFSSEMNVSALELQDSAVYLCASSL
Oryctolagus cuniculus V653 trbv AAGW02068540.1 15421 PANAGVTQSPKFQVLKTGQSLTLRCAQNMNYDYMCWYRQDPGLGLKLIYYSVDHDIYEKGDVPDGYNTFRQSTEEFHLTLPSAVPSQTSVYFCASS
Oryctolagus cuniculus V654 trbv AAGW02068540.1 18984 HMNAGVSQSPRHRVTGRGQNVTLTCDPESGHNVLYWYRQSQGQGLQLMMYFQGKNPAEESGLPGAHFSAERPGGSSSTLKIQPAQPGDSAMYLCAGSEAP
Oryctolagus cuniculus V655 trbv AAGW02068540.1 25810 PVEAGVTQTPRHLIQTRGQQVSLGCTPQSGHNRVLWYQQVLGQGLQFLFYYYNEIQSSKGNVSGRFSAHQFSDFSSEMNVSALELQDSAVYLCASSL
Oryctolagus cuniculus V656 trbv AAGW02068540.1 28196 PANAGVTQSPKFQVLKTGQSLTLKCTQDMSHNYMYWYRQDPGLGLKLIYYSVGRDTDAKGEVSDGYNVSRPSTEEFPLMLLSAVPSQTSVYFCASS
Oryctolagus cuniculus V657 trbv AAGW02068540.1 33393 PANAGVTQSPKFQVLKTGQSLTLSCAQDMNYDYMYWYRQDPGLGLKLIYYSAGQGTPEKGDVPDGYNASRPSTEEFPLMLLSAVPSQTSVYFCASS
Oryctolagus cuniculus V658 trbv AAGW02068540.1 36609 HTDAGVSQSSRHRVTGRGQNVTLTCDPESGHARLYWYRQSQGQGLQLMMYFQGKDPADQSGLPGAHFSAERPGGSSSTLKIQPAQPGDTAVYLCASSI
Oryctolagus cuniculus V659 trbv AAGW02068540.1 37702 PASAGVTQSPKFQVLKTGQSLTLRCAQDMNYDNMYWYRQDPGLGLKLIYYSVDRDIYAIGEVSDGYNVSRPSTEEFHLMLLSAVPSQTSVYFCAAI
Oryctolagus cuniculus V660 trbv AAGW02068540.1 41257 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHTFLYWYRQSQGQGLQFMMYFQDKNPADESGMPGAHFSAERPGGSSSTLKIQPAQPGDSAVYLCASSL
Oryctolagus cuniculus V661 trbv AAGW02068540.1 46799 PVETGVTQTPRHLIQTRGQQVSLRCIPHSGDDHVFWYQQVLGQGLQFLFDYYNEIQSSKGNVSGRFSAHQFSDFSSEMNVSALELQDSAVYLCASSL
Oryctolagus cuniculus V662 trbv AAGW02068540.1 49989 PANAGVTQSPKFQVLKTGQSLTLRCVQDMNHNYMYWYRQDPGLGLKLIYYSVGRDTDAKGEVSDGYNASRPSTEEFPLTLLSAVPSQTSVYFCASS
Oryctolagus cuniculus V663 trbv AAGW02068540.1 55025 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHAGLYWYRQSQGQGLHLMMYFQRKDPADESGMPGAHFSAERPGGSSSTLKIQPAQPGDSAVYLCASSL
Oryctolagus cuniculus V664 trbv AAGW02068540.1 60843 PANDGVTQSPKFQVLKTGQSLTLRCAQDMNHNYMCWYRQDPGLGLKLIYYSAGQGTPEKGDVPDGYNVSRPSTEEFPLTLQSAVPSQTSVYFCASS
Oryctolagus cuniculus V665 trbv AAGW02068540.1 62804 PGEAGVTQKPRHLIQIRGQQVSLRCTPHSGHDRVLWYQHVLGQGLQFLFDYYNERQSSKGNVSGRFSAHQFSDCSSEMNVSALELQDSAVYLCASSL
Oryctolagus cuniculus V666 trbv AAGW02068541.1 8007 PVEAGVTQTPRHLIQTRGQQVSLRCTPDSGHDRVFWYQQVLGQDLRFLFAYSLGSETSKGNVSGRFSARQFSDRRSEMNVSALELQDAAVYLCASSL
Oryctolagus cuniculus V667 trbv AAGW02068541.1 11214 PANAGVTQSPKFQVLKTGQSLTLRCAQDMSHNYMYWYRQDPGLGLKLIYYSAGQGTHEKGDVPDGYNASRPSTEEFPLMLLSAVPSQTSVYFCASS
Oryctolagus cuniculus V668 trbv AAGW02068541.1 25709 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHARLYWYRQSQGQGLQLMMYFQRKDPVDESGMPGAHFSAERPGGSSSTLKIQPAQPGDSAVYLCAGSL
Oryctolagus cuniculus V669 trbv AAGW02068541.1 35445 PVEAGVTQTPRYLIQTRGQQVSLTCTPDSGHNRVVWYQQVLGQGLQFLFDYYLGSQNAKGNVSGRFSAHQFSDFSSEMNVSTLELQDSAVYLCASSL
Oryctolagus cuniculus V670 trbv AAGW02068541.1 44341 PASAGVTQSPKFQVLKTGQSLTLRCAQDMNYDYMCWYRQDPGLGLKLIYYSVGLGTPEKGDVPDGYNASRPSIEEFHLTLPSAVPSQTSVYFCASS
Oryctolagus cuniculus V671 trbv AAGW02068543.1 10380 HTDAGVSQSPRHRVTGRGQNVTLTCDPESGHVGLYWYRQSQGQGLQLMMYFQDKNPVDESGMPGAHFSAERPEGSSSTLKIQPAQPGDSAVYLCASSL
Oryctolagus cuniculus V672 trbv AAGW02068543.1 17098 PVEAGVTQTPRHLIKARGQQVSLRCTPHSGHSSVSWYQQAPGQGLQLLFTIYEYVENAKGNFPDRFSAHQFQNYDSELNVSALDLGDSAVYLCASSL
Oryctolagus cuniculus V673 trbv AAGW02068543.1 29247 SVNVGVIQSPRHLIKGKGGNFSLKCSPIPGHNAVSWYQKLPGEGPHFLIQYFETMQRERGNIPDRFSAQQFQDYHSELNGSFLEPGDSALYLCASSL
Oryctolagus cuniculus V674 trbv AAGW02068543.1 32420 HTDAVVTQIPRHKITQTGKKVTLRCHQTDNYNYMYWYRQDLGSGLRLIHYSYGVGSMEKGDVSDGYNVSRTNTEDFSLILVSATTSQTSVYFCANSD
Oryctolagus cuniculus V675 trbv AAGW02068545.1 1287 PTDAGVIQTPRHTVTEKGQAVTLRCEPMSGHAALFWYRQTSGQGLEFLIYFNNQAPIDDSGMPKDRFSAIMPNASLSTLKIQPTDARDSAVYFCASSL
Oryctolagus cuniculus V676 trbv AAGW02068545.1 29508 LIKAAIQSPRHLIREQGEEVTLTCNPTKGHAHVFWYRQHLEEDLKFMIYLQKEMVIDDSGMPAQRFSAGFPREGPSSLQIEPAEPQDSAVYFCASSS
Oryctolagus cuniculus V677 trbv AAGW02068545.1 33847 TTDGGINQIPKHLIRKEKQAVTLECEQNLNHDVMYWYRQDPGQGLKLIYYSQTVKDVQKGDLAEGYNALREKKTSFTLAVTSTHENQRALYLCAASV
Oryctolagus cuniculus V678 trbv AAGW02068545.1 39207 SGLGALVLQNPSRAICQSGASVRIECHSVGLQALTVLWYRQLPKQSFMLMATSNQGSDAAYEQGFTKAKFPINHPNLSYSSLEVTNTQPEDIGLYFCGAS
Oryctolagus cuniculus V679 trbv AAGW02068546.1 2599 SMDTQVTQTPRHLLKGKAQTAKMECVPAKGHRSVYWYRKKPEEELKFLVYFLDEEINEKTEVINERFSAQCPTNSPCSVEIQSTELEDSALYFCASSQ
Oryctolagus cuniculus V680 trbv AAGW02068546.1 5857 SMDTEVTQTPRHLLKGKAQTAKMDCVPAKGHRYVFWYRKKPEEELKFLVYLQNEEIIEKTEVINERFSAQCPTNSPCSVEIQSTELGDSALYFCASSQ
Oryctolagus cuniculus V681 trbv AAGW02068546.1 9019 SMDTQVTQTPRHLLKGKAQTAKMECVPAKGHSYVYWYRQKPEEELKFLVYFLDEEINEKTEVINERFSAQCPKNSPCSVEIQSTELEDSALYFCASSQ
Oryctolagus cuniculus V682 trbv AAGW02068546.1 12888 SGLGALVLQNPTRAICQSRASVRIECRSVGLQAVTVFWYRQLPKQSFMLMATSNQASDAAYEQGFTKAKFPINHPNLSYSSLEVTNTQPEDIGFYFCGAS
Oryctolagus cuniculus V683 trbv AAGW02068547.1 4290 SMDTEDTQTPRHLLKGKAQTAKMDCVPAKGHRSVYWYRKKPEEELKFLVYLQDKEIIEKTEVINERFSAQCPTNSPCSVEIQSTDLGDSALYFCASSQ
Oryctolagus cuniculus V684 trbv AAGW02068547.1 7632 SMDTEVTQTPRHLLKGKAQTAKMDCVPAKGHSYVYWYRQKPEEELKFLVYLQNEEIIEKTEVINERFSAQCPTNSPCSVEIQSTDLGDSALYFCASSQ
Oryctolagus cuniculus V685 trbv AAGW02068547.1 11683 SMDTEVTQTPRHLLKGKAQTAKMDCVPAEGHRYVYWYLKKPEEEIKFVVYFRDEEILDKTEVINSRFSAQCPTNSPCSVEIQSTDLGDSALYFCASSQ
Oryctolagus cuniculus V686 trbv AAGW02068547.1 15015 SMDTEVTQTPRHLLKGKAQTAKMECVPAERHSYVYWYRQKPEEELKFLVYFQDEAIIEKTEMINERFSTQCPTNSPCSVEIQSTELEDSALYFCASSQ
Oryctolagus cuniculus V687 trbv AAGW02068548.1 6297 LLEAAVFQTPRHRIAGTGSKITLECSQTMGHDRMFWYRQDPGMRPQLIHYSFGVNSTEKGDLPSEASVSRATKEQFSLTLASARPSDSSWYLCASSD
Oryctolagus cuniculus V688 trbv AAGW02068548.1 12315 LENAVVTQSPRHRVSGTGKTLTLRCSQDMSHVAMYWYRQDPGLGLQLIYYSPGVSSTEKGDTSEGYNVSRKELGHFPLMLESTSTKQTSVYICASSS
Oryctolagus cuniculus V689 trbv AAGW02068548.1 28314 LMEAKVTQTPRHITTGTGQKLTVTCSQDMNHDYMYWYRQDPGLGLKLIYYSINVDSVENGDVHAGYVASRKKKANFLLTLESTNISQTSLYLCASSD
Oryctolagus cuniculus V690 trbv AAGW02068548.1 32333 LMKAEVTQTPRYVIKRRGEKVLLECSQDMDHEQMYWYRQDPGLGLQLIYFSYGIDNKEKGEASEGYDVSRKKKPNFSLILASASANHTSTYHCASSL
Oryctolagus cuniculus V778 ighv AAGW02078754.1 31331 VQCQQLEESGGGLVQPGGSLKLCCKASGFTFSSYYMCWVRQAPGKGLEWIRCIYAGSGSTHYASWVNGRFTLSRDNAQSTVCLQLNSLTAADTATYFCAR
Oryctolagus cuniculus V779 ighv AAGW02078756.1 4183 VQCQEQLEESGGRLVTPGGSLTLTCTASGFSLSSYNMGWVRQVPGKGLEYIGYISSGGSAYYASWVNGRFTISKTATTMDLKMNSLTASDTATYFCTR
Oryctolagus cuniculus V780 ighv AAGW02078756.1 43283 VQCQSVEESRGGLIKPTDTLTLTCTVSGFSLSSYGVIWVRQAPGNGLEYIGTIGSSGSAYYASWAKSRSTITRNTNLNTVTLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V782 ighv AAGW02078950.1 5316 VQCQEQLKESGGGLVTPGGTLTLTCTASGFTISSYHICWVRQAPGKGLEWIGDIYAGSGSTWYASWVNGRFTISSNTNQNTVSLQMTSLTAADTATYFCTR
Oryctolagus cuniculus V783 ighv AAGW02078950.1 9289 VQCQEQLVESRGGLVQPGGSLTLSCKASGFTISSYGVNWVRQAPGKGLEWIRYIYNDGSTYYASWVNGRFTISKTSTTVDLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V785 ighv AAGW02078951.1 16013 VQCQEPLKESGGGLVTPGGNLTLTCKASGSDISSYSIGWVRQAPGKGLEWIGIIYASGSTYYASWVNGRFTISKTSSTVDLKMTSLTAADTATYLCAR
Oryctolagus cuniculus V786 ighv AAGW02078956.1 8842 VQCQSVEESGGRLVKPDETLTLTCTVSGIDLSSNAMSWVRQAPGEGLEWIGTISTGGSTYYASWAKGRFTISKTSTTVDLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V787 ighv AAGW02078956.1 17105 VQCQELVESGGGLVQPEESLKLSCKASGIDFSSYGISWVRQAPGKGLEWIAYIYPGFSITNYANSVKGRFTISSDNAQNTVFLQMTSLTASDMATYFCAR
Oryctolagus cuniculus V788 ighv AAGW02078959.1 5205 LVQPVGSLKLSCKASGFDLSSYAMCWVRQAPGKGLEWNGEINPNGGSTWYASRVNGRFTDSRNNVKSTLDLQMSSLTAADTSLYYCARPSGRAQ
Oryctolagus cuniculus V789 ighv AAGW02078959.1 23853 VQCQQLKESGGGLVQPGGSLKLCCKASGFTFSSYYMCWVRQAPGKGLEWIGCIYAGSGSTHYASWVNGRFTLSRDNAQSTVCLQLNSLTAADTATYFCAR
Oryctolagus cuniculus V790 ighv AAGW02078959.1 36155 VQCQKQLKESGGGLVQAGGSLKLSCKASGFNFSSNAMSWVHEAPGKGLEWITCIDSYGSTNYASWLNGRFTISSNNAQNMVDLEMNSLTAADMATYFCAR
Oryctolagus cuniculus V798 igkv AAGW02079587.1 15491 TRCALVMTQTPASVSAAVGGTVTINCQASQSISTALAWYQQKPGQRPKLLIYDASKLASGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCQQGYSSSAD
Oryctolagus cuniculus V799 igkv AAGW02079587.1 26728 ATFAVEMTQTPASVSAAVGGTVTINCQASEDIYSNLAWYQQKPGQPPKLLIYGASTLASGVPSRFKGSGSGTEYTLTISGVQCDDAATYYCQ
Oryctolagus cuniculus V803 ighv AAGW02079983.1 15461 VQCQSLEESGGGLFKPGGSLKLSCKASGFIFSDNYAMCWFRQAPRKGLEWIAYINTGSGSTWYASWVNGRFTISRNTKENTVCLKMTSLTAMDTAAYFCVR
Oryctolagus cuniculus V804 ighv AAGW02079983.1 55425 VQCQQLEESGGGLVKPGGSLKLFCKAFGFTFSSYYMFWVHQAPGKGLEWIGCIYAGSGSTWYASWVNGRFTLSRDNAQSTVCLQLNSLTAVDMATYFCAR
Oryctolagus cuniculus V805 ighv AAGW02080074.1 20910 VQCQEQLKESGGRLVTPGGILALTCKASGSDISSYGVSWVRQAPGKGLEWIRYIYAGSGSTWYASWAKGRFTISKTSSTVDLKMTSLTATDTATYFCAR
Oryctolagus cuniculus V806 ighv AAGW02080074.1 25826 AQCQEQLKESGGGLVTPGGILTVTCTASGFSISSYRMGWVRQAPGKGLEYIGYISYGGSAYYTSWAKGRFTISKTSSTVDLKMTSLTASDKATYFCAR
Oryctolagus cuniculus V808 ighv AAGW02080074.1 40324 VQCQEQLEESGGGLVQPGGSLKLSCNASGIDLSTYAMGWVREAPGKGLEWIGYIDPVFGSTDYASWVNGRFTISSDNAQNTLYLQLNSLTATDMATYFCAR
Oryctolagus cuniculus V809 ighv AAGW02080074.1 51242 VQCQEQLVESGGGLVQPGGTLKLSCKGSGFDLSSNAMCWVRQAPGKGLEWIGCIIYGSTYYASWVNGRFTISSDNAQSSVDLQLNSLTAADTATYFCAR
Oryctolagus cuniculus V810 ighv AAGW02080079.1 7466 VQCQEQLKESGGGLVQPGGSLTLSCKASGFDFSTYYMSWVRQAPGKGLEWIGIIYAGKGSTDYASWVNGRFTISSDNAQNTVDLQMNSLTAADRATYFCAR
Oryctolagus cuniculus V811 ighv AAGW02080082.1 15781 VQCQSVEESGGRLVTPGTPLTLTCTVSGFSLSSYAMSWVRQAPGKGLEWIGIISSSGSTYYASWAKGRFTISKTSTTVDLKITSPTTEDTATYFCAR
Oryctolagus cuniculus V812 ighv AAGW02080082.1 29212 VQYQEQLKESGGRLVTPGGSLTLTCTVSGFSLSSYNMQWVRQAPGKGLEYIGYISSSGSTYYASWVNGRFTISKTSTTMDLKMNSLTASDTATYFCAR
Oryctolagus cuniculus V813 ighv AAGW02080082.1 34068 VQYQEQLKESGGHLVTPGGSLTLTCTVSGFSLSSYNMGWVRQAPGEGLEYIGWISTGGSAYYASWVNGRFTISKTSTTMDLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V815 ighv AAGW02080300.1 29931 AGGGLVKPGGSLELCCKASGFTLSSSYWICWVHQAPGKGLEWIGCIYAGSSGSTYYASWVNGPFTLSRDIDQSTGCLQLNSLTAADTAMYYCAR
Oryctolagus cuniculus V816 ighv AAGW02080430.1 4096 VKCQEQLKESGGGLVQPGGSLKLSCKASGIDFSSYWMSWVRQAPGKRLEWIGIIYAGSGSTDYASWVNGRFTISSDNAQNTVDLQMNSLTAADTATYFCAR
Oryctolagus cuniculus V817 ighv AAGW02080430.1 32687 AEGGLVKPGGSLELCCKASGFSLSSSYWICWVRQAPGKGLEWIGCIYAGSSGSTYYESWVNGPFTLSRDIDQSTGCLQVKSLTAADTAMYYCAR
Oryctolagus cuniculus V818 ighv AAGW02080430.1 37937 VQCQEKLVQSRGGLVQPGGSLKLPCKASEFNLSSYAMCWVCQAPGKGLEWNGEINPNGGSTWYASRINGRFTVSRNNVKSTLDLQMSSLTAADTSLYYCAR
Oryctolagus cuniculus V821 ighv AAGW02080938.1 18529 AGGGLVKPGGSLELCCKASGFSLSSSYWICWVRQAPGKGLEWIGCIYAGSGSTHYASWVNGRFTLSRDIDPSTGCLQLNSLTAADTAMYYCAR
Oryctolagus cuniculus V822 ighv AAGW02080938.1 23784 VQCQEQLVQSRGGLVQPGGSLKLFCKASGFDLSSYAMCWVRQAPGKGLEWNGEINPNGGSTWYASRINGRFTVSRNNVKSTLDLQMSSLTAADTSLYYCAR
Oryctolagus cuniculus V824 ighv AAGW02081160.1 11004 VQCQSVEESGGGLFKPGGSLKLSCKASGFTISSSYWMCWVRQAPGKGLEWIAYINTGSGSTWYTSWVNGRFTISRNTKENTVSLKMTSLTAADTAAYFCVR
Oryctolagus cuniculus V825 ighv AAGW02081160.1 29187 AGGGLVKPGGSLELCCKASGFSLSSSYWICWVRQAPGKGLEWIGCIYAGSRGSTYYASWVNGRFTLSRDIDQSTGCLQLNSLTVADTAMYYCAR
Oryctolagus cuniculus V826 ighv AAGW02081222.1 6804 VQCQEQLKESGGGLVTPGGILSLTCTASGFSISSYRMGWVRQAPGKGLEWIRYISYGGSAYYKSWAKGRFTISKTLSTVDLKMTSLTASDTATYFCAR
Oryctolagus cuniculus V828 ighv AAGW02081251.1 20431 VQCQQLEESGGGLVTPGGSLKLCCKASGFTFSSYYMCWVRQAPGKGLEWIGCIYAGSVSTRYASWVNGRFTLFRDNAQSTVCLQPNSLTAADTATYFCAR
Oryctolagus cuniculus V831 igkv AAGW02081369.1 4182 ARCALVMTQTPSPVSAAVGSTVTNSCQSSESVYSNYLSWFQQKTGQPPKLLIYRASTLASGVPSRFKGSGSGTQFTLTISGVQCDDAATYYCAGYKS
Oryctolagus cuniculus V832 ighv AAGW02081480.1 9785 VQYQEQLKESGGCLVTPGGFLTLTCTVSGFALSSYNMGWVRQAPGKGLEYIGWISTGGSAYYASWVNGRFTISKTSTTMDLKMTSLTAADMATYFCAR
Oryctolagus cuniculus V834 ighv AAGW02081617.1 9929 VQCQEQLMQSRGGLVQPGGSLKLFCKASGFDLSSYAMCWVRQAPGKGLEWNGENNPNGGSTWYASRVNGRFTVSRNNVKSTLDLQMSSLTAADTSLYYCAR
Oryctolagus cuniculus V836 ighv AAGW02081764.1 16741 VQCQEQLEESGGGLVQAGRSLKLSCKASGLDFSSYSMSWVHQAAGKVPEWIAYIYPGSGSRADSQSPATTPRHTVSQQMNHLTEDDMATYYCVG
Oryctolagus cuniculus V838 ighv AAGW02081962.1 10971 AGGGLVKPGGSLELCCKASGFSLSSSYWICWGRQAPGKGLVWIGCIYACSGSTYYASWVNGRFTLSRDIDQSTGCLQLNSLTAADTAMYYCAR
Oryctolagus cuniculus V840 ighv AAGW02082120.1 1986 VQCQEQLKESRGGLVQPGGSLKLSCKASGFDLSSYAMCWVRQAPGMGLEWNGEINPNGGSTWYASRVNGRFTVSRNNVKSTLDLQMSSLTAADTSLYYCAR
Oryctolagus cuniculus V841 igkv AAGW02082420.1 12044 ARCALVLTQTPSSVSAAVGGTVTIKCQASQSISSYLNWYQQKPGQPPKLLIYQASTLASGVPSRFKGSGSGTEFTLTISDLECADAATYYCQ
Oryctolagus cuniculus V842 ighv AAGW02082503.1 6529 VHCQEQLKESRGGLVQPGGSLKLSCKASGFDFSSIAIGWVRQAPGKGLEWIGYIDPVFGSTDYVSWVNGRFTISSDNAQKTLYLEMNSLTAADMATYFCAR
Oryctolagus cuniculus V846 ighv AAGW02083703.1 4894 VQCQQLEESGGGLVKPGGSLELCCKASGFTFSSYYMCWVRQAPGKGLEWIGCIYAGSGSTHYASWVNGRFTLSRDNAQSTVCLQLNSLTATDTDTYFCAR
Oryctolagus cuniculus V903 igkv AAGW02007319.1 5229 ARCAFEMTQTPSSVSEPVGGTVTIKCQASQSIYSYLSWYQQKPGQPPKLLIYEASKLASGVPSRFSGSGSGTEFTLTISDLECADAATYYCQGILVS
Oryctolagus cuniculus V904 igkv AAGW02007326.1 122068 ARCDIVLTQAPSSVSAAVGGTVTIKCQASQSVSSYLTWYQQKPGQPPKLLIYGASNLESGVPSRFRGSGSGTQFTLTISGMKAEDVATYYCHQHSSYP
Oryctolagus cuniculus V905 igkv AAGW02007327.1 1711 ARCDIVMTQTPSSVSAAVGGTVTINCQASQSVSNLLAWYQQKPGQPPKLLIYGASNLESGVPSRFRGSGSGTEFTLTISGMKAEDAATYYCQSGYYSAG
Oryctolagus cuniculus V906 igkv AAGW02007328.1 1316 ATFAIDMTQTPSSVSAAVGGTVTINCQASESISNYLAWYQQKPGQPPKLLICYASNLASGVPSRFRGSGSGTQFTLTISGVQCDDAATYYCQQC
Oryctolagus cuniculus V908 igkv AAGW02007333.1 15606 ARCAIEMTQSPPSLSASVGETVRIRCLASEFLFNAVSWYQQKPEKPPTLLISGASNLESGVPPRFSGSGSGTDYTLTIGGVQAEDVATYYCLGGYSGSAD
Oryctolagus cuniculus V909 igkv AAGW02007333.1 11809 ARCAIEMTQSPPSLSASVGGTVTMNCQASEDIDSYLSWYQQKPGKPPTLLISGASNLESGVPPRFSGSGSGTDYTLTIGDLQAEDAATYFCQGYSSYP
Oryctolagus cuniculus V910 igkv AAGW02007333.1 7174 ARCAIEMTQSPPSLSASVGGTVTINCLASENVYSAVAWYQQKPEKPPTLLISGASNLESGVPPRFSGSGSGTDYTLTIGGVQAEDAATYFCQGYSSYP
Oryctolagus cuniculus V911 igkv AAGW02007334.1 3855 ARGAIQMTQSPSSLAASVGDTVTITCKASEDIGYGLNWYQQKLGIAPKLLIYGANTLESGVPSRFSGSGSETDYTLTISSVQAEDAGIYYCQQGYSTP
Oryctolagus cuniculus V934 trav AAGW02009486.1 28122 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Oryctolagus cuniculus V1021 trdv AAGW02024183.1 5090 SSNSQSVDQSTNVEYKREGQSVTMDCKITVSWYYYYMYWYRQLSSGEMILIINLYSENSQERKGRYSLKFQKPQKLLSLTISSLTITDSAVYFCAVSD
Oryctolagus cuniculus V1022 trav AAGW02024184.1 12363 LHGKSKVKQSPQYLSAREGEFLTIDCSYSTGMTTLHWLQQTPGGGIVSLFILSLEMKKNGRMSATINTKESQSSLHITASQLRDSATYLCAV
Oryctolagus cuniculus V1023 trav AAGW02024187.1 1127 LGGQETVEQNPQILSVQEGEECTLYCSYPSSFTDRLHWYRQALGTSLEPLFVLLSNGEVKQKDQFRASLDTKAKRSTLHIMAAQHGLAATYFCAVD
Oryctolagus cuniculus V1024 trav AAGW02024188.1 8709 SSMAQTVTQTQPEMSVQEAETATLDCTYDTRDSDYYLFWYKQPPSGELVLIIRQEAYKPQNATQNRFSVNFQKVSKSFSLKISDSQLGDAGMYLCALRE
Oryctolagus cuniculus V1025 trav AAGW02024188.1 1713 SSVAQTVTQTQPEMSVQEAETATLDCTYDTGDSNYYLFWYKQPPSGELVLIIRQEAYKPQNATQNRFSVNFQKASKSFSLKISDSQLGDAGMYLCAFA
Oryctolagus cuniculus V1026 trav AAGW02024190.1 9701 YGRADWITPTETQVLGVEGKAGDLFCHYGTSSSGYIDLYWFRQYPNQAPEFILYRGWGYSGKGDADFAKKRFYSKVTANSTNLYISSLVPADTALYYCALR
Oryctolagus cuniculus V1027 trav AAGW02024192.1 15414 ANGQEKQVVQSPSILNVWEGETAVINCSYTDGASNYFPWYKKEERKGPTLLIEIRSNVDKKQDGRVTVLLNKNAKHISLHISATRPGDSATYFCAE
Oryctolagus cuniculus V1028 trav AAGW02024192.1 10920 IMADAKTTQPTSMETTEGDPVHLPCNHSTISGSEYIYWYRQIPLQGPEYVIYGVKNNVTNGGASLTIAADRKFSTLILPHITLRDAAVYYCIVR
Oryctolagus cuniculus V1029 trav AAGW02024196.1 23965 VSSMSNVEQKPWSLQVQEGESTNFTCSFPTSSFYNLNWYRWKPSKSPKFLFGMSLNGDEKQEGRVRATLNTKEGHSYLYIKGSQLEDSATYLCAM
Oryctolagus cuniculus V1030 trav AAGW02024196.1 15040 RTGAQSVTQLDGHTTVSEGAALELRCNYTYSGTPYLFWYVQYPGQSLQFLLKYMSGAPLVKGPKGFEAEFKKSETSFHLRKLSAQWSDTAQYFCALS
Oryctolagus cuniculus V1031 trav AAGW02024197.1 76673 VNSQQEEEKPQTLSIQEGENVTMNCSYKSTISSLQWYRQDSGRGPVSIILIRTNEREKPSGRLRATLDTANRRSSLSISASQTADTATYFCATD
Oryctolagus cuniculus V1032 trav AAGW02024197.1 71819 GANGDSVTQTEGTVTLLEGAALTLNCTYQTSYPPFLFWYVQYQNKELTLLLKSSSEVQETDSRGFRGSHVKSNSSFHLRKPSVQVSDSAVYFCALQ
Oryctolagus cuniculus V1033 trav AAGW02024197.1 68046 ASVAQKVTQAQTATSVVEKEPVTLHCVYETSNPTYYLFWYKQLPSGEMIFLIRQDSYNEKNATEGRYSLNFQKAVRAISLTITASQLVDSAVYFCALREN
Oryctolagus cuniculus V1034 trav AAGW02024197.1 58512 SSSGDSVTQMEGLVSLSEGASLALSCTYQTTYLSPFLFWYIQYPNKALQLLLRSTTENQRTESQGFWATLVKSNSSFHLHKSSLQISDSAVYYCAMT
Oryctolagus cuniculus V1035 trav AAGW02024197.1 31713 GARAQAVTQPDSHRAVAIGAPLELRCKYSSSLPSYLFWYMRSPSQGLQFLLKSTLGNERFSGSKGFEAELRQNEKSFLLRKPSAHWSDAAEYFCA
Oryctolagus cuniculus V1036 trdv AAGW02024197.1 13525 SSVAQKVTQVQQDIFLSEGSTATLYCQYETSWSLYYIFWYKQLSSGEIIYVIRQGSAVQNAKKDRYSINLQKEAKSVSLTISALQLGDSSKYLCALSE
Oryctolagus cuniculus V1037 trav AAGW02024199.1 41113 GAKGLEVKQSPSWLSVQEGASPTLNCTFSASVRSVQWFQQNPGSSLISLFFISSGTKQNRRLKATVNSQERYSTLHITTTQVEDSGTYLCAAE
Oryctolagus cuniculus V1038 trav AAGW02024199.1 33485 MSQAENVEQLPSTLSVQEGDSSAINCTYSNSAFSYFPWYKQEPGQDLQLIIDIRSNMENKQDQRLTVLLNKAAKHVSLHIATTQPGDSAVYFCAAS
Oryctolagus cuniculus V1039 trav AAGW02024199.1 30834 SAIAQKVTQAQPAILAQEKEAVTLDCTYDTSVSSYGLLWYKQLNTGEMIFLIRQDSYGQQNATQGRYSLNFQKARKSINLVISVLQLEDSAVYFCTLTE
Oryctolagus cuniculus V1040 trav AAGW02024199.1 25065 STRGDSVTQKEGQVTLPEGANLTINCTYSTTGYPNLFWYVQYPGEGPQLLLKAMTANEKGSGRGFEALYNKDSSSFHLEKSSVQESDSAMYYCALS
Oryctolagus cuniculus V1041 trav AAGW02024199.1 22701 VSGKNQVEQDPQSLIILEGGNCTLQCRYTVTPVNNVRWYRQDVGRGPVLLIVMTSFESKKSNGRYTATLESTAGHNSLHIRASQLSDSASYICVVV
Oryctolagus cuniculus V1042 trav AAGW02024199.1 13753 VRSQQQELEQNPQSLSIAQGALASFNCTYSTASQNFMWYRQYAGKGPELVMSIYASGEKVEGRFTAQLSTAGRYVSLLIRDSQLRDSATYLCAL
Oryctolagus cuniculus V1043 trav AAGW02024199.1 3870 GVSGGARAQTVTQPVDRSSVSTGAPVQVNCSYSFSGSPLLFWYVRYPGSSLQLLLGYTTGKSTNGFTADLNKAETSFHLKKASAQEEDSATYYCALS
Oryctolagus cuniculus V1044 trav AAGW02024200.1 116695 RTNGDSVTQTEGPVILSEGSSLTLNCNYQTSYQEFLFWYVQYLHQGPQLLLKSATENQRVEHQGFHATLVKKDSSFHLHKSSLQLSDSAVYYCALK
Oryctolagus cuniculus V1045 trav AAGW02024200.1 104838 RTNGASVTQTEGPVILSEGSSLTLNCNYEADYLDVLFWYVQYLHQGPQLLLKSATENQRMEHQGFHATLVKKDSSFHLHKSSLQLSDSAVYYCALR
Oryctolagus cuniculus V1046 trav AAGW02024200.1 100374 RTNGASVTQTEGPVILSEGSSLTLNCNYQTSYSGFLFWYVQYLHQEPQLLLQSTTENQRMEHQGFHATLVKKDSSFHLHKSSLQLSDSAVYYCALG
Oryctolagus cuniculus V1047 trav AAGW02024200.1 96020 DARAQIVTQPDAQVAVSEGAAAELRCSYSQGTALYLFWYVQYPGQGPQLLLKYISGDARVPGIRGFEAEFKKSESSFHLRKASVQGSDAAQYFCAVT
Oryctolagus cuniculus V1048 trav AAGW02024200.1 87303 GSNGDSVTQTEGQVTLPEGASLTVNCSYESAQYPALLWYVQYPGEGPQLLLRAMTANEKGSNRGFEALYNKDSSSFYLEKSSVQESDSAVYYCALS
Oryctolagus cuniculus V1049 trav AAGW02024200.1 80423 DTRAQTVTQPDAQVAVSEGAAVELRCNYSYGGSVSLFWYVQHPGQGPQLLLKYLSGNALVPGIRGFEAEFKKSESSFHLRKASVQGSDAARYFCAVT
Oryctolagus cuniculus V1051 trav AAGW02024200.1 58349 MSQGGNVEQHPSTLSVQEGDSSVINCTYSDSFSDYFPWYKQEPGQGLQLIIDIRSNLEKKQDQRLTVSLNKAAKHVSLHIAATQPGDSAVYFCVA
Oryctolagus cuniculus V1052 trdv AAGW02024200.1 53212 SAVAQKVTQAKPAILAQEKEAVTLDCTYDTSAASYSLLWYKQLNTGEMIFLIRQDSYGQQNATQGRYSLNFQKARKSINLVISVLQLEDSAVYFCTLRE
Oryctolagus cuniculus V1053 trav AAGW02024200.1 42694 ESRGDDVEQFPSILSVQEGDSSVINCTYSDSSSAFFAWYKQEPGQGPQLILDIRSNVEKKQNQRLTVLLNKVAKHFSLHIAATQLGDSAIYFCAAS
Oryctolagus cuniculus V1054 trav AAGW02024200.1 37336 GSNGQLVTQTEGQVTLAEGASLTVKCSYKITWFPALFWYVKYPGEGLQLLLKATKANEKGSNRGFEALYNKDTSSFHLEKSSVQESDSAVYYCAQ
Oryctolagus cuniculus V1055 trav AAGW02024200.1 32081 DTSAQTVTQPDAQVSVSEGAAAELRCNYSYGAPVYLFWYVQHPGQGPQLLLKYVSGDSRVPGIRGFEAEFKKSESSFHLRKASVQGSDAARYFCAAAS
Oryctolagus cuniculus V1056 trav AAGW02024200.1 26974 GVRGMQVQQSPSTLTAQEGVSSSLTCNFSNTANSVQWFRQNPGSSLVNLFFIATGTKQNGRLKATVNSQERYSTLHITSSQLEDSGTYLCAA
Oryctolagus cuniculus V1057 trav AAGW02024200.1 18873 VSQGENVEQHPSALSVREGDSSAINCTYTDSASNYFLWYKQEPGQGLQLIIDIRSNTEKQQNQRFTVSLNKMAKHVSLHIAATQPGDSAVYFCVAS
Oryctolagus cuniculus V1058 trav AAGW02024200.1 12555 GGNGDSVTQTEGQVTLPEGASLTVNCSYESTQYPALFWYVQYSGESPQLLLRATKANEKGSNRGFEALYNKDSSSFHLEKSSVQESDSAMYYCALS
Oryctolagus cuniculus V1059 trav AAGW02024200.1 5166 DTSAQTVTQPDAQVAVSEGAAVELRCNYSYGASVSLFWYVQHPGQGPQLLLKYLSGNALVSGIRGFEAEFKKSESSFHLRKASVQGSDAARYFCAAVS
Oryctolagus cuniculus V1060 trav AAGW02024202.1 99967 VSGGETVEQSPSFLSVQEGDGCVINCTYTESASTYFSWYKQEPGAGLQFLINILSNADKKEEQRLTVLMSKKDKRLSLHIAAARPADSATYFCAAR
Oryctolagus cuniculus V1061 trav AAGW02024202.1 83743 RTNGDSVTQTEGLVILSEGSSLTLNCNYQADSYSEFLFWYVQYLHEGPQLLLKSTTENQRMEHHGFHATLVKKDSSFHLHKSSLQLSDSAVYYCALR
Oryctolagus cuniculus V1062 trav AAGW02024202.1 78838 RTNGDSVTQTEGPVILSEGSPLTLNCSYQTSSSVFLFWYVQYLHEGPQLLLKSAIENQRVEHEGFHATLVKKDSSFHLHKSSLQLSDSAVYYCALR
Oryctolagus cuniculus V1063 trav AAGW02024202.1 64911 RTNGDSVTQTEGPVILSEGSSLTLNCNYQTSYLDVLFWYVQHIHQGPQLLLKSGTENQRMKHEGFHATLVKKDSSFHLHKSSLQLSDSAVYYCALR
Oryctolagus cuniculus V1064 trav AAGW02024202.1 57919 VSRGETVEQSPSFLNVQEGDGCVINCTYTDSTFNYFYWYKQEPGAGLQLLLNIFSSMDKKEEKRFTVFMNKKDKHLSLHIAAAHAVDSATYFCAA
Oryctolagus cuniculus V1065 trav AAGW02024202.1 41158 VSGGETVEQSPSFLNVREGDGCVINCTYTDSTFSYFSWYKQEPGAGLQFLISIFSSMDKKEEQRLTVLMSKKDQRLSLHIAAARPADSATYFCAAG
Oryctolagus cuniculus V1066 trav AAGW02024202.1 33326 VSRGETVEQSPSFLSVQEGDGCVINCTYTDSASDYFYWYKQEPGAGLQFLISILSNADKKEEQRLTVLMSKKDQHLSLHIAAARPADSATYFCAAR
Oryctolagus cuniculus V1067 trav AAGW02024202.1 28319 VSGGETVEQSPSFLSVQEGDGCVINCTYTDSTSDYFYWYKQEPGSGLQFLINIFASMDMNEDQRFTVFLNKKDKLLSLHIRSAHPADSATYFCAE
Oryctolagus cuniculus V1068 trav AAGW02024202.1 19119 VSRGETVEQSPFFLNVREGDGCVINCTYTDSASTFFYWYKQEPGAGLQLLLNIISSVDKKEEKRFTVFMNKKDKHLSLHIAAAHAVDSATYFCAA
Oryctolagus cuniculus V1069 trav AAGW02024202.1 6645 VSGGEMVEQSPSFLSVWEGDGCVINCTYTDSVTSYFFWYKQEPGAGLQFLISILSNVDKKEEQRLTVLMSKKDKHLSLHIAAARPADSATYFCAAR
Oryctolagus cuniculus V1070 trav AAGW02024204.1 52632 AVSLSKTTQPSSMGAYEGQNVNISCSHPNIDTNEYIFWYQQIHNQGPRFLIQGYKTNVQNEEASLLIAADRKSSTLGLARLSLRDTAVYYCTVV
Oryctolagus cuniculus V1071 trav AAGW02024204.1 39390 VRGLQVKQRPSALSVQEGASPTLSCNFSAMVTRVQWFRQNPGGNLISLFFMTSEIMENGRLKSTVNFKELFSTLHITASQLKDSGTYLCAAEAQ
Oryctolagus cuniculus V1072 trav AAGW02024204.1 34095 VSGGEMVEQSPSFLSVQEGDGCVINCTYTDSTSDYFYWYKQEPGAGLQILISIFSSMDMKEDQRFTVFLNKKDKLLSLHIRAAHPADSATYFCAQ
Oryctolagus cuniculus V1073 trav AAGW02024204.1 18224 VSRGETVEQSPSFLSVQEGDSCVINCTYTDSASTYFFWYKQEPGSGLQFLINILSSMEKKEEQRLTVLMNEKDKHLSLRISVVHVADSAVYFCAAL
Oryctolagus cuniculus V1074 trav AAGW02024204.1 3680 VSRGETVEQSPSFLNVQEGDGCVINCTYTDSASTYFYWYKQEPGASLQLLLNIISSMDKKEEKRFTVFMNKKDKHLSLHITAARAVDSATYFCAA
Oryctolagus cuniculus V1502 ighv AAGW02067762.1 37547 VQCQEQLKESGGGLVQPAGSLKLCCKASGFDFSSNAIGWVCQAPGKGLEWIGYIDPVFGSTDYASWVNGRFAISSDNAHNTLYLEMNSLTAADMATYFCAR
Oryctolagus cuniculus V1503 ighv AAGW02067769.1 15145 VQCQQLEHSGGGLVQPRGSLKLCCKASGFTFSSYYMCWVRQAPGKGLEWIGCIYAGSSGSTYYASWVNGRFTLSRDIDQSTGCLQLNSLTAADMAMYYCAR
Oryctolagus cuniculus V1504 ighv AAGW02067769.1 3200 VQYQEQLEESGGGLVQPGGSLKLSCKASGIDFSSNAIGWVREAPGKGLEWIGYIDPVFGSTDYASWVNGRFTISSDNAQNTLYLEMNSLTAADMATYFCAR
Oryctolagus cuniculus V1516 trbv AAGW02068548.1 86125 TRAQTIHQWPAFRVQLVGSPLSLQCTVKGVSSPNLYWYRQAAEGSLQALFFSIGVGQVDPEGPQNLSASRPQDDQFILSSPKLLLSDSGFYLCAWS
Oryctolagus cuniculus V1574 ighv AAGW02074337.1 13233 LQCQSVEESGGRMVKPDETLTLTCTVSGIDLSSNAMSWVRQAPGERLEWIRTISTGGSTYYASWAKGRFTISQTSTTVDLKMTSLTASDTATYFCARDRVRG
Oryctolagus cuniculus V1575 ighv AAGW02074341.1 9617 VQCQEQLLESGGGLVQPGGTLKLSCKGSGFDLSSNAMCWVRQAPGKGLEWIGCIIYGSTDYASWVNGRFTISSDTAQSSVDLQLNSLTAADTATYFCAR
Oryctolagus cuniculus V1576 ighv AAGW02074343.1 31399 VQCQEQLKESGGGLVMPGGSLKLCCKASGFTFSSNAMCWVHQAPGKGLEWIACIDSYGSTNYVSRVNGRFTISSDNTQNMVDLEMTSLTAADTATYFCAR
Oryctolagus cuniculus V1577 ighv AAGW02074345.1 9836 SVLEKSGGGLFKPGGSLKLSCKASGFIFSDNYAMCWFRQAPGKGLEWIAYINTGSGSTYYASWVNGRFTISRNTKENTVSLKMTSLTAADTAAYFCVR
Oryctolagus cuniculus V1578 ighv AAGW02074348.1 103970 VQCQKQLKESRGGLVQPGESLKLCCKASGFTFSSNAMCWVHQAPGKGLEWIACIDSYGSTNYASWVNGRFTISSNNAQNMVDLEMNSLTAADMATYFCAR
Oryctolagus cuniculus V1579 ighv AAGW02074348.1 71216 SGAAGGVRGRPGHTWGSLTLTCTASGFSLSSYGVSWVRQAPGKGLEWIRYISISGSAYYASWVNGPFTISKTSSPVDLKMTSLTASNTATYFCAR
Oryctolagus cuniculus V1580 ighv AAGW02074348.1 50391 VQRQEQLKESGGHLVTPGGILKLFCTASGSDISSYGVSWVRQAPGKGLEWIGYISYGGSAYYKSWGKGQFTISKTSSTVDLKMTILTASDTATYFCAR
Oryctolagus cuniculus V1582 ighv AAGW02074348.1 30872 AGGGLVKPGGSLELCCKASGFSLSSSYWICWGRQAPGKGLVWIGCIYACSGSTYYASWVNGRFTLSRDIDQSTGCLQLNSLTAADTAMYYCAR
Oryctolagus cuniculus V1583 ighv AAGW02074348.1 18916 VQCQEQLKESGGGLVQPGGSLKLSCKASGFDFSSYGVSWVRQAPGKGLEWIGYIDPVFGSTYYASWVNDRFTISSHNAQNTLYLQLNSLTPADTATYFCAR
Oryctolagus cuniculus V1584 ighv AAGW02074348.1 11932 VQCQEQLKDSGGRLVTPGGILTLTCTASGSDISSYGVSWFRQAPGKGLEWIRYISYGGSAYYKSWAKGRFTISKTSSTVDLKMTSLTASDTATYFCAR
Oryctolagus cuniculus V1585 ighv AAGW02074350.1 33654 VQCQQLEESGGGLVKPGGSLELCCKASGFTFSSYYMCWVRQAPGKGLEWIGCIYAGSGSTHYASWVNGRFTLSRDNAQSTVCLQLNSLTAADTATYFCAR
Oryctolagus cuniculus V1586 ighv AAGW02074351.1 24034 AGGGLVKPGGSLELCCKASGFTLSSSYWICWVRQAPGKGLEWIGCIYAGSSGSTYSASWVNGRFTLSRDIDQSTGCLQLNSLTATDTAMYYCVR
Oryctolagus cuniculus V1587 ighv AAGW02074352.1 24876 CLCLQVPVSGTAGGILGRPSPAWGSLTLTCAVSGFSLSSYAMIWVRQPPGEGLEYIGIIYTGGSAYYASWVNGRFTISKTSSTVDLKMTGLTASDKATYFCAR
Oryctolagus cuniculus V1622 ighv AAGW02078243.1 8297 VQCQSVKESEGGLFKPTDTLTLTCTVSGFSLSSNAISWVRQAPGNGLEWIGAIGSSGSAYYASWAKSRSTITRNTNLNTVTLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1624 ighv AAGW02078677.1 39798 AGGGLVKPGGSLELCCKASGFTLSSSYWICWVRQAPGKGLEWIGCIYAGSSGSTYSASWVNGRFTLSRDIDQSTGCLQLNSLTATDTAMYYCVR
Oryctolagus cuniculus V1626 ighv AAGW02078677.1 26926 VQCQEQLKESGGGLVTPGGTLTLTCTASGFTISSYHMSWVQQAPGKGLEWIGDIYAGSGSTWYASWAKGRFTISKTSTTVDLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1627 ighv AAGW02078677.1 16596 VQCQSVEESGGGLFKPGGSLKLSCKASGFIFSDNYAMCWVRQAPGKGLQWIAYINTGSGSTWYTSWVNGRFTISRNTKENTVSLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1628 ighv AAGW02078681.1 7481 SGQLEEAGGGLVTPGGTLTLTCTVSGFSLSSYGVSWVRQAAGKGLEWIGYSSSSGSIYYASWVNGRFTISKTSSTVHLKMTSLTASDTATYFCAR
Oryctolagus cuniculus V1629 ighv AAGW02078682.1 13775 VQCQEQLEESGGRLVTPGGNLTLTCTASGFDISRYNMQWLRQAPGKGLEYIGWTSSSGSAYYASWVNGRFTISRTSTTVDLKLTSLSAADIATYFCAR
Oryctolagus cuniculus V1630 ighv AAGW02078683.1 8342 IQCQSLEESGGGLVTPGGSLTLTCTASGSISSYYISWVRQAPGKGLEYIGYISSGGSTYYASWVNGRFTISKTSTTVDLKLTSLRAVDTATYFCAR
Oryctolagus cuniculus V1631 ighv AAGW02078683.1 580 VQCQEQLKESGGGLVTPAGTLTHTCTASGSDISSYYISWVRQAPGKGLEYIGYISSSGSAYYASWVNGRFTISKTSTTVDLKLTSLSAADIATYFCAR
Oryctolagus cuniculus V1632 ighv AAGW02078784.1 78096 GVQCQEQLEDSGGGLVTPAGTLTLTCTASGSDISSYSIGWVHQVPGKGLEWIGYISTGGSAYYASWVNGRFTISKTSTTVHLKMTGLRAADTATYFCARDRVRG
Oryctolagus cuniculus V1633 ighv AAGW02078784.1 65409 VQCQELLKESRGGLVMPGGTLTLTCTASAFTISSYHMCWVHQAPGKGLEWIGYIYVSSISTYYASWVNGRFTISSNTNQNTVSLQMTSLTAVDKATYFCAR
Oryctolagus cuniculus V1634 ighv AAGW02078784.1 54400 VQCQEQLKESGGRLVTPGGILTLTCTASGFSISSYRMCWVCQAPGKGLEYIGYISYGGSAYYKSWAKGRFTISKTSSTVDLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1635 ighv AAGW02078784.1 46663 CLCLQVSSVRNSWRNPGQSKSCLGFLTLTCTVSGFSLSRYAMIWVRQAPGEGLEYIGIIYTGGSAYYASWVNGRFTISKTSSTVDLKMTGLTASNTATYFCAR
Oryctolagus cuniculus V1636 ighv AAGW02078784.1 34861 VLCQEQLKESGGGLVQPGGSLTLSCKASGFDFSSYYMSWVRHTPGKGLEWIGTIYAGKGRTYYASWVNGRFTIFSDNAQNTVDLQMNSLTAADMATYFCAR
Oryctolagus cuniculus V1637 ighv AAGW02078784.1 27847 VQCQSVEESGGRLVKPDESLTLTCTASGFSLSSYYMIWVRQAPGKGLEYIGIISYGGSTYYASWAKGRFTISKTSTTVTLTITDLQPSDTGTYFCAR
Oryctolagus cuniculus V1638 ighv AAGW02078785.1 9167 VQCQEQLVESRGGLVQPGGSLTLSCKASGFTISSYAMSWVCQAPGKGLEWIGFIYTDGSTYYASWVNGRFNISKTSTTVMQKMTSLRAADTATYFCAR
Oryctolagus cuniculus V1643 iglv AAGW02079118.1 23308 SQPVLTQPDALLVFPGQVAQLSCTLSPQHASIWDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPEDVPDRFSASKDAAHNACILTINPVQPEDDADYYCSVG
Oryctolagus cuniculus V1653 ighv AAGW02079997.1 48316 VQCQEQLKESGGRLVTPGGILTFTCTASGSDIISYGVSWVRQAPGKGLEWITYISYGGSTYYKSWAKGRFTISKTSSTVDLKMTSLTASDTATYFCAR
Oryctolagus cuniculus V1654 ighv AAGW02079997.1 40562 YLCLQVPVSGTAGGILGRPSPAWGSLTLTCAVSGFSLSRYAMIWVRQAPGEGLEYIGIIYTGGSAHYTSWVNGRFTISKTSSTVDLKMTGLTASDKATYFCAR
Oryctolagus cuniculus V1655 ighv AAGW02079997.1 28802 VQCLSLEESGGGLFKPGGSLKLSCKASGFIFSDNYAMCWFRQAPGKGLEWIACIKTGSGSTWYASWVNGRFTMSRNTKDNTVSLKMTTLTAADMATYFCVR
Oryctolagus cuniculus V1656 ighv AAGW02079997.1 9572 AGGGLVKPGGSLELCCKASGFTLSSSYWICWVRQAPGKGLEWIGCIYAGSSVSTYYVSWVNGRFTLSRDIDQSTGCLQLNCLTAADTAMYYCAR
Oryctolagus cuniculus V1663 ighv AAGW02080504.1 49143 VQCQEQLKESGGSLVTPGGILTLTCTASGFSISSYRMGWVRQAPGKGLEYIGYISYGGSAYHKSWAKGRFTISKTLSTVDLKMTSLTASDTATYFCAR
Oryctolagus cuniculus V1664 ighv AAGW02080504.1 29201 VQCQEQLKESGGRLVTPGGILTLTCTASGSDVSSYYMSWVRQAPGKGLEWIRYISYGGSAYYKSWAKGRFTISKNSTTVTLKMTSLTASDTATYFCAR
Oryctolagus cuniculus V1667 ighv AAGW02080923.1 26954 GVQCQSLEESGGGLVTPGGTLTLTCTASGSDISSCSIGWVYQAPGKGLEWIGYISYGGSAYYASWVNGRFTISKTSTTVDLKMTSLKAADTATYLCAR
Oryctolagus cuniculus V1668 ighv AAGW02080923.1 14076 SGAAEGVRGGLVTPGGNLTLTCTASGFDISSYNMQWVRQSPGKGLEYIGYISYGGSTYYASWVNGRFTISKTSTTVDLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1669 ighv AAGW02080923.1 7065 VQCQSVEESGGDLVKPDKTLTLTCTVSGFSLSSYAMIWVPQAPGKELEWIGFIYTDGSTSYASWAKGRFTISRTSTTVDLKMTSLTATDTATYFCAR
Oryctolagus cuniculus V1670 ighv AAGW02080960.1 10034 VQYQEQLVESRGGLLQPGRSLTLSCKASGFTISSYGVSWVCQAPGEGLEWIGYIYTDGSTYYASWVNGRFTISKTSTTVDPKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1672 ighv AAGW02081056.1 10671 VQCQQLEESGGGLVKPGESLKLCCKASGFTFSSYYMCWVHQAPGKGLEWIGCIYAGSGSTHYASWVNGRFTLSRDNAQSTVCLQLKSLTAADTATYFCAR
Oryctolagus cuniculus V1673 ighv AAGW02081122.1 12494 VQCQEQLKESRGGLVQPGGSLKLSCKASGFDLSSYAMCWVRQAPGMGLEWNGEINPNGGSTWYASRVNGRFTVSRNNVKSTLDLQMSSLTAADTSLYYCAR
Oryctolagus cuniculus V1675 ighv AAGW02081138.1 17586 VQCQSVKESGGGLFKPTDTLTLTCTVSGFSLSSNAISWVPQAPGKGLEWIGIINSYGSTYYASWAKSRSTITRNTNENTVTLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1676 ighv AAGW02081138.1 4216 VQYQEQLEESGGHLVTPGGSLTLTCTASGFSLSSYNMGWVRQAPGKGLEYIGYISSAGSTYYASWVNGRFTISKTSTTMDLKMNSLTASDTATYFCAR
Oryctolagus cuniculus V1678 ighv AAGW02081234.1 21044 VQCQEQLKESGGRLVTPGGILTLTCTASGSDISSYGVNWVRQAPGKGLEWIRYIYAGSGSTWYTSWAKGRFTISKTSSTVDLKMTSLTASDTATYFCAR
Oryctolagus cuniculus V1680 ighv AAGW02081234.1 1501 AGGGLVKPGGSLELCCKASGFDFSSSYWICWVRQAPGKGLEWIGCIYAGSSGSTYYASWVNGRFTLSRDIDQSTGCLQLNSLTAADTAMYYCAR
Oryctolagus cuniculus V1683 ighv AAGW02081589.1 2010 VQCQEQLLESGGGLVKPVRSLKLSCKVSGFTFSSNYYMCWVCQAPGKGLEWIGYIYPDYGSTDYASWVNGRFTISSDNAQNTVDLQMTGLTAADTATYFCAR
Oryctolagus cuniculus V1684 ighv AAGW02081622.1 4062 VQCQEQLKESGGGLVQPGGPLTLSCKASGFDFSSYYMSWVRQAPGKGLEWIGIIYVGKGSTDYASWVNGRFTISSDNAQNTVDLQMNSLTAADTATYFCAR
Oryctolagus cuniculus V1685 ighv AAGW02081685.1 17967 VQCQQLEESGGGLVQPGGSLKLCCKASGFTFSSYYMCWVRQAPGKGLEWIGYIYAGSGSTHYASWVNGRFTLSRDKAQSTVCLQLNSLTAADTATYFCAR
Oryctolagus cuniculus V1686 ighv AAGW02081685.1 6915 VQCQKQLVESGGGLDQPGLSLKLSCKASGFTLSSNAMCWVHQALGKGLEWIACIEFYGSTNYASWVNGRFTISSDNTQNMVDLEMNSLTAADMAIYFCAR
Oryctolagus cuniculus V1688 ighv AAGW02082429.1 2332 VQCQELVESGGGLVQPGESLKLSCKASGIDFSSYSISWVRQAPGKGLEWIAYIYPGFGITNYANSVKGRFTISSDNAQNTVFLQMTSLTASDTATYFCAR
Oryctolagus cuniculus V1689 ighv AAGW02082571.1 10995 VQCQSLEESRGGLIKPTDTLTLTCTVSGFSLSSYAISWVRQAPGNGLEWIGIINSYGSTYYASWAKSRSTITRNTNENTVTLKMTSLTAADTATYFCAR
Oryctolagus cuniculus V1690 ighv AAGW02082571.1 8245 VQCQEQLKESGRGLVQPGGSLTLTCTASGFTISSNAMIWVRQAPGKGLEYIGFINTGGSTNYASWANGRFTISSDNAQNTVSLQMNSLTAADTYFCAR
Oryctolagus cuniculus V1692 ighv AAGW02082936.1 5459 VQCQEQLEESGGGLVKPGGSLELCCKASGFTFSSYYMCWVRQAPGKGLEWIGCIYAGSGSTHYASWVNGRFTLSRDNAQSTVCLQLNSLTAADMATYFCAR
Oryctolagus cuniculus V1693 ighv AAGW02082959.1 2681 VQCQQQLKESGGGLVTPGGSLTLTCTASGFIISSYHMCWVRQAPGNGLEWIGYIYASSISTYYASWVNGRFTISSNTNQNTVSLLMTSLTAADTATYFCAR
Oryctolagus cuniculus V1694 ighv AAGW02083071.1 5866 VQCQEQLKESGGGLVQPGGSLKLSCKASGFDFSSYYMSWIRQAPGKGLEWIGIIYAGSGSTDYASWVNGRFTISSDNAQNTVDLQMNSLTAADTATYFCAR
Oryctolagus cuniculus V1695 ighv AAGW02083164.1 904 VQGQEQLEESGGGLVQPGGSLKLSCKASGFDFSSYYMSWVHQAPGKGLEWIGYIDPVFGSTDYASWVNGRFTISSDNAQNKLYLQLNSLTAADTATYFCAR
Oryctolagus cuniculus V1696 ighv AAGW02083341.1 5683 VQCQSLEESGGRLVKPDETLTITCTVSGIDLSSNAMSWVRQAPGEGLEWIGTISTGGSTYYASWAKGRFTISKTSTTVDLKMTSLTAADTATYFCARDTVRG