WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mustela putorius furo AEYP00000000.1 (AEYP01) 187 18 32 48 57 18 8 6
Mustela putorius furo AGTQ00000000.1 (AGTQ01) 178 9 33 48 57 17 8 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mustela putorius furo V28 trgv AEYP01005243.1 40128 GGAGLKLSQTALLVARVGSSTPLDCKVDAWVKYIHWYRHQEGTAPKRLLYLDMSTSLVQRDFVLKADKVNANKGRDSYSCTLSLLKLEKSDEGVYYCAAWA
Mustela putorius furo V29 trgv AEYP01005244.1 4430 GGAGLKLSQTALLVARVGSSCSLDCQVDSSVSYIHWYRHQEGTAPKRLLYLDMSRSLVQRDFVLKADKVYAQKGKDSYSCTLSLLKLEKSDEGLYYCAAWV
Mustela putorius furo V30 trgv AEYP01005256.1 12554 GGAGLKLSQTALLVARVGSSCSLDCQVDSSVSYIHWYRHQEGTAPKRLLYLDMSRSLVQRDFVLKADKVYAQKGKDSYSCTLSLLKLEKSDEGLYYCAAWV
Mustela putorius furo V31 trgv AEYP01005261.1 22009 GHTVMRLEQPAVVVACESTSAILSCTANTKVNYIHWYRHQEGKSLQRILHLTMDQSVVHWDLVEKAEKVTAIGAKDGYSCTLLVLKLEKSDEDMYYCAFWE
Mustela putorius furo V32 trgv AEYP01005263.1 2726 GLGQATLKQHEISVSRARDKSAHISCNVSAKNFNSETIYWYRQKPDQEIEYLTDVITDRVQVPLDGKNNKFEASKNTHTSTSTLKINFLEKEDEAIYYCGSWNW
Mustela putorius furo V33 trgv AEYP01005263.1 11986 ADADFLITQLVPSITKKQGNTAFLECHIKAGGLRNNVYIHWYQQKPDQPLKRILYISSNENVVHEQGVNEERYEARKWQRDLPASLRIHRVNEEDAGLYYCACWD
Mustela putorius furo V34 trgv AEYP01005268.1 1075 GLGQVKLEQPEISISRERYKSAHILCKVSSKDFTNEVIHWYRQKPHQEIEHLTYILTSYTQVSLGGKKTKLEATKNAITSTSTLKVNFLEQEDEAMYYCACWRG
Mustela putorius furo V35 trgv AEYP01005270.1 2032 GLGQVKLEQPEISISRERYKSAHILCKVSSKDFTNEVIHWYRQKPHQEIEHLTYILTSYTQVSLGGKKTKLEATKNAITSTSTLKVNFLEQEDEAMYYCACWDW
Mustela putorius furo V65 igkv AEYP01011048.1 52890 VHGDITMTQSPGSLAVSPGQRVTINCRASQSVSNYVAWYQQKPGQSPRLLIYYASSRATGIPDRFSGSGSGTDFTLSISNLQAEDVGDYYCQHHYSY
Mustela putorius furo V66 igkv AEYP01011048.1 57786 CTGDIVLTQSPASLTMSPGQRTTISCKTSQEVSDILGITHCITWYQQKSGQCPRILIYKASSGVCGVPVRFNGGRSGTEFSLTTGLVEDGDAASYYCQKSKETP
Mustela putorius furo V67 igkv AEYP01011050.1 31654 AHGDITMTQSPGSLAVSPGQRVTMNCRASQSVSKYVAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGSYYCQQYKNY
Mustela putorius furo V68 igkv AEYP01011057.1 2993 SHGDIMMTQSPGSLAVSPGQRVTLNCRASQSVSNYVAWHQQKPGQAPRLLIYRASNRATDIPGRFSGSGSGTDFTLTISNLQAEDVGNYYCLQYDSFP
Mustela putorius furo V69 igkv AEYP01011060.1 5419 AHGDITMTQSPGSLAVSPGQRVTMNCRASQGVYSNVAWYQQKPGQAPRLLIYDASSRDTGIPDRFSGSGSGTDYTLTISNLQAEDVGNYYCQQYDSFL
Mustela putorius furo V70 igkv AEYP01011063.1 5971 AHGDITMTQSPGSLAVSPGQRVTMNCRASQSVNNYVAWYQQKPGQAPRRLIYAASSRDTGIPDRFSGSGSGTDYTLTISNIQAEDVGSYYCQQGYSS
Mustela putorius furo V71 igkv AEYP01011064.1 14322 SSGEVVLTQTPLSLSVTPGEPASISCRASQSLVHSNGNTYLSWFRQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQG
Mustela putorius furo V72 igkv AEYP01011064.1 32981 SSGDIMLTQTPLSLSITPRELASISCRASQSLLHRDGNTYLYWYLQKPGQSPQLLIYEVSIHKSGVPDRFSGSGSGTDFTLRISKVEDDDVGVYYCEQG
Mustela putorius furo V73 igkv AEYP01011064.1 37249 SNGEVVLTQTPLLLSVTPGEPASISCKASQSLVHSNGNTYLDWYLQKPGQSPQLLIYEVSNRYTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQR
Mustela putorius furo V74 igkv AEYP01011065.1 4712 SSGEIMMTQTPLSLSVTPGEPASISCRASQSLVHSNGNTYLSWFRQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCGQG
Mustela putorius furo V75 igkv AEYP01011066.1 9022 SSGEAVLTQTTPLTLSVTSGEPASNSCRASQSLVHSNGNTSLNWYLQKPGQSPQILIYLVSSRVSGIPDRFSGSGSGTDFTLTISRVEAGDVGVYYCQQD
Mustela putorius furo V76 igkv AEYP01011066.1 15575 SSGEVVMTQTPLSLTVTPGEPASISCRASQSLVHSDGNTYLHWYLQKPGQSPQLLIYSHFTGVPDRFSGSGSGTDFTLTINRVEADDVGVYYCQQGIQYP
Mustela putorius furo V77 igkv AEYP01011069.1 1065 AHGDVTMTQSPGSLAVSPGQRVTMNCRASQGVYNNVAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGDYYCQQYNY
Mustela putorius furo V78 igkv AEYP01011069.1 32044 AHGDITMTQSPGSLAVSPGQRITMNCRASQSVSNYVAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGNYYCQQGNSF
Mustela putorius furo V79 igkv AEYP01011070.1 13420 AHGDITMTQSPGSLAVSLGQRVTMNCRASQNIYSNVNWYQQKPGQAPRLLIYAASSRATGIPGRFSGSGSGTDFTLTISNLQAEDVGDYYCQEGYNYP
Mustela putorius furo V80 igkv AEYP01011073.1 27735 ACGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYAASSRATGIPDRFSGSGSGTDFTFSISNLQAEDVGDYYCQQYYSSL
Mustela putorius furo V81 igkv AEYP01011075.1 21726 VSGDIVMTQSPASLNGSPGERIAMNCKSSQSLLYSSNQKNYLAWYQQKPGQAPKLLIIWASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVGDYYCMQYYSFP
Mustela putorius furo V82 igkv AEYP01011075.1 25438 CSGDIVLTQSPASLTVSPGQRATISCKTSQNVGDIWGMTHYITWYQQKSGQRPRMLIYKASSQASGAPARFSGSGSGTEFSLTIDPVEDGDAANYYCKQSKE
Mustela putorius furo V83 iglv AEYP01011094.1 639 SMASYVLTQPPSLSVNLEQTAKITCGGNNIGGKSVHWYQQKPAQVPVLIIYNDKNRPSGIPDRFSGTNSGNTATLTISGTRAEDEADYYCQVWDSGTN
Mustela putorius furo V84 iglv AEYP01011095.1 5727 SVTSELTQPPSVSAALGQTATITCTGEEVEYIYVYWYHQKPGQAPLTVTYDDSDQPSGIPEKFSGSKSGNTATLTISSAQAKDEADYYCQSLTAVVM
Mustela putorius furo V85 iglv AEYP01011097.1 10661 SMASYVLTQPPSISVKLGQTAKITCGGDNIGNKYAYWYQQKPGRVPVLIIYEDSKRPSGIPDQFSGTNSGNTATLTISGARAEDEADYYCQVWDSSTN
Mustela putorius furo V86 iglv AEYP01011097.1 26157 SVVSSEVTQPPFVSVALGQTATITCTGEKVKYSSIHWYQQKPGQAPLTVIYAEIERPSGIPERFSGSRSGNTATLTISSVQAEDEADYYCQSHYSYDN
Mustela putorius furo V87 iglv AEYP01011099.1 12481 STVAYELTQDSSVSVNLGQTARITCRGDNIGSKYAYWYQQKPSQAPLLIIYGDSNRPSGIPERFSGTNSGNTATLTISGAQAEDEADYYCQVWDSGN
Mustela putorius furo V89 iglv AEYP01011185.1 42314 SQPGLPQPDALLVFPGQVAQLSCMLSPSHATIGEYGVSWYQQRAGSAPRYLLYYRSEDDYHRPPDIPDRFSAATDAAHNACILIISPVQPEDEADYYCSVA
Mustela putorius furo V191 trdv AEYP01038920.1 110912 KSVLCDQVTQSPPDQIVASGSSVKLFCTYYTSESNPDLYWYRIWPDHSFQFILYRDKTLSHNADFTGGRFSVLHNPSQRTFHLVIFLVEPEDSATYFCALNP
Mustela putorius furo V375 iglv AEYP01102023.1 5736 SWAQSSLTQEASLSASVGQEVTLNCAGNDNNVGAYYVGWYQQVSGGAPKTVMLGTTRPSGIPDRFSGSHSGNKASLIISNLWPEDEADYYCSTWDKGINN
Mustela putorius furo V376 iglv AEYP01102028.1 9125 ADSQTVVIQEPSLWVSPGGTVTLTCGLSSGSVSSNNYPYWYQQTPGKTPRLLIYDTNNRLPGVPGRFSGSISGNKAALTITGAQLEDEADYHCLLYMGSGS
Mustela putorius furo V378 iglv AEYP01102034.1 15582 SWAVLTQPPYVSGALGESVTISCTGIPTSIDYDEEEYTYNVNWYQQLQGKVPILLIYGDNNRNPGVPDRFSGSKSGSSASLTISGLQAEDEADYYCQ
Mustela putorius furo V379 iglv AEYP01102042.1 2213 TSSEAVVTQEPSLTVSPGETVTLTCASSYGAVSNGHFPCWFQQKPGQSPRTLIYNTHNKPSWTPARFSGSLLGGKAVLTLTGAQPEDEAEYHCFLQYGDG
Mustela putorius furo V380 iglv AEYP01102063.1 5864 SMASSVLTQSPSVSVSLGQTATITCSGEILSKSYARWHQQKPGQSPVNIIYKDTQRPSGIPDRFSGSSSGSTHTLTISRAQAEDEADYYCQGWDGNGK
Mustela putorius furo V381 iglv AEYP01102063.1 25939 SVASSVLTQSPSVSVSLGQTATITCSGEVLNKKYAQWFQQKPGQAPMLVIYKDTERPSGIPDRFSGSSSGTTHTLTISGTRAEDEADYYCQSYDSNTD
Mustela putorius furo V382 iglv AEYP01102063.1 32845 SVASYVLTQPPSVSVALGKTAQVTCGGNNIGNKYVHWYQQKAGQAPVLIIYESNKRPSGIPERFSGTNSGNTATLTISGARAEDEADYYCQVWDSSSN
Mustela putorius furo V388 iglv AEYP01104249.1 30640 FSGSMAFSVLTQPHSVSVSLGQTATIICSGEVLSKYYAQWYQQKAGQAPKQVIYKDTECPSGIPDQFSGSSSGTTHTLTINGAQAEDEADYYCQSSDSSDK
Mustela putorius furo V389 ighv AEYP01104659.1 7085 VQCEMKLVESGGDLVKPGGSLRLSCVASGFTFSSYGMTWVCQDPGKGPQWVAGIWIDGSFTSYVDSVKGQFTISRDNGKNTLYLQMNSLRSNDMDVYYCAR
Mustela putorius furo V390 ighv AEYP01104666.1 8911 AQCEMQLVESGGDLVKPGGSLRLSCEASGFTFSGYGMSWVRQAPGKRIELVSNIDAGGGSTSYTDSVKGRFTISRDNAKNTLYLQMNSLRTEDTAMYFCAK
Mustela putorius furo V391 ighv AEYP01104671.1 4274 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTISNNEMNWVRQAPGMGLQWVAYINSVGSTYYADSVKGRFTISRDNSKNTLHLHMSNLNAEDTAVYYCAR
Mustela putorius furo V392 ighv AEYP01104676.1 2167 IHREMQLVESGGDLVKPEGSLRLSCAASGFTFSSYGMSWVRQAPGNGLQWVAGISYDGSSTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAT
Mustela putorius furo V394 iglv AEYP01105999.1 1315 SMSAYVLTQPPSMSVNLGQMASITCSGDNIGGIYVSWQQLKLGQTPMTIIYSDSNQPSGIPDRFSGSNSGNMATLTISGAQAEDEAITDYYCAYDSSRDT
Mustela putorius furo V395 iglv AEYP01105999.1 7424 SMASYVLTQPPSVSVALGQTAQVTCTGNNIGSKHVYWYQQQPGHIPVLIIYNSNKRPSGTPERFSGTGSGNTATLTISGAQAEDEADYYCHMLDSSAD
Mustela putorius furo V396 iglv AEYP01106001.1 2723 SVASYVLTQPPSVSVALGQTAQVTCGGNNIGNKFVHWYQQKPGQAPVLIIYNSNKRPSGIPERFSGTKSGNTATLTISGSRAEDEADYYCQVWDRSSD
Mustela putorius furo V398 iglv AEYP01107449.1 10787 SWSQSVLTQPPSVSGTLGQRVTISCTGSSNNIGDYGVTWQQQLPGTAPRTIIYANTYRPSGVPDRFSGSQSGSDATLTITGLQPEDEAEYYCATWDNSLR
Mustela putorius furo V399 ighv AEYP01107866.1 1344 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYYMYWVRQAPGKGLQWVAGISRDGSSTSYADSVKGRFTISRDNGKNTLYLQINSLRSEDTAVYYCAR
Mustela putorius furo V400 ighv AEYP01107872.1 1156 VQCVVQLVESGGDLVKPRGSLRLSCAASGFTFSNYHMDWVHQAPGKGLQWVAEISNTGSSTNYADSVKGQITISRDNGKNTLYLQMNSLRVEDTAVYYCAT
Mustela putorius furo V401 iglv AEYP01107926.1 14043 FVAAYELTQPPLMSVNLGRTASITCSRDNIGNTYVSWYQQKLGKAPMMIIYSGSNRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCLSYKSGSGN
Mustela putorius furo V403 iglv AEYP01108379.1 2278 SSAQSMLTQPPSVSGALGQRVTISCTGSSSNIGSGNYVYWYQQLPGITPKLIIYGSSNRPSGVPDRFSGSRSGSSGTLTITGLHTEDEADYYCSAWDDSLN
Mustela putorius furo V406 iglv AEYP01112098.1 956 SVVSSELTQTPFVSVAPGQTATITCSGEELDYGYVQWYQQKPGQAPLMVIYLDNERASGIPERFSGSKSGNTATLTISSVQAEDEADYFCQSYDSSGN
Mustela putorius furo V407 igkv AEYP01112294.1 1066 SSGEVVLTQNPLSLSITLGEPASISCRASQSLLHSNRYNYLHWYLQKPGQSPQLLIYLATNRFSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQSLHV
Mustela putorius furo V408 trav AEYP01112886.1 1126 SSIAQKITQAQPAMLVQEKGTVILECTYNTNEPRYSLLWYKQPSSGAMVFLIRQDSYNLQNATEGRYSLNFQKTRNFIQLVISASQLEDSAVYFCALRE
Mustela putorius furo V454 igkv AEYP01011050.1 4043 SGGEVVLTQTPLLLPVTPGEPASISCRASQSLIHSDGNTYLHWYLQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCYQN
Mustela putorius furo V455 igkv AEYP01011053.1 2645 SSGKVVLTQTPLSLSVTPGESGSISCRASQSLVHSDGNTYLSWYLQKPDQSPQLLIYMVSNRFTGLPERFSGSGSGTDFTLTISRVEADDVGVYYCGQF
Mustela putorius furo V456 igkv AEYP01011056.1 10307 VRRHTGLTQSPAFLSVSLREGVSITCRAKESVSDYLSWYQQKPGQDPQLLIYDADNLKSGVPDRFSVIQLDREFILNISSVEAEDAASYYCQQDYTLP
Mustela putorius furo V457 igkv AEYP01011060.1 17281 SDGEVVLTQTPLSLSITPGESASISCRASQSLVHSNGNTYLSWYLQKPGQSPQLLIYKVSNRFTGVPDRFTGSGSGTDFTLRISRVEVDDVGIYYCQQGLQYP
Mustela putorius furo V458 igkv AEYP01011063.1 18362 SSGKVVLTQTPLSLSVTPGESGSISCRASQSLVHSDGNTYLSWYLQKPDQSPQLLIYMVSNRFTGLPERFSGSGSGTDFTLTISRVEADDVGVYYCGQF
Mustela putorius furo V459 igkv AEYP01011063.1 11181 SIGEVVLTQTPLSLSVTPGEPVSISCRASQSLVHSNGNTYLHWYLQKPGQSPQLLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCFQG
Mustela putorius furo V460 igkv AEYP01011064.1 47839 SHGEITMTQSPGSLAVSPGQRVTLNCKASQSVSNYVNWYQQKPGQSPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGSYYCQQAYSSP
Mustela putorius furo V461 igkv AEYP01011064.1 4157 ACGDITMTQSPGSLAVSPGQRVTLNCRASQSVSNYVAWYQQKPGQSPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGNYYCQQYDNY
Mustela putorius furo V462 igkv AEYP01011067.1 12777 SSGEAVLTQSPLTLSVSPGESASISCRASQSLVHSNGNTYLHWYLQKPGQSPQGLIYRVSNHYTGVPDRFSGSGSETDFTLRISRVEANDVGVYYCGQGTIQNL
Mustela putorius furo V463 igkv AEYP01011069.1 26805 FPGENVLTQSSAILSMVPKERVSITCRASQNINKWLAWYQQEPGRAPKLLICETSKLETGVTSRFSGSESGTDITLISSSLEPEDAGTYYCLQSNSY
Mustela putorius furo V464 igkv AEYP01011069.1 11913 SSRDIVLTQTPRSLSLTPGEPASISCRASQSLLHRDGNTYLYWYLQKPGQSPQLLIYEVSIHKSGVPDKFSGSRSGTDFTLKLSRVEDGDVGVYYCEQG
Mustela putorius furo V465 igkv AEYP01011069.1 7021 VVITQTPHLLPVIPGESASISCRASQSLVHSTGNTYLYWYLQRPGHSPQGLIYKVSNRFTGVPDRFSGSGSGTDFSLRISRVEADDVGVYYCGQGIHFP
Mustela putorius furo V466 igkv AEYP01011072.1 17764 SSGEVVLTQTPLSLSVTPGESASISCRASQSLVHSDGNTYLNWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCYQG
Mustela putorius furo V467 igkv AEYP01011072.1 998 SSGEVVLTQTPLLLSVTPGEPASISCRASQSLVHSNGNTYLHWYLQKPGQSPQLLIYKVSNRYTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCFQE
Mustela putorius furo V468 igkv AEYP01011073.1 8533 SSGDIVLTQTPLSLSITPGESASISCRASQSLVHSNGNTHLSWYLQKPGQSPQLLIYKISNHFTGVPDRFSGSGSGTDFTLTVSRVEADDVGVYYCGQD
Mustela putorius furo V469 igkv AEYP01011073.1 3389 GKIMMTQTPLSLPITPGEPASISCQASQSLVHNNENTYLHWYLQKPGQSPQGLIYRVSNHFTWVPDRFSGSGSGTDFTLRISTVEGDGVGVYYCGQS
Mustela putorius furo V470 igkv AEYP01011075.1 42898 ATGEIVLTQSPALLSLSPGEKATLNCRASQSASSYVAWYQQKPGQAPRLLIYGASTRATDIPARFSGSGSGTDFTLTISNLEREDAAIYHCHQYNIGY
Mustela putorius furo V471 igkv AEYP01011075.1 13519 SHGEIVLTQSPAVLSMAPKERVTITCQASQNINKWLAWYHQEPGRAPKLLIYEASKLITGVPSRFSGSGSGTDFTLTISSLEPEDAGTYYCLQSNSYP
Mustela putorius furo V472 igkv AEYP01011075.1 536 VCAHTELTQSPAFLSVSLGDSVSITCRVNESVSDYLSWYQQKPGQAPKHLIYDADNLKSGVPARFSAIQSDKEFTLKISAVEAEDAASYYCQQDYILP
Mustela putorius furo V473 igkv AEYP01011078.1 70215 SSGEIVLTQTPLSLSVSSREPASISCRASQSLLHSNGNNYLHWYLQKPGQSPQLLIFFATNRFSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQSLHV
Mustela putorius furo V474 igkv AEYP01011078.1 52223 SSGEIVMTQTPLSLPISPGEPASISCKASQSLLYSNGKTYLHWYLQKPGQSPQLLIYEVSNHFSGVSDRFSGSGSGTDFNLRISRVEADDMGVYYCGQSTEYP
Mustela putorius furo V475 igkv AEYP01011078.1 40643 SSGEVVLTQTPLSLSVTLGEPASISCRASQSLLHSTRYNFLHWYLQKPGQSPQLLIYLATNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQNLHA
Mustela putorius furo V476 igkv AEYP01011078.1 19131 SSGEIVMTQTPLSLPISPGEPASISCKANQNLLHSDGKTYLTWFRQKPGQSPQGLIYLLSKRFSGVSDRFSGSGSGTDFTLTISRVEADDVGIYYCGQSIQSP
Mustela putorius furo V477 igkv AEYP01011078.1 7428 SSGEVVMTQTPLFLPVTPGEPASISCRASQSLLHSDGNTYLYWYLQKPGQSPQLLIYGVSYRFLRVPGRFSGSGSGTDFTLRISRVEADDMGVYYCMQG
Mustela putorius furo V478 igkv AEYP01011081.1 11111 SSGEVVLTQNPLSLSITLGEPASISCRASQSLLHSNRYNYLHWYLQKPGQSPQLLIYLATNRFSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQSLHV
Mustela putorius furo V479 igkv AEYP01011081.1 3576 SSGDIVMTQTPLSLSVTPGKPVSISCRASQSLLHSNGMNYLYWYLQKPGQSPQSLIYLASSRYPGVPDRFSGRGSGTDFTLTISSVEAEDVGVYYCLQSLEFP
Mustela putorius furo V480 igkv AEYP01011082.1 26597 AHGHVGLTQSPAFLQVSLREGVSITCRANESVSDYLSWYQQKPGQAPQLLIYDADNLKSGVPDRFSAIQSDKEFILKISAVEAEDAASYYCQRGSIL
Mustela putorius furo V481 igkv AEYP01011082.1 23475 SSGEIVMTQTPLSLSVTPGEPASISCRASQSLLHSDGNTYLNWYRQKPGQSPQLLIYLVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDMGVYYCGQNLQSP
Mustela putorius furo V482 igkv AEYP01011082.1 17052 SSGEIVMTQTPLSLPITPGESASISCRASQSLLHSNGNTYLYWFRQKPGQSPQDLIYKVSNQYSWVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQNLQSP
Mustela putorius furo V524 trav AEYP01020962.1 39761 TSDQEFQVTQPESSVSVRAGEILTLSCNVSARSPAGPVLWFRENAQERKLIYNFNGGQFPRVTQVENTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Mustela putorius furo V589 trav AEYP01038921.1 143055 GTSGNSVQQTDQITVLEGESVTMNCVYTSTQYPTLFWYVQYPNQALQFLQRETMENSKNFGARNIKDKNSPITKSAVQMSDSAVYYCLLRDTHSDK
Mustela putorius furo V590 trav AEYP01038921.1 139623 VSGKPGVEHSPQYLTAQEGDSVTITCSYSIGMTALHWLQQNPGGHIVSLFILSLEMKKKGRVRATINTEELHSSLYITASQPRDSATYLCAV
Mustela putorius furo V591 trdv AEYP01038921.1 106248 SSNADNVRQSASVHEEEGKSVTLDCSFTLNFNYYVMCWYHQPPNGKMTEIISMFSDSSTNMEGRYTLSLQKRSRILKLTITGLMLADTGVYFCAIGEN
Mustela putorius furo V592 trdv AEYP01038921.1 69740 VSLDIVLEPDAKTLTVQVGEPATLRCSVTGGDLKNYQVSWYKKNEDNSLTLVYRPSNNTNDDLRSNFKGNTNPSKSQLDIQRTAAEDAGTYYCACD
Mustela putorius furo V593 trdv AEYP01038922.1 19929 SSTAQTVTQTQPDTSVRETETVTLHCTFDTSDTNYYLFWYKQPPSGEMSFIIRQESYNQKNATEDRFSVNFQKAQKSFGLRISDSRLEDAATYFCA
Mustela putorius furo V594 trav AEYP01038922.1 13179 SSTAQTVTQTQPDTSVRETETVTLHCTYDTTDTNYYLFWYKQPPSGEMSFIIRQEYYNQKNATEDRFSVNFQKAKKSFGLRISDSRLEDAAVYFCA
Mustela putorius furo V595 trav AEYP01038924.1 75292 VGSVSNVEQNPPWLHVQEGENTNFTCRFPSSNFYSLHWYRWEPAKPPMFLISVTLNGDEKRTGRVRTTLNTQEGYSSFYIRGCQPEDAATYFCAM
Mustela putorius furo V596 trav AEYP01038924.1 68434 INGQEIKQNPQFLLLQEGKDFTISCNASSILTSFQWYKQRPGGGPVLLISLLKGGEVKQKRLTARFGESRKDSFLHMEASQTADAGTYFCAGTQCSQ
Mustela putorius furo V597 trav AEYP01038924.1 55041 ESTQQLEQSPRFLSIQEGENFTAYCNSTSTFPSFQWYRQRLGEGPVHLMTLSKGGEMKKHKRLTAWFGEMRKDSSLLITAAQPVDAAIYICAG
Mustela putorius furo V598 trav AEYP01038924.1 48231 VRVQMKVEQSPRVLILQEGRNASMMCNYSISMTSMQWFQQSPEGHLTFSSYIASGTQQKGRLKFTVNIKERNSHLYITDSQPGDSVTYFCAVG
Mustela putorius furo V599 trav AEYP01038924.1 42981 VTSQQKGDQQQVKQTPSLSVQEGEISILTCDHNNDLFDYFSWYKKYPAKGPNFLISIRSVMDKNEDGRFTVFLNKSAKHLSLHIAGSQPGDSALYLCAAS
Mustela putorius furo V600 trdv AEYP01038924.1 25929 SSTAEKVIQTQRTLTIQEGESATFYCKYETSWSYYYTLYWYKQLPSGEMIFLIYQDESKPNAQQGRLSLDFQKAIKFISLTISPLKLTDSAMYFCAWGS
Mustela putorius furo V601 trav AEYP01038924.1 22669 IMSDADPTQPNAMEGTEGEPVHLPCNHSTISGNQYIYWYRQIPNQSPEYMIHGLKDNVTEGITSLIITRARKSSTLILPRVTLGDAAVYYCLLRE
Mustela putorius furo V602 trav AEYP01038924.1 16440 VSSQGLEQSPQSLIVQEGEDFTINCSSSKPVYALHWYRQKKSKSLISLMILWKNGEEKNHEETTATLDDKKQQSSLHIRAAQPSHSGTYLCAAD
Mustela putorius furo V605 trav AEYP01038926.1 129335 QTHGDSVTQTEGQMTLSEGASLTINCTFSTTWSPTVFWYVQYPGEGLELLLKALKDKETKHNKGFEATFNSKSKSFHLEKGSVQASDSAVYYCAMN
Mustela putorius furo V606 trav AEYP01038926.1 120327 VRGMTVEQSPSHRSLQEGASSTLKCNFSNAVNNVQWFRQNPGGGSLTRLFYIVSGMKQSGRLNCTVNTKDRSSTLHIGASQLEDSATYLCAVE
Mustela putorius furo V607 trav AEYP01038926.1 114357 FSQGENVEQHPSTLSVQEGGSSVINCSYSDSTSSYLPWYKQELGKGPQLLIDIFSSMTTKEDQRLTVSLNKTAKRFSLHVRDTQPEDSAVYFCAA
Mustela putorius furo V608 trav AEYP01038926.1 107188 QTHGDSVTQTEGQVTLSEEASLTINCTFSTSWSPTLFWYVQYPGEGLELLLKALRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDSAVYYCAMY
Mustela putorius furo V609 trav AEYP01038926.1 102904 SSIAQKITQAQPAMLVQEKGTVTLECTYNTNEPSYSLLWYKQPSSGEMVFLIRQDSYNQQNATEGRYSLNFQKTGNFIQLVISSSQLEDSAVYFCALRE
Mustela putorius furo V610 trav AEYP01038926.1 96388 QTHGDSVTQTEGQVTLSEEASLTINCTFSTSWSPTLFWYVQYPGEGLELLLKALRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDAAVYYCAMY
Mustela putorius furo V611 trav AEYP01038926.1 87605 VSGKDQVEQNPQSLVILEGENCTIQCIYSVTPFGSLRWYKQGTGRGPASLIVMDNDDGRKSNGRYTATLDTTSKHSSLHIRAIQLSDSALYICAVS
Mustela putorius furo V612 trav AEYP01038926.1 74022 MRSQQNRVEQSPGSLSLREGDAASLNCTYSDSASQYFTWYRQYSGKGPELLMYMYSKGNKTEGRFSGQVDRTKQYVSLLIRDSQLSDSATYLCAV
Mustela putorius furo V613 trav AEYP01038926.1 71671 GTGAQSVTQPDTHVTVSEEAALELRCNYSYSGTPYLYWYVQYPNQGLQLLLRYFSGNTLVKGIKGFEAEFRKTESSFHLRKHSAHGSDTAEYFCAVS
Mustela putorius furo V614 trav AEYP01038926.1 66580 GTGAQTVTQPEDHISVFEGDFVQIKCNYSYSGSPILFWYVQYPKQALQLLLKQISGESTKGFVANLNRDETSFHLKKQSAQQEDSAMYYCALS
Mustela putorius furo V615 trav AEYP01038926.1 62487 VNSQQEQHHQVLNFQEGENATMNCSYKTSISNLQWYRKDSGQGFVQLILIRSNEREKYRGRLRVTLDNSNKSSSLSIIASQTADSATYICAT
Mustela putorius furo V616 trav AEYP01038926.1 56151 GTSGDTVTQTEGSVTLPEGTPLTLNCTYQSSYSVVAFWYVQYQNKEPKLLLKSSSENRRVENHGFQASLKSDKSFHLEKRSVQMSDSAVYYCAVE
Mustela putorius furo V617 trdv AEYP01038926.1 42562 SSMAQNVTQAQPAISTLENETVTLDCVFKASGSTYYLFWYKQLPSGEMIFLILQESYMEQNATEGRYSLNFQKSDHSISLTIRALQLADSAVYFCALR
Mustela putorius furo V618 trav AEYP01038926.1 35471 VTGEDRVEQSPQTLRLQEGDRVRLNCSYTVSAFNGLQWYRQDPGQGPEFLFVLYAVGDEKQKERLRATLLKEGSSLHIEASKPEDSATYFCAVK
Mustela putorius furo V619 trav AEYP01038926.1 25783 VSSKQEVKQSPEALNIREQDSVVLNCSYTDGTLYSVQWFRQDPGKGLTLLMIILSNQKEQTSGRIKVLLDTRARQSSLYIVASQPSDSATYLCAV
Mustela putorius furo V620 trav AEYP01038926.1 10378 VTGAEVEQRPPTLSLQEGASATLQCNFSTSAANVQWYRQDRGGRLILLFYIPSGTKKNGRLSSTTVAKERRSSLYISSSQITDSATYYCAAEPQCSP
Mustela putorius furo V621 trav AEYP01038927.1 5106 FSQGENVEQHPPTLSVQEGSSSVINCSYSDSTSDYFPWYKQEPGKGPLLLTYVHSTVATKEDQRLTLSLNEMAKRFSLCIRDTHPEDSAVYFCAA
Mustela putorius furo V622 trav AEYP01038928.1 46005 QTHGDSVTQTEGLVTLFEEASLTINCTFSTTQYPALFWYVQYPGEGLELLLKASRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDSAVYYCAMY
Mustela putorius furo V623 trav AEYP01038928.1 27427 ARGMTVEQSPSDLSLQEGDSSTLKCNFSSTPDSVQWFRQHPGGGGLTRLFYIASGMKQSGRLNCTVNTKEQSSTLHIRASQLEDSATYLCAGE
Mustela putorius furo V624 trav AEYP01038928.1 22887 FSQGENVEQHPSTLSVQEGSSSVINCSYSDNNSEYFPWYKQEPGKGPQILVYILSSMATKEEQRLTVLLSKTAKRFSLHVRDTQPEDSAVYFCAA
Mustela putorius furo V625 trav AEYP01038928.1 14406 QTQGDSVTQTEVQVTLLEEASLTVNCTYSTTVFPTLFWYVQYPGKGLQLLLSSSRDQEKKSNKGFEVTLDSKSKSFHLEKGSVQASDSAVYYCALS
Mustela putorius furo V626 trav AEYP01038928.1 3170 VRGMTVEQNPSDLSLQEGANSTLKCNFSSTVNRVQWFRQNPGGGGFTSLFYIFSGMKQSGRLTCTVNTKEQSSTLHITASRLEDSATYLCAGE
Mustela putorius furo V627 trav AEYP01038929.1 6613 FSQGENVEQHPSTLSVQEGSSSVINCSFSDGRSDYFPWYKQELGKGLQFLIYIRSNMATKEDQRLTVSLNRTAKHFSLHIRDTQPEDSAVYFCAA
Mustela putorius furo V628 trav AEYP01038931.1 1113 VRGKNVEQTPSALSLQEGASYTLKCNFSSSIYSVQWFRQHPGDSGLTLLFYITSGMQHSGRLNCTVNTKDRYSTLHITTSQLEDSATYLCAVE
Mustela putorius furo V629 trav AEYP01038932.1 41289 VRGMTVQQTPSTLSLQEGANSTLKCTFSSTLGSVQWFRQHPRASSLTRLFYITSGMQHSGRLNCTVNTREQSSTLHIGASRLEDSATYLCAG
Mustela putorius furo V630 trav AEYP01038932.1 35468 FSQGENVEQHPSTLSVQEGGSSFINCSYSDGGSDYFPWYKQELGKGPQLLIYIRSSMATKEDQRLTVSLNKTAKRFSLHIRDTQPEDSAVYFCAA
Mustela putorius furo V631 trav AEYP01038932.1 9916 QTRGDSVTQTEGQVTLSENAFLTMNCTYSASRYPALFWYVQYPGEGLELLLKALKDKEKGSNKGFEATYDGKSNTFHLEKRSVQTSDSAVYYCAMN
Mustela putorius furo V632 trav AEYP01038933.1 3891 QTHGDSVTQVESQVTLSEEASLTINCTYTTTGYPTLFWYVQYPGEGLELLLKASRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDSAVYYCAMY
Mustela putorius furo V633 trav AEYP01038934.1 981 VRGMTVEQSPSALSLQEGASSTIKCNFSSTVYNVQWFRQHPRGGGLTRLFYITSGMQHSGRLNCTVNTKEQSSTLHIMASRLEDSATYLCAAQ
Mustela putorius furo V634 trav AEYP01038935.1 2635 QTRGNSVTQTEGQVTLSENAFLTMNCTYSASWYPALFWYVQYPGEGLELLLKALKDKEKGSNKGFEATYDGKSKSFHLEKRSVQASDSAVYYCAMN
Mustela putorius furo V635 trav AEYP01038937.1 942 VRGMTVEQSPSALSHQEGASFTLQCNFSQTAGSVQWFRQHPGGGGLTRLFYIASGMQQSGRLNCTVNTRERPSTLHIGASRLEDSATYLCAAQ
Mustela putorius furo V636 trav AEYP01038938.1 18450 VRGMTVEQSPSALRLQEGDSSTLKCNFSETARSVQWFRQHPRGDGLMGLFYIASGMKQSGRLNCTVNTKDRSSTLHIRASRLEDSATYLCAAQ
Mustela putorius furo V637 trav AEYP01038939.1 1324 QTHGDSVTQMESQVTLSEEASLTINCTYTTTVYPTLFWYVQYPGEGLELLLKASRDKEKGSNKGFEATYNKDSKSFHLEKDSVQASDSAVYYCALS
Mustela putorius furo V638 trav AEYP01038940.1 24838 QTRGDSVTQTEGQVTLSENAFLTMNCTYSASWYPALFWYVQYPGEGLELLLKALKDKEKGSNKGFEATYDGKSNSFHLEKRSVQASDSAVYYCAMN
Mustela putorius furo V639 trav AEYP01038940.1 15022 KTRGDSVTQTEGQVTLLEETSLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALRGKEKGSNKGFEATFDSKSKSFHLEKGSVQASDSAVYYCAVT
Mustela putorius furo V640 trav AEYP01038941.1 936 VRGMTVEQSPSTLSLQEGASSTLKCNFSSSPDSVQWFRQHPRGGRLMGLFFIASGMKQSGRLNCTVNTKERSSTLHIGASQLEDSATYLCAVE
Mustela putorius furo V641 trav AEYP01038942.1 6298 QTHGDSVTQTEGQVTLLEETSLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALKDKEKKSNKGFEATFDGRSKSFHLEKGSVQASDSAVYYCAVT
Mustela putorius furo V642 trav AEYP01038944.1 23949 FSQGENVEQHPSTLSVQEGSSSVINCSYSDSYSDYFPWYKQEPGKGPQLLVYILSSMATKEEQRLTVLLNKTAKRFSLHIRDTQPEDSAVYFCAA
Mustela putorius furo V643 trav AEYP01038944.1 13550 QTHGDSVTQMKSQVTLSEEASLTINCTYTTTSYPTLFWYVQYPGEGIELLLKALRDKEKGSNKGFEATYDSKSNSFHLEKGSVQASDSAVYYCAMT
Mustela putorius furo V645 trav AEYP01038945.1 73791 GTGAQSVTQPDVHVTVSEESPLELRCSHSSSLQSYLYWYVQNPNQGLQLLLLYISGDTLVKGIIGFEAEFRKTKTSFHLRKPSAHGNNTAKYFCAVN
Mustela putorius furo V646 trav AEYP01038945.1 71918 VRGMNVEQSPSALSLQEGASSTLKCNFSSSPYSVQWFQQHPRGGGLTRLFFIASGMQHSGRLNCTVNTKEWSSTLYITASQLEDSATYLCAVE
Mustela putorius furo V647 trav AEYP01038945.1 67045 LSRGEEIQQHPSLLTVREGGSFVINCTYTDSASDYFFWYKQEPGKGLQLLIYTLSNVVKKQEQRLTVLFNKKDKHLSLQDTATHPRDSATYFCATR
Mustela putorius furo V648 trav AEYP01038945.1 59783 VSSQKMEQNPQSLSIQEGEKAVLTCNYTNYSPVVFQWYRQDLGRDLVFLLLIRENEGEKQTGRLRATFDKTLQQSSFYITKSQPADSATYFCAT
Mustela putorius furo V649 trav AEYP01038945.1 37427 VRGVTVEQSSSVLSFQEGADSTLKCNFSQTARSVQWFRQHPGGGSLTRLFYVFSGMQQSGRLNCTVNIKERSSTLHIRASRLEDSATYLCAAQ
Mustela putorius furo V650 trav AEYP01038945.1 27666 QSRGDSVTQTEGQVTLSENAFLTINCTYSASGYTVLFWYVQYPGENLELLLKALKDKEKGSNKGFEATYDGKSKSFHLEKRSVQASDSAVYYCALR
Mustela putorius furo V651 trav AEYP01038945.1 18911 KTRGDSVTQTEGQVTLLEETSLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALRGKEKGSNKGFEATFDSKSKSFHLEKGSVQASDSAVYYCALS
Mustela putorius furo V749 iglv AEYP01065912.1 8666 SLAQPVLTQPPSLSASPGTTARLTCTLSRDISVGSKYMHWYQQKPGTPPRYLLYYYSDSSTQLGPGIPSRFSGSKDTSANAGILLISGLQPEDEADYYCAV
Mustela putorius furo V856 trbv AEYP01102308.1 187996 STGNGVTQTPKHLVSGTGRSVTLKCKQHLGHNAMYWYKQSVQKPPKLMLAYSYKDLLQNETASSRFLPDRSNNSQLDLQIKALEPEDSALYLCASSK
Mustela putorius furo V857 trbv AEYP01102308.1 178650 SMDPGVIQTPKHLVTGTTRSVTLKCKQHLGHNAMYWYKQSVQKPPKLMLAYNYKNLFENATASSRFLPDRSNNSQLDLQIKALEPEDSALYLCASSK
Mustela putorius furo V858 trbv AEYP01102308.1 160479 PVASGVTQTPRHLIKTRGQKVTLRCSFVSGHLSVYWYQQVLGQGPRFLIQYYDRKERDKGDMPERFSARQFSNSSSQLDLDLLELEDSALYLCASS
Mustela putorius furo V859 trbv AEYP01102308.1 154650 SLNAGITQTPKFQVLGTGQNMTLKCHQDMNHNSMYWYRQDHGHGLRLIHYSVGPAPLSGASASGEVPDGYSASRPNVTIFLLLSTAPSQTSVYFCASSV
Mustela putorius furo V860 trbv AEYP01102308.1 147993 PMEAEITQTPRYSIIQIGTKKTLECSQDMNHFAMFWYRQDPGQGLRLIYYSSDSPSTTKGDVAEGYSVSRKEQKFSPLTLESASTNQTSVYLCASSE
Mustela putorius furo V861 trbv AEYP01102308.1 135312 HTGPGVSQFPRHRVTERGQNVTLGCDPISGHTVLYWYRQTTGKGLEFLVYFQNTDAVDKSGMTNDRLSVQRSKGTNSTLQIQRAEQGDSAVYLCASS
Mustela putorius furo V862 trbv AEYP01102308.1 128996 PAGAEVIQTPRHLIQGSGGTAVLTCQPVSGHNSVRWYQQTLGQGPKFLIEYFAQAPRDKGDMPERFSAQQFSNYSSQLNLSLLEPGDSALYLCASS
Mustela putorius furo V863 trbv AEYP01102308.1 109765 FTDAGVIQTPRHKVTKMGQEVTLKCQPISGHEGLFWYSQTSVQGPKLLISFNNEAPIDDSGMPKEWFSAEISNKSLSTLKIKSTEPGDSATYLCASSI
Mustela putorius furo V864 trbv AEYP01102308.1 101917 FIDAGVIQTPRHNVTKMGQEVTLKCQPISGHAALYWYSQTSVQGPKLLIYFNNQAPIDDSGMPKERFSAEISNKSLSTLKIKPTEPGDSATYLCASSV
Mustela putorius furo V865 trbv AEYP01102308.1 96231 LMGAMVIQSSRYQVTRVGKPVNLSCSQNMNHDSMYWYQQKLNQAPKLLLYYYDKNFNREAETSDNFQASRPNTSFCSLNILSPGLGDSGVYLCASSK
Mustela putorius furo V866 trbv AEYP01102308.1 90216 ALHAEVTQTPGHLVKGKGQKAKMHCVPIKGHSYVDWYQQIPAKEFKFFISFQNDAIFDKTGMPEKRFSAACPQNASCSLEIKPTELQDSAVYFCASSE
Mustela putorius furo V867 trbv AEYP01102308.1 79308 LMNAGVTQNPRHLVIRTGQEATLKCSPEKGHVYFYWYQQPQGESLKFMVYLQNAQTVDDSGMSKERFSTNISKEGQSILKIQPAELGDSAVYFCASSL
Mustela putorius furo V868 trbv AEYP01102308.1 76030 TTDGGITQTPKYLLREEGREVTLKCEQDFNHDYMYWYRQDPGQGPRLIYYSPLKDDVQRGDIPEGYFGSRGKKTIFSLAVTSTRKNHTALYLCASSR
Mustela putorius furo V869 trbv AEYP01102308.1 58439 PTHAEIYQMPAFLLTRAGRAVTLECKQNLRYNAMYWYWQDPGQSLRLIYYSTVEKDVQRGDITEGYNVSREEKGLFPLTMNLAHTNQTGVYLCSGSA
Mustela putorius furo V870 trbv AEYP01102308.1 43405 LVDAGITQTPRHCVSGTGKKIVLECSQTMGYENMYWYRQDPGKALQLIHYSYGVNNTENEELSSGSTVSRLRKEVFPLTLESASPSQTSLYLCASSE
Mustela putorius furo V871 trbv AEYP01102308.1 38390 LKGAVVTQFPKHRIVGPGKELTLQCLQDMNYVLMYWYRQDPGFGLQLIYYSTGARNFEKGDVPQGYRVSRKDLQSFSLTLESASTNQTSVYLCTSSE
Mustela putorius furo V872 trbv AEYP01102308.1 29819 PVEAGVTQTPRHFITRTGRQLTLYCSQDMDHDVMFWYRQDPGVGLKLIYFSRNVKFIEVGDVPDGYSVLRKEKKDFPLTLKSTGTNQTSLYLCASSV
Mustela putorius furo V873 trbv AEYP01102308.1 15684 SVFSTLLSQEPRRDICQCGTSMTIQCETDTQVSLMYWYRQLPGQSLILIATANQGMEATYESGFTKEKFPISRPTLTFSSLTVNNMSFEDSSFYLCSAE
Mustela putorius furo V882 iglv AEYP01105693.1 1772 SWAQSVLTQPSSLSGSLGQRVTISCTGGSTNIGDGYSVYWYQQHQGKAPKTIIYGTSSRPSGVPERFSGSRSGNTGSLTITGLKTEDEADYYCSSWDKSLS
Mustela putorius furo V883 iglv AEYP01105770.1 8028 SVAAYVLTQPPSMSVNLGRTASITCSGDNIGSTYVSWNQQKPGQAPVTIIYSDSSRPSGIPDRFSGSNSGNMATLTISGARAEDEADYYCASYDSSRDT
Mustela putorius furo V884 iglv AEYP01105771.1 13244 SMASYVLTQPPSISVNLGQTAKITCEGNNIGRKSIYWYQQKLDQSPVLIIYRNSNRPSGIPDRFSGTNSGNMATLTISGACAEDEADYYCQVWDNNSN
Mustela putorius furo V885 iglv AEYP01105773.1 15101 SMVSSELTQLPSVSVALGQTATITCTGEELDYTVQWYQKKPGQAPLTIIYDESERPSGIPERFSGSRSGNTATLTISGVQAEDEADYYCQSYDSNAD
Mustela putorius furo V886 iglv AEYP01105774.1 6000 SMASSVLTQPHSVSVSLGQMATISCSGEILSGSYAYWYQKKPGQPPVQVIYKDTERPSGIPDRFSGSSSGTTHTLTINGAQAEDEADYYCQSSYSSGQ
Mustela putorius furo V887 iglv AEYP01105776.1 1160 SMASSVLTQPHLVSVSLGETATITCSGEVLSKYYAQWYQQKAGQAPKQVIYKDTERPSGIPDRFSGSSSGTTHTLTINRVQAEDEADYYCQSSDSSDK
Mustela putorius furo V889 ighv AEYP01106190.1 2689 VLSQLTLQESGPGLVKPSQTLSLTCVVSGGSVTSSYYWNWIRQRPGKALEWMGYWTGSTRYNPAFQGRISITADTSKNQFSLQLSSMTTEDTAVYYCAR
Mustela putorius furo V890 ighv AEYP01106626.1 577 VYSQVQLVQSEAEVRKPGESVKVSCKASGYTFTSYAMNWVQQAPGKSLQYMGWIDTNTGKPTYAPGFSGRFVFSTDTSVSTAYLQMNSLNSEDTAVYYCAR
Mustela putorius furo V891 ighv AEYP01106635.1 812 VQCEVQLVESGGDLVKPGGSLRLSCAASGFIFSSYWMRWVRQAPGKGLKWVTSISNTGSNTYYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAVYYCAR
Mustela putorius furo V892 ighv AEYP01106637.1 4014 VYAQVHLLQSGAEVRNPGASVKVSCKASGYTFTNYYMHWVQQAPERGLEWMGQIDPEDGATNIAQKYQARVTLMADTSTNMAYMELRSLRPEDTALYYCA
Mustela putorius furo V894 ighv AEYP01107227.1 5782 VECEVQLVESGGDLVKPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLQWVTSISNTGSNTYYADSVKGRFTISRDNGKNMLYLQMNSLKAEDTAVYYCVK
Mustela putorius furo V895 ighv AEYP01107237.1 5041 VYAQVHLLQSGAEVRNPGASVKVSCKASGYTFTDYYMHWVRQAPERGLEWMGRIDPEDGATNIAQKFQARVTLMADTSTSMAYMELRSLRSEDTALYYCA
Mustela putorius furo V896 ighv AEYP01107238.1 5908 VQCEVQLVESGGDLAKPGGSLRLSCAASGFTFSNYGMSWVRQTPGKGLQWVAYISTSSSYTYYADSVKGQFTVSRDNGKNTLYLQMSSLRAEDTAVYYCAR
Mustela putorius furo V897 ighv AEYP01107239.1 9943 VQCEVQLVESGGDLVKPEGSLRLSCAASGFTFSNYYMYWVRQAPGKGLQWVAEISNTGSSTYYTDSVKGRFTISRDNGKNTLYLQMNSLRAEDTAMYYCVR
Mustela putorius furo V898 ighv AEYP01107858.1 2901 VLCEVQLVESGGDLLKPGGSLRLSCAASGFTFSSYGMSWVHQAPGKGLQWVADISKGGSYTYYTDSVKGRFTISRDNGKNMLYLQMNSLRAEDTAVYYCAT
Mustela putorius furo V899 ighv AEYP01107922.1 1023 VQCEVQLVESGEDLVKPGGSLRLSCAASGFTFSNYYMDWVRQAPGKGLQWVADISGGGSSTSYADSVKGRFTISRDNGKNMLYLQMNSLRAEDTTLYYCAT
Mustela putorius furo V901 iglv AEYP01108526.1 7732 SMASYVLTQPPSLSVNLGQTAKITCGGDNIGCENAHWYQQKPGQAPVLIIYTDKNQPSGIPDRFSGSNSGNTATLTISRAHAKDESDYYCQVWDSSAN
Mustela putorius furo V902 ighv AEYP01109183.1 3985 VQSEVKLVESGGDLVKPGGSLRLSCAASGFTFSNYDMNWVRQAPGKGLQWVAYISSGGSSTYYADSVKGRFTISRDNDKDMLYLQMNSLRAEDTAMYYCAR
Mustela putorius furo V903 iglv AEYP01109684.1 6302 ANSQTVVIQEPSVSVSPGGAVTLTCGLSSGSVSTSNYPQWFQQTPGKAPRLLIYSTSSRPSGVPGRFSGSISGNKAAFTIKEAQLEDEANYHCLLYMGSG
Mustela putorius furo V904 iglv AEYP01110728.1 4460 SMASYVLTQPPSMSVNLGQTVRMTCGGNNIGRKSVPWYQQKPGLAPVMIIYGDSSRPSGIPDRFSGTNSGNTATLTISGVRAEDEADYYCQVWDNSAD
Mustela putorius furo V906 ighv AEYP01111131.1 949 VQCEVQLVESGGDLVKPGGSLRLSCTASGFTFSSYSMQWVRQAPGKGLQWVAYIRYDGGSTSYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTALYYCAR
Mustela putorius furo V907 iglv AEYP01111698.1 3680 SVTSSELTQPPSVSVALGQTATVTCTGGELEYFYVHWYQQKPGQAPLTIIYGDKERPSGIPERFSGSKSGSTATLTISSAQAEDEADYYCQSFDISVN
Mustela putorius furo V0 igkv AGTQ01034183.1 1096 SSGEVVLTQTPLSLSVTPGEPVSISCRASQSLVHSNGNTYVSWFRQKPGQSPQLLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCYQG
Mustela putorius furo V1 igkv AGTQ01034183.1 33126 SGGEVVLTQTPLLLPVTPGEPASISCRASQSLIHSNGNTYLHWYLQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCYQN
Mustela putorius furo V3 trbv AGTQ01047125.1 7684 STGNGVTQTPKHLVSGTGRSVTLKCKQHLGHNAMYWYKQSVQKPPKLMLAYSYKDLLQNETASSRFLPDRSNNSQLDLQIKALEPEDSALYLCASSK
Mustela putorius furo V4 trbv AGTQ01047125.1 17034 SMDPGVIQTPKHLVTGTTRSVTLKCKQHLGHNAMYWYKQSVQKPPKLMLAYNYKNLLQNKTASSRFLPNRSNNSQLDLQIKALEPEDSALYLCASSK
Mustela putorius furo V5 trbv AGTQ01047127.1 11265 PVASGVTQTPRHLIKTRGQKVTLRCSFVSGHLSVYWYQQVLGQGPRFLIQYYDRKERDKGDMPERFSARQFSNSSSQLDLDLLELEDSALYLCASS
Mustela putorius furo V6 trbv AGTQ01047129.1 6550 PKEAEITQTPRYSIIQTGTKKTLECSQDMNHFAMFWYRQDPGQGLRLIYYSSGSPSTTKGDVAEGYSVSREEQIFPLTLESASTNQTSVYLCASSE
Mustela putorius furo V7 trbv AGTQ01047129.1 19305 HTGPGVSQFPRHRVTERGQNVTLGCDPISGHTVLYWYRQTTGKGLEFLVYFQNTDAVDKSGMTNDRLSVKRSKGTNSTLQIQRAEQGDSAVYLCASS
Mustela putorius furo V8 trbv AGTQ01047129.1 25621 PAGAEVIQTPRHLIQGSGGTAVLTCQPVSGHNSVRWYQQTLGQGPKFLIEYFAQAPRDKGDMPERFSAQQFSNYSSQLNLSLLEPGDSALYLCASS
Mustela putorius furo V9 trbv AGTQ01047129.1 44764 FTDAGVIQTPRHKVTKMGQEVTLKCQPISGHEGLFWYSQTSVQGPKLLISFNNEAPIDDSGMPKERFSAEISNKSLSTLKIKSTEPGDSATYLCASSI
Mustela putorius furo V10 trbv AGTQ01047129.1 52612 FIDAGVIQTPRHNVTKMGQEVTLKCQPISGHAALYWYSQTSVQGPKLLIYFNNQAPIDDSGMPKERFSAEISNKSLSTLKIKPTEPGDSATYLCASSV
Mustela putorius furo V11 trbv AGTQ01047129.1 58308 LMGAMVIQSSRYQVTRVGKPVNLSCSQNMNHDSMYWYQQKLNQAPKLLLYYYDKNFNREAETSDNFQASRPNTSFCSLNILSPGLGDSGVYLCASSK
Mustela putorius furo V12 trbv AGTQ01047130.1 1484 ALHAEVTQTPGHLVKGKGQKAKMHCVPIKGHSYVDWYQQIPAKEFKFFISFQNDAIFDKTGMPEKRFSAACPQNASCSLEIKPTELQDSAVYFCASSE
Mustela putorius furo V13 trbv AGTQ01047130.1 12430 LMNAGVTQNPRHLVIRTGQEATLKCSPEKGHVYFYWYQQPQGESLKFMVYLQNAQTVDDSGMSKERFSTNISKEGQSILKIQPAELGDSAVYFCASSL
Mustela putorius furo V14 trbv AGTQ01047130.1 15709 TTDGGITQTPKYLLREEGREVTLKCEQDFNHDYMYWYRQDPGQGPRLIYYSPLKDDVQRGDIPEGYFGSRGKKTIFSLAVTSTRKNHTALYLCASSR
Mustela putorius furo V15 trbv AGTQ01047130.1 33300 PTHAEIYQMPAFLLTRAGRAVTLECKQNLRYNAMYWYWQDPGQSLRLIYYSTVEKDVQRGDITEGYNVSREEKGLFPLTMNLAHTNQTGVYLCSGSA
Mustela putorius furo V16 trbv AGTQ01047130.1 48344 LVDAGITQTPRHCVSGTGKKIVLECSQTMGYENMYWYRQDPGKALQLIHYSYGVNNTENEELSSGSTVSRLRKEVFPLTLESASPSQTSLYLCASSE
Mustela putorius furo V17 trbv AGTQ01047130.1 53365 LKGAVVTQFPKHRIVGPGKELTLQCLQDMNYVLMYWYRQDPGFGLQLIYYSTGARNFEKGDVPQGYRVSRKDLQSFSLTLESASTNQTSVYLCTSSE
Mustela putorius furo V18 trbv AGTQ01047130.1 61935 PVEAGVTQTPRHFITRTGRQLTLYCSQDMDHDVMFWYRQDPGVGLKLIYFSRNVKFIEVGDVPDGYSVLRKEKKDFPLTLKSTGTNQTSLYLCASSV
Mustela putorius furo V19 trbv AGTQ01047130.1 76113 SVFSTLLSQEPRRDICQCGTSMTIQCETDTQVSLMYWYRQLPGQSLILIATANQGMEATYESGFTKEKFPISRPTLTFSSLTVNNMSFEDSSFYLCSAE
Mustela putorius furo V20 igkv AGTQ01064830.1 106584 AHGHVGLTQSPAFLQVSLREGVSITCRANESVSDYLSWYQQKPGQAPQLLIYDADNLKSGVPDRFSAIQSDKEFILKISAVEAEDAASYYCQRGSIL
Mustela putorius furo V21 igkv AGTQ01064830.1 109708 SSGEIVMTQTPLSLSVTPGEPASISCRASQSLLHSNGNTYLNWYRQKPGQSPQLLIYLVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDMGVYYCGQNLQSP
Mustela putorius furo V22 igkv AGTQ01064830.1 116129 SSGEIVMTQTPLSLPITPGESASISCRASQSLLHSNGNTYLYWFRQKPGQSPQDLIYKVSNQYSWVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQNLQSP
Mustela putorius furo V23 igkv AGTQ01064831.1 19390 SSGEVVLTQNPLSLSITLGEPASISCRASQSLLHSNRYNYLHWYLQKPGQSPQLLIYLATNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQSLHV
Mustela putorius furo V24 igkv AGTQ01064831.1 26925 SSGDIVMTQTPLSLSVTPGKPVSISCRASQSLLHSNGMNYLYWYLQKPGQSPQSLIYLASSRYPGVPDRFSGRGSGTDFTLTISSVEAEDVGVYYCLQSLEFP
Mustela putorius furo V25 igkv AGTQ01064831.1 42895 SSGEIVLTQTPLSLSVSSREPASISCRASQSLLHSNGNNYLHWYLQKPGQSPQLLIFFATNRFSGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQSLHV
Mustela putorius furo V26 igkv AGTQ01064831.1 60888 SSGEIVMTQTPLSLPISPGEPASISCKASQSLLYSNGKTYLHWYLQKPGQSPQLLIYEVSNHFSGVSDRFSGSGSGTDFNLRISRVEADDMGVYYCGQSTEYP
Mustela putorius furo V27 igkv AGTQ01064831.1 72468 SSGEVVLTQTPLSLSVTLGEPASISCRASQSLLHSNRYNYLHWYLQKPGQSPQLLIYLATNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQNLHA
Mustela putorius furo V28 igkv AGTQ01064831.1 93981 SSGEIVMTQTPLSLPISPGEPASISCKANQNLLHSDGKTYLTWFRQKPGQSPQGLIYLLSKRFSGVSDRFSGSGSGTDFTLTISRVEADDVGIYYCGQSIQSP
Mustela putorius furo V29 igkv AGTQ01064831.1 105583 SSGEVVMTQTPLFLPVTPGEPASISCRASQSLLHSDGNTYLYWYLQKPGQSPQLLIYGVSYRFLRVPGRFSGSGSGTDFTLRISRVEADDMGVYYCMQG
Mustela putorius furo V30 igkv AGTQ01064833.1 14392 ATGEIVLTQSPALLSLSPGEKATLNCRASQSASSYVAWYQQKPGQAPRLLIYGASTRATDIPARFSGSGSGTDFTLTISNLEREDAAIYHCHQYNIGY
Mustela putorius furo V31 igkv AGTQ01064833.1 43771 SHGEIVLTQSPAVLSMAPKERVTITCQASQNINKWLAWYHQEPGRAPKLLIYEASKLITGVPSRFSGSGSGTDFTLTISSLEPEDAGTYYCLQSNSYP
Mustela putorius furo V32 igkv AGTQ01064833.1 56757 VCAHTELTQSPAFLSVSLGDSVSITCRVNESVSDYLSWYQQKPGQAPKHLIYDADNLKSGVPARFSAIQSDKEFTLKISAVEAEDAASYYCQQDYILP
Mustela putorius furo V33 igkv AGTQ01064833.1 64229 SSGDIVLTQTPLSLSITPGESASISCRASQSLVHSNGNTHLSWYLQKPGQSPQLLIYKISNHFTGVPDRFSGSGSGTDFTLTISRVEADDVGVYYCGQD
Mustela putorius furo V34 igkv AGTQ01064833.1 69373 GKIMMTQTPLSLPITPGEPASISCQASQSLVHNNENTYLHWYLQKPGQSPQGLIYRVSNHFTWVPDRFSGSGSGTDFTLRISTVEGDGVGVYYCGQS
Mustela putorius furo V35 igkv AGTQ01064836.1 10832 SSGEVVLTQTPLSLSVTPGESASISCRASQSLVHSDGNTYLNWYLQKPGQSPQLLIYRVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCYQG
Mustela putorius furo V36 igkv AGTQ01064836.1 27596 SSGEVVLTQTPLLLSVTPGEPASISCRASQSLVHSNGNTYLHWYLQKPGQSPQLLIYKVSNRYTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCFQE
Mustela putorius furo V37 igkv AGTQ01064839.1 10473 FPGENVLTQSSAILSMVPKERVSITCRASQNINKWLAWYQQEPGRAPKLLICETSKLETGVTSRFSGSESGTDITLISSSLEPEDAGTYYCLQSNSY
Mustela putorius furo V38 igkv AGTQ01064839.1 25367 SSRDIVLTQTPRSLSLTPGEPASISCRASQSLLHRDGNTYLYWYLQKPGQSPQLLIYEVSIHKSGVPDKFSGSRSGTDFTLKLSRVEDGDVGVYYCEQG
Mustela putorius furo V39 igkv AGTQ01064839.1 30261 VVITQTPHLLPVIPGESASISCRASQSLVHSTGNTYLYWYLQRPGHSPQGLIYKVSNRFTGVPDRFSGSGSGTDFSLRISRVEADDVGVYYCGQGIHFP
Mustela putorius furo V40 igkv AGTQ01064840.1 18453 SSGEAVLTQSPLTLSVSPGESASISCRASQSLVHSNGNTYLHWYLQKPGQSPQGLIYRVSNHYTGVPDRFSGSGSETDFTLRISRVEANDVGVYYCGQGTIQNL
Mustela putorius furo V41 igkv AGTQ01064841.1 25744 SHGEITMTQSPGSLAVSPGQRVTLNCKASQSVSNYVNWYQQKPGQSPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGSYYCQQAYSSP
Mustela putorius furo V42 igkv AGTQ01064841.1 69422 ACGDITMTQSPGSLAVSPGQRVTLNCRASQSVSNYVAWYQQKPGQSPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGNYYCQQYDNY
Mustela putorius furo V43 igkv AGTQ01064842.1 977 SSGEVVLTQTPLSLSVTPGEPVSISCRASQSLVHSNGNTYLHWYLQKPGQSPQRLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDMGVYFCEQG
Mustela putorius furo V44 igkv AGTQ01064843.1 5533 SSGKVVLTQTPLSLSVTPREPASISCRASQSLVHSDGNTYLSWYLQKPDQSPQLLIYMVSNRFTGLPERFSGSGSGTDFTLTISRVEADDVGVYYCGQF
Mustela putorius furo V45 trav AGTQ01065631.1 1081 SSIAQKITQAQPAMLVQEKGTVILECTYNTNEPRYSLLWYKQPSSGAMVFLIRQDSYNLQNATEGRYSLNFQKTRNFIQLVISASQLEDSAVYFCALRE
Mustela putorius furo V46 trav AGTQ01065631.1 12470 VRGMTVEQSPSALSLQEGASSTIKCNFSSTVYNVQWFRQHPRGGGLTRLFYITSGMQHSGRLNCTVNTKEQSSTLHIMASRLEDSATYLCAAQ
Mustela putorius furo V47 trav AGTQ01065631.1 37170 QTHGDSVTQVESQVTLSEEASLTINCTYTTTGYPTLFWYVQYPGEGLELLLKAARDKEKGSNKGFEATYNKKSKSFHLEKGSVQASDSAVYYCAMY
Mustela putorius furo V48 trav AGTQ01065632.1 1405 VRGMTVQQTPSTLSLQEGANSTLKCTFSSTLGSVQWFRQHPRASSLTRLFYITSGMQHSGRLNCTVNTREQSSTLHIGASRLEDSATYLCAG
Mustela putorius furo V49 trav AGTQ01065632.1 7226 FSQGENVEQHPSTLSVQEGGSSFINCSYSDGGSDYFPWYKQELGKGPQLLIYIRSSMATKEDQRLTVSLNKTAKRFSLHIRDTQPEDSAVYFCAA
Mustela putorius furo V50 trav AGTQ01065632.1 32796 QTRGDSVTQTEGQVTLSENAFLTMNCTYSASRYPALFWYVQYPGEGLELLLKALKDKEKGSNKGFEATYDGKSNTFHLEKRSVQTSDSAVYYCAMN
Mustela putorius furo V51 trav AGTQ01065633.1 9306 VRGKNVEQTPSALSLQEGASYTLKCNFSSSIYSVQWFRQHPGDSGLTLLFYITSGMQHSGRLNCTVNTKDRYSTLHITTSQLEDSATYLCAVE
Mustela putorius furo V52 trav AGTQ01065634.1 5743 FSQGENVEQHPSTLSVQEGSSSVINCSFSDGRSDYFPWYKQELGKGLQFLIYIRSNMATKEDQRLTVSLNRTAKHFSLHIRDTQPEDSAVYFCAA
Mustela putorius furo V53 trav AGTQ01065636.1 11385 QTHGDSVTQTEGLVTLFEEASLTINCTFSTTQYPALFWYVQYPGEGLELLLKASRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDSAVYYCAMY
Mustela putorius furo V54 trav AGTQ01065636.1 29965 ARGMTVEQSPSDLSLQEGDSSTLKCNFSSTPDSVQWFRQHPGGGGLTRLFYIASGMKQSGRLNCTVNTKEQSSTLHIRASQLEDSATYLCAGE
Mustela putorius furo V55 trav AGTQ01065636.1 34525 FSQGENVEQHPSTLSVQEGSSSVINCSYSDNNSEYFPWYKQEPGKGPQILVYILSSMATKEEQRLTVLLSKTAKRFSLHVRDTQPEDSAVYFCAA
Mustela putorius furo V56 trav AGTQ01065636.1 43006 QTQGDSVTQTEVQVTLLEEASLTVNCTYSTTVFPTLFWYVQYPGKGLQLLLSSSRDQEKKSNKGFEVTLDSKSKSFHLEKGSVQASDSAVYYCALS
Mustela putorius furo V57 trav AGTQ01065636.1 54246 VRGMTVEQNPSDLSLQEGANSTLKCNFSSTVNRVQWFRQNPGGGGFTSLFYIFSGMKQSGRLTCTVNTKEQSSTLHITASRLEDSATYLCAGE
Mustela putorius furo V58 trav AGTQ01065637.1 1921 FSQGENVEQHPPTLSVQEGSSSVINCSYSDSTSDYFPWYKQEPGKGPLLLTYVHSTVATKEDQRLTLSLNEMAKRFSLCIRDTHPEDSAVYFCAA
Mustela putorius furo V59 trav AGTQ01065637.1 9967 QTHGDSVTQTEGQMTLSEGASLTINCTFSTTWSPTVFWYVQYPGEGLELLLKALKDKETKHNKGFEATFNSKSKSFHLEKGSVQASDSAVYYCAMN
Mustela putorius furo V60 trav AGTQ01065637.1 18976 VRGMTVEQSPSHRSLQEGASSTLKCNFSNAVNNVQWFRQNPGGGSLTRLFYIVSGMKQSGRLNCTVNTKDRSSTLHIGASQLEDSATYLCAVE
Mustela putorius furo V61 trav AGTQ01065637.1 24946 FSQGENVEQHPSTLSVQEGGSSVINCSYSDSTSSYLPWYKQELGKGPQLLIDIFSSMTTKEDQRLTVSLNKTAKRFSLHVRDTQPEDSAVYFCAA
Mustela putorius furo V62 trav AGTQ01065637.1 32115 QTHGDSVTQTEGQVTLSEEASLTINCTFSTSWSPTLFWYVQYPGEGLELLLKALRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDSAVYYCAMY
Mustela putorius furo V63 trav AGTQ01065637.1 36398 SSIAQKITQAQPAMLVQEKGTVTLECTYNTNEPSYSLLWYKQPSSGEMVFLIRQDSYNQQNATEGRYSLNFQKTGNFIQLVISSSQLEDSAVYFCALRE
Mustela putorius furo V64 trav AGTQ01065637.1 42914 QTHGDSVTQTEGQVTLSEEASLTINCTFSTSWSPTLFWYVQYPGEGLELLLKALRDKEKGSNKGFEATYNKDSKSFHLEKGSVQASDAAVYYCAMY
Mustela putorius furo V65 trav AGTQ01065637.1 51691 VSGKDQVEQNPQSLVILEGENCTIQCIYSVTPFGSLRWYKQGTGRGPASLIVMDNDDGRKSNGRYTATLDTTSKHSSLHIRAIQLSDSALYICAVS
Mustela putorius furo V66 trav AGTQ01065638.1 6206 VSGKDQVEQNPQSLVILEGENCTIQCIYSVTPFGSLRWYKQGTGRGPASLIVMDNDDGRKSNGRYTATLDTTSKHSSLHIRAIQLSDSALYICAVS
Mustela putorius furo V67 trav AGTQ01065638.1 19790 MRSQQNRVEQSPGSLSLREGDAASLNCTYSDSASQYFTWYRQYSGKGPELLMYMYSKGNKTEGRFSGQVDRTKQYVSLLIRDSQLSDSATYLCAV
Mustela putorius furo V68 trav AGTQ01065638.1 22141 GTGAQSVTQPDTHVTVSEEAALELRCNYSYSGTPYLYWYVQYPNQGLQLLLRYFSGNTLVKGIKGFEAEFRKTESSFHLRKHSAHGSDTAEYFCAVS
Mustela putorius furo V69 trav AGTQ01065638.1 27231 GTGAQTVTQPEDHISVFEGDFVQIKCNYSYSGSPILFWYVQYPKQALQLLLKQISGESTKGFVANLNRDETSFHLKKQSAQQEDSAMYYCALS
Mustela putorius furo V70 trav AGTQ01065638.1 31326 VNSQQEQHHQVLNFQEGENATMNCSYKTSISNLQWYRKDSGQGFVQLILIRSNEREKYRGRLRVTLDNSNKSSSLSIIASQTADSATYICAT
Mustela putorius furo V71 trav AGTQ01065638.1 37662 GTSGDTVTQTEGSVTLPEGTPLTLNCTYQSSYSVVAFWYVQYQNKEPKLLLKSSSENRRVENHGFQASLKSDKSFHLEKRSVQMSDSAVYYCAVE
Mustela putorius furo V72 trdv AGTQ01065638.1 51254 SSMAQNVTQAQPAISTLENETVTLDCVFKASGSTYYLFWYKQLPSGEMIFLILQESYMEQNATEGRYSLNFQKSDHSISLTIRALQLADSAVYFCALR
Mustela putorius furo V73 trav AGTQ01065638.1 58345 VTGEDRVEQSPQTLRLQEGDRVRLNCSYTVSAFNGLQWYRQDPGQGPEFLFVLYAVGDEKQKERLRATLLKEGSSLHIEASKPEDSATYFCAVK
Mustela putorius furo V74 trav AGTQ01065638.1 68034 VSSKQEVKQSPEALNIREQDSVVLNCSYTDGTLYSVQWFRQDPGKGLTLLMIILSNQKEQTSGRIKVLLDTRARQSSLYIVASQPSDSATYLCAV
Mustela putorius furo V75 trav AGTQ01065638.1 83441 VTGAEVEQRPPTLSLQEGASATLQCNFSTSAANVQWYRQDRGGRLILLFYIPSGTKKNGRLSSTTVAKERRSSLYISSSQITDSATYYCAAEPQCSP
Mustela putorius furo V76 trav AGTQ01065639.1 13066 VGSVSNVEQNPPWLHVQEGENTNFTCRFPSSNFYSLHWYRWEPAKPPMFLISVTLNGDEKRTGRVRTTLNTQEGYSSFYIRGCQPEDAATYFCAM
Mustela putorius furo V77 trav AGTQ01065639.1 19924 INGQEIKQNPQFLLLQEGKDFTISCNASSILTSFQWYKQRPGGGPVLLISLLKGGEVKQKRLTARFGESRKDSFLHMEASQTADAGTYFCAGTQCSQ
Mustela putorius furo V78 trav AGTQ01065639.1 33317 ESTQQLEQSPRFLSIQEGENFTAYCNSTSTFPSFQWYRQRLGEGPVHLMTLSKGGEMKKHKRLTAWFGEMRKDSSLLITAAQPVDAAIYICAG
Mustela putorius furo V79 trav AGTQ01065639.1 40127 VRVQMKVEQSPRVLILQEGRNASMMCNYSISMTSMQWFQQSPEGHLTFSSYIASGTQQKGRLKFTVNIKERNSHLYITDSQPGDSVTYFCAVG
Mustela putorius furo V80 trav AGTQ01065639.1 45377 VTSQQKGDQQQVKQTPSLSVQEGEISILTCDHNNDLFDYFSWYKKYPAKGPNFLISIRSVMDKNEDGRFTVFLNKSAKHLSLHIAGSQPGDSALYLCAAS
Mustela putorius furo V81 trdv AGTQ01065639.1 62429 SSTAEKVIQTQRTLTIQEGESATFYCKYETSWSYYYTLYWYKQLPSGEMIFLIYQDESKPNAQQGRLSLDFQKAIKFISLTISPLKLTDSAMYFCAWGS
Mustela putorius furo V82 trav AGTQ01065639.1 65689 IMSDADPTQPNAMEGTEGEPVHLPCNHSTISGNQYIYWYRQIPNQSPEYMIHGLKDNVTEGITSLIITRARKSSTLILPRVTLGDAAVYYCLLRE
Mustela putorius furo V83 trav AGTQ01065639.1 71918 VSSQGLEQSPQSLIVQEGEDFTINCSSSKPVYALHWYRQKKSKSLISLMILWKNGEEKNHEETTATLDDKKQQSSLHIRAAQPSHSGTYLCAAD
Mustela putorius furo V86 trdv AGTQ01065641.1 14376 SSTAQTVTQTQPDTSVRETETVTLHCTFDTSDTNYYLFWYKQPPSGEMSFIIRQESYNQKNATEDRFSVNFQKAQKSFGLRISDSRLEDAATYFCA
Mustela putorius furo V87 trav AGTQ01065641.1 21126 SSTAQTVTQTQPDTSVRETETVTLHCTYDTTDTNYYLFWYKQPPSGEMSFIIRQEYYNQKNATEDRFSVNFQKAKKSFGLRISDSRLEDAAVYFCA
Mustela putorius furo V88 trav AGTQ01065642.1 15728 GTSGNSVQQTDQITVLEGESVTMNCVYTSTQYPTLFWYVQYPNQALQFLQRETMENSKNFGARNIKDKNSPITKSAVQMSDSAVYYCLLRDTHSDK
Mustela putorius furo V89 trav AGTQ01065642.1 19160 VSGKPGVEHSPQYLTAQEGDSVTITCSYSIGMTALHWLQQNPGGHIVSLFILSLEMKKKGRVRATINTEELHSSLYITASQPRDSATYLCAV
Mustela putorius furo V90 trdv AGTQ01065643.1 906 SSNADNVRQSASVHEEEGKSVTLDCSFTLNFNYYVMCWYHQPPNGKMTEIISMFSDSSTNMEGRYTLSLQKRSRILKLTITGLMLADTGVYFCAIGEN
Mustela putorius furo V91 trdv AGTQ01065644.1 22984 VSLDIVLEPDAKTLTVQVGEPATLRCSVTGGDLKNYQVSWYKKNEDNSLTLVYRPSNNTNDDLRSNFKGNTNPSKSQLDIQRTAAEDAGTYYCACD
Mustela putorius furo V92 iglv AGTQ01068546.1 32490 FSGSMAFSVLTQPHSVSVSLGQTATIICSGEVLSKYYAQWYQQKAGQAPKQVIYKDTECPSGIPDQFSGSSSGTTHTLTINGAQAEDEADYYCQSSDSSDK
Mustela putorius furo V93 iglv AGTQ01069627.1 5343 SLAQPVLTQPPSLSASPGTTARLTCTLSRDISVGSKYMHWYQQKPGTPPRYLLYYYSDSSTQLGPGIPSRFSGSKDTSANAGILLISGLQPEDEADYYCAV
Mustela putorius furo V94 iglv AGTQ01069635.1 23359 SWSQSVLTQPPSVSGTLGQRVTISCTGSSNNIGDYGVTWQQQLPGTAPRTIIYANTYRPSGVPDRFSGSQSGSDATLTITGLQPEDEAEYYCATWDNSLR
Mustela putorius furo V95 ighv AGTQ01070905.1 2912 VQCEVQLVESGGDLVKPGASLRLSCAASGFTFSNYYMNWVRQAPGKGLQWVAWINTGGSSTSYADSVKGRFTISRDNGKNTLYLQMNSLRTEDTAMYYCAT
Mustela putorius furo V96 iglv AGTQ01071545.1 6984 SSAQSMLTQPPSVSGALGQRVTISCTGSSSNIGSGNYVYWYQQLPGITPKLIIYGSSNRPSGVPDRFSGSRSGSSGTLTITGLHTEDEADYYCSAWDDSLN
Mustela putorius furo V97 igkv AGTQ01071776.1 1598 VRRHTGLTQSPAFLSVSLREGVSITCRAKESVSDYLSWYQQKPSQDPQLLIYDADNLKSGVPDRFSAIQLDREFILNISSVEAEDAASYYCQQDYTLP
Mustela putorius furo V98 ighv AGTQ01071865.1 8728 VQCELQLVESGGDLVKPGRGIWSLKLPCAASGFTLSSYDMNWVRQTQGKGLQWVAYINNGGSTYYADSVKALFILSGDTGKNKLYLQMNSLRIEDTAVYYCVPR
Mustela putorius furo V99 iglv AGTQ01072014.1 17420 SMASSVLTQPHSVSVSLGQMATISCSGEILSGSYAYWYQKKPGQPPVQVIYKDTERPSGIPDRFSGSSSGTTHTLTINGAQAEDEADYYCQSSYSSGQ
Mustela putorius furo V100 iglv AGTQ01072014.1 24327 SVTSSELTQPPSVSVALGQTATVTCTGGELEYFYVHWYQQKPGQAPLTIIYGDKERPSGIPERFSGSKSGSTATLTISSAQAEDEADYYCQSF
Mustela putorius furo V101 iglv AGTQ01072015.1 17383 SMVSSELTQLPSVSVALGQTATITCTGEELDYTVQWYQKKPGQAPLTIIYDESERPSGIPERFSGSRSGNTATLTISGVQAEDEADYYCQSYDSNAD
Mustela putorius furo V102 ighv AGTQ01072136.1 6277 VQCEMKLVESGGDLVKPGGSLRLSCAASGFTFSSYGMTWVCQDPGKGPQWIAGIWIDGSFTSYADSVKGQFTISRDNGKNTLYLQMNSLRSKDMDVYYCAR
Mustela putorius furo V103 ighv AGTQ01072146.1 610 AQCEMQLVESGGDLVKPGGSLRLSCEASGFTFSGYGMSWVRQAPGKRIEVVSNIDAGGGSTSYTDSVKGRFTISRDNAKNTLYLQMNSLRTEDTAMYFCAK
Mustela putorius furo V104 trgv AGTQ01072355.1 10768 GGAGLKLSQTALLVARVGSSRTLDCKVDTWVSYIHWYRQQEGTAPKRLLHLDMSRSLVQRDFVLNANKVNAEKGKDSYSCTLSLLKVEKNDEGVYYCAAW
Mustela putorius furo V105 iglv AGTQ01072731.1 16955 SMASYVLTQPPSLSVNLGQTAKITCGGDNIGCENAHWYQQKPGQAPVLIIYTDKNQPSGIPDRFSGSNSGNTATLTISRAHAKDESDYYCQVWDSSAN
Mustela putorius furo V106 igkv AGTQ01072852.1 279 SDGEVVMTQTPLSLSITPGESASISCRASQSLVHSNGNTYLSWYLQKPGQSPQLLIYKVSNRFTGVPDRFTGSGSGTDFTLRISRVEADDVGIYYCQQGIQYP
Mustela putorius furo V107 trgv AGTQ01017073.1 4432 GGAGLKLSQTALLVARVGSSTPLDCKVDAWVKYIHWYRHQEGTAPKRLLYLDMSTSLVQRDFVLKADKVNANKGRDSYSCTLSLLKLEKSDEGVYYCAAWA
Mustela putorius furo V108 trgv AGTQ01027730.1 17558 GLGQVILEQPEISISRTRDESAHILCKVSTKDFTNAVIHWYRQKPHQEIEHLGLVQSISIQVSLGGKKTKLEATKNAITSTSTLKVNFLEQEDEAMYYCACWRG
Mustela putorius furo V109 trgv AGTQ01027730.1 6267 GLGQVKLEQPEISISRERYKSAHILCKVSSKDFTNEVIHWYRQKPHQEIEHLTYILTSYTQVSLGGKKTKLEATKNAITSTSTLKVNFLEQEDEAMYYCACWDW
Mustela putorius furo V110 trgv AGTQ01027731.1 36610 GLGQATLKQHEISVSRARDKSAHISCNVSAKNFNSETIYWYRQKPDQEIEYLTDVITDRVQVPLDGKNNKFEASKNTHTSTSTLKINFLEKEDEAIYYCGSWNW
Mustela putorius furo V111 trgv AGTQ01027731.1 27350 ADADFLITQLVPSITKKQGNTAFLECHIKAGGLRNNVYIHWYQQKPDQPLKRILYISSNENVVHEQGVNEERYEARKWQRDLPASLRIHRVNEEDAGLYYCACWD
Mustela putorius furo V112 trgv AGTQ01027733.1 3223 GHTVMRLEQPAVVVACESTSAILSCTANTKVNYIHWYRHQEGKSLQRILHLTMDQSVVHWDLVEKAEKVTAIGAKDGYSCTLLVLKLEKSDEDMYYCAFWE
Mustela putorius furo V113 trgv AGTQ01027739.1 38245 GGAGLKLSQTALLVARVGSSCSLDCQVDSSVSYIHWYRHQEGTAPKRLLYLDMSRSLVQRDFVLKADKVYAQKGKDSYSCTLSLLKLEKSDEGLYYCAAWV
Mustela putorius furo V114 igkv AGTQ01034183.1 47253 VHGDITMTQSPGSLAVSPGQRVTINCRASQSVSNYVAWYQQKPGQSPRLLIYYASSRATGIPDRFSGSGSGTDFTLSISNLQAEDVGDYYCQHHYSY
Mustela putorius furo V115 igkv AGTQ01034183.1 42355 CTGDIVLTQSPASLTMSPGQRTTISCKTSQEVSDILGITHCITWYQQKSGQCPRILIYKASSGVCGVPVRFNGGRSGTEFSLTTGLVEDGDAASYYCQKSKETP
Mustela putorius furo V116 trav AGTQ01040528.1 7799 VRGMTVEQSPSALSHQEGASFTLQCNFSQTAGSVQWFRQHPGGGGLTRLFYIASGMQQSGRLNCTVNTRERPSTLHIGASRLEDSATYLCAAQ
Mustela putorius furo V117 trav AGTQ01040529.1 22069 VRGMTVEQSPSALRLQEGDSSTLKCNFSETARSVQWFRQHPRGDGLMGLFYIASGMKQSGRLNCTVNTKDRSSTLHIRASRLEDSATYLCAAQ
Mustela putorius furo V118 trav AGTQ01040530.1 1399 QTHGDSVTQVESQVTLSEEASLTINCTYTTTVYPTLFWYVQYPGEGLELLLKASRDKEKGSNKGFEATYNKDSKSFHLEKDSVQASDSAVYYCALS
Mustela putorius furo V119 trav AGTQ01040531.1 14921 QTRGDSVTQTEGQVTLLEEASLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALRGKEKGSNKGFEATFDSKSKSFHLEKGSVQASDSAVYYCAVT
Mustela putorius furo V120 trav AGTQ01040532.1 2670 QTRGDSVTQTEGQVTLSENAFLTMNCTYSASWYPALFWYVQYPGEGLELLLKALKDKEKGSNKGFEATYDGKSNSFHLEKRSVQASDSAVYYCAMN
Mustela putorius furo V121 trav AGTQ01040533.1 6459 VRGMTVEQSPSTLSLQEGASSTLKCNFSSSPDSVQWFRQHPRGGRLMGLFFIASGMKQSGRLNCTVNTKERSSTLHIGASQLEDSATYLCAVE
Mustela putorius furo V122 trav AGTQ01040534.1 3203 QTHGDSVTQTEGQVTLLEETSLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALKDKEKKSNKGFEATFDGRSKSFHLEKGSVQASDSAVYYCAVT
Mustela putorius furo V124 trav AGTQ01040536.1 5690 QTHGDSVTQMKSQVTLSEEASLTINCTYTTTSYPTLFWYVQYPGEGIELLLKALRDKEKGSNKGFEATYDSKSNSFHLEKGSVQASDSAVYYCAMT
Mustela putorius furo V125 trav AGTQ01040537.1 3690 FSQGENVEQHPSTLSVQEGSSSVINCSYSDSYSDYFPWYKQEPGKGPQLLVYILSSMATKEEQRLTVLLNKTAKRFSLHIRDTQPEDSAVYFCAA
Mustela putorius furo V126 trav AGTQ01040538.1 27659 QSRGDSVTQTEGQVTLSENAFLTINCTYSASGYTVLFWYVQYPGENLELLLKALKDKEKGSNKGFEATYDGKSKSFHLEKRSVQASDSAVYYCALR
Mustela putorius furo V127 trav AGTQ01040538.1 18904 KTRGDSVTQTEGQVTLLEETSLTVNCTYSASGSLTLFWYVQYPGEGLQLLLKALRGKEKGSNKGFEATFDSKSNSFHLEKGSVQASDSAVYYCALS
Mustela putorius furo V128 trav AGTQ01040539.1 30595 VSSQKMEQNPQSLSIQEGEKAVLTCNYTNYSPVVFQWYRQDLGRDLVFLLLIRENEGEKQTGRLRATFDKTLQQSSFYITKSQPADSATYFCAT
Mustela putorius furo V129 trav AGTQ01040539.1 8217 VRGVTVEQSSSVLSFQEGADSTLKCNFSQTARSVQWFRQHPGGGSLTRLFYVFSGMQQSGRLNCTVNIKERSSTLHIRASRLEDSATYLCAAQ
Mustela putorius furo V130 trav AGTQ01040540.1 8053 GTGAQSVTQPDVHVTVSEESPLELRCSHSSSLQSYLYWYVQNPNQGLQLLLLYISGDTLVKGIIGFEAEFRKTKTSFHLRKPSAHGNNTAKYFCAVN
Mustela putorius furo V131 trav AGTQ01040540.1 6180 VRGMNVEQSPSALSLQEGASSTLKCNFSSSPYSVQWFQQHPRGGGLTRLFFIASGMQHSGRLNCTVNTKEWSSTLYITASQLEDSATYLCAVE
Mustela putorius furo V132 trav AGTQ01040540.1 1307 LSRGEEIQQHPSLLTVREGGSFVINCTYTDSASDYFFWYKQEPGKGLQLLIYTLSNVVKKQEQRLTVLFNKKDKHLSLQDTATHPRDSATYFCATR
Mustela putorius furo V133 iglv AGTQ01051105.1 3471 SQPGLPQPDALLVFPGQVAQLSCMLSPSHATIGEYGVSWYQQRAGSAPRYLLYYRSEDDYHRPPDIPDRFSAATDAAHNACILIISPVQPEDEADYYCSVA
Mustela putorius furo V134 trav AGTQ01064410.1 75093 TSDQEFQVTQPESSVSVRAGEILTLSCNVSARSPAGPVLWFRENAQERKLIYNFNGGQFPRVTQVENTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Mustela putorius furo V136 igkv AGTQ01064833.1 81215 ACGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYAASSRATGIPDRFSGSGSGTDFTFSISNLQAEDVGDYYCQQYYSSL
Mustela putorius furo V137 igkv AGTQ01064833.1 35564 VSGDIVMTQSPASLNGSPGERIAMNCKSSQSLLYSSNQKNYLAWYQQKPGQAPKLLIIWASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVGDYYCMQYYSFP
Mustela putorius furo V138 igkv AGTQ01064833.1 31852 CSGDIVLTQSPASLTVSPGQRATISCKTSQNVGDIWGMTHYITWYQQKSGQRPRMLIYKASSQASGAPARFSGSGSGTEFSLTIDPVEDGDAANYYCKQSKE
Mustela putorius furo V139 igkv AGTQ01064837.1 12624 AHGDITMTQSPGSLAVSLGQRVTMNCRASQNIYSNVNWYQQKPGQAPRLLIYAASSRATGIPGRFSGSGSGTDFTLTISNLQAEDVGDYYCQEGYNYP
Mustela putorius furo V140 igkv AGTQ01064839.1 36217 AHGDVTMTQSPGSLAVSPGQRVTMNCRASQGVYNNVAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGDYYCQQYNY
Mustela putorius furo V141 igkv AGTQ01064839.1 5234 AHGDITMTQSPGSLAVSPGQRVTMNCRASQSVSNYVAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISNLQAEDVGNYYCQQGNSF
Mustela putorius furo V142 igkv AGTQ01064840.1 39852 SSGEVVMTQTPLSLTVTPGEPASISCRASQSLVHSDGNTYLHWYLQKPGQSPQLLIYSHFTGVPDRFSGSGSGTDFTLTINRVEADDVGVYYCQQGIQYP
Mustela putorius furo V143 igkv AGTQ01064841.1 59257 SSGEVVLTQTPLSLSVTPGEPASISCRASQSLVHSNGNTYLSWFRQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQG
Mustela putorius furo V144 igkv AGTQ01064841.1 40602 SSGDIMLTQTPLSLSITPRELASISCRASQSLLHRDGNTYLYWYLQKPGQSPQLLIYEVSIHKSGVPDRFSGSGSGTDFTLRISKVEDDDVGVYYCEQG
Mustela putorius furo V145 igkv AGTQ01064841.1 36334 SNGEVVLTQTPLLLSVTPGEPASISCKASQSLVHSNGNTYLDWYLQKPGQSPQLLIYEVSNRYTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQR
Mustela putorius furo V146 igkv AGTQ01064841.1 15323 SSGEIMMTQTPLSLSVTPGEPASISCRASQSLVHSNGNTYLSWFRQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDAGVYYCGQG
Mustela putorius furo V147 igkv AGTQ01064841.1 2042 SSGEAVLTQTTPLTLSVTSGEPASNSCRASQSLVHSNGNTSLNWYLQKPGQSPQILIYLVSSRVSGIPDRFSGSGSGTDFTLTISRVEAGDVGVYYCQQD
Mustela putorius furo V149 trdv AGTQ01065645.1 496 KSVLCDQVTQSPPDQIVASGSSVKLFCTYYTSESNPDLYWYRIWPDHSFQFILYRDKTLSHNADFTGGRFSVLHNPSQRTFHLVIFLVEPEDSATYFCALNP
Mustela putorius furo V150 iglv AGTQ01067839.1 8626 SVASSVLTQSPSVSVSLGQTATITCSGEVLNKKYAQWFQQKPGQAPMLVIYKDTERPSGIPDRFSGSSSGTTHTLTISGTRAEDEADYYCQSYDSNTD
Mustela putorius furo V151 iglv AGTQ01067839.1 1720 SVASYVLTQPPSVSVALGKTAQVTCGGNNIGNKYVHWYQQKAGQAPVLIIYESNKRPSGIPERFSGTNSGNTATLTISGARAEDEADYYCQVWDSSSN
Mustela putorius furo V152 iglv AGTQ01067840.1 13364 SMASSVLTQSPSVSVSLGQTATITCSGEILSKSYARWHQQKPGQSPVNIIYKDTQRPSGIPDRFSGSSSGSTHTLTISRAQAEDEADYYCQGWDGNGK
Mustela putorius furo V153 iglv AGTQ01067853.1 2913 TSSEAVVTQEPSLTVSPGETVTLTCASSYGAVSNGHFPCWFQQKPGQSPRTLIYNTHNKPSWTPARFSGSLLGGKAVLTLTGAQPEDEAEYHCFLQYGDG
Mustela putorius furo V154 iglv AGTQ01067859.1 11811 SWAVLTQPPYVSGALGESVTISCTGIPTSIDYDEEEYTYNVNWYQQLQGKVPILLIYGDNNRNPGVPDRFSGSKSGSSASLTISGLQAEDEADYYCQ
Mustela putorius furo V155 iglv AGTQ01069756.1 26461 SWAQSVLTQPSSLSGSLGQRVTISCTGGSTNIGDGYSVYWYQQHQGKAPKTIIYGTSSRPSGVPERFSGSRSGNTGSLTITGLKTEDEADYYCSSWDKSLS
Mustela putorius furo V156 iglv AGTQ01070550.1 16406 STVAYELTQDSSVSVNLGQTARITCRGDNIGSKYAYWYQQKPSQAPLLIIYGDSNRPSGIPERFSGTNSGNTATLTISGAQAEDEADYYCQVWDSGN
Mustela putorius furo V157 iglv AGTQ01070553.1 33892 SMASYVLTQPPSISVKLGQTAKITCGGDNIGNKYAYWYQQKPGRVPVLIIYEDSKRPSGIPDQFSGTNSGNTATLTISGARAEDEADYYCQVWDSSTN
Mustela putorius furo V158 iglv AGTQ01070553.1 18397 SVVSSEVTQPPFVSVALGQTATITCTGEKVKYSSIHWYQQKPGQAPLTVIYAEIERPSGIPERFSGSRSGNTATLTISSVQAEDEADYYCQSHYSYDN
Mustela putorius furo V159 iglv AGTQ01070555.1 19156 SVTSELTQPPSVSAALGQTATITCTGEEVEYIYVYWYHQKPGQAPLTVTYDDSDQPSGIPEKFSGSKSGNTATLTISSAQAKDEADYYCQSLTAVVM
Mustela putorius furo V160 iglv AGTQ01070556.1 1815 SMASYVLTQPPSISVKLGQTAKITCGGDNIGNKYAYWYQQKPGRVPVLIIYEDSKRPSGIPDQFSGTNSGNTATLTISGARAEDEADYYCQVWDSSTN
Mustela putorius furo V161 iglv AGTQ01070711.1 1907 SWAQSSLTQEASLSASVGQEVTLNCAGNDNNVGAYYVGWYQQVSGGAPKTVMLGTTRPSGIPDRFSGSHSGNKASLIISNLWPEDEADYYCSTWDKGINN
Mustela putorius furo V162 iglv AGTQ01070723.1 6315 ANSQTVVIQEPSVSVSPGGAVTLTCGLSSGSVSTSNYPQWFQQTPGKAPRLLIYSTSSRPSGVPGRFSGSISGNKAAFTIKEAQLEDEANYHCLLYMGSG
Mustela putorius furo V163 iglv AGTQ01071012.1 29948 SMASYVLTQPPSISVNLGQTAKITCEGNNIGRKSIYWYQQKLDQSPVLIIYRNSNRPSGIPDRFSGTNSGNMATLTISGACAEDEADYYCQVWDNNSN
Mustela putorius furo V164 iglv AGTQ01071012.1 8019 SVAAYVLTQPPSMSVNLGRTASITCSGDNIGSTYVSWNQQKPGQAPVTIIYSDSSRPSGIPDRFSGSNSGNMATLTISGARAEDEADYYCASYDSSRDT
Mustela putorius furo V165 iglv AGTQ01071135.1 3747 SVTSSELTQPPSVSVALGQTATVTCTGGELEYFYVHWYQQKPGQAPLTIIYGDKERPSGIPERFSGSKSGSTATLTISSAQAEDEADYYCQSFDISVN
Mustela putorius furo V166 iglv AGTQ01071136.1 1273 SMASSVLTQPHLVSVSLGETATITCSGEVLSKYYAQWYQQKAGQAPKQVIYKDTECPSGIPDRFSGSSSGTTHTLTINRVQAEDEADYYCQSSDSSDK
Mustela putorius furo V167 iglv AGTQ01071139.1 24811 SMSAYVLTQPPSMSVNLGQMASITCSGDNIGGIYVSWQQLKLGQTPMTIIYSDSNQPSGIPDRFSGSNSGNMATLTISGAQAEDEAITDYYCAYDSSRDT
Mustela putorius furo V168 iglv AGTQ01071139.1 18702 SMASYVLTQPPSVSVALGQTAQVTCTGNNIGSKHVYWYQQQPGHIPVLIIYNSNKRPSGTPERFSGTGSGNTATLTISGAQAEDEADYYCHMLDSSAD
Mustela putorius furo V169 iglv AGTQ01071184.1 2128 ADSQTVVIQEPSLWVSPGGTVTLTCGLSSGSVSSNNYPYWYQQTPGKTPRLLIYDTNNRLPGVPGRFSGSISGNKAALTITGAQLEDEADYHCLLYMGSGS
Mustela putorius furo V170 ighv AGTQ01071337.1 415 VLSQLTLQESGPGLVKPSQTLSLTCVVSGGSVTSSYYWNWIRQRPGKALEWMGYWTGSTRYNPAFQGRISITADTSKNQFSLQLSSMTTEDTAVYYCAR
Mustela putorius furo V171 ighv AGTQ01071419.1 3732 VQCEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYPMSWVRQAPEKGLQWVAYISSDGSSTSYADSVKGRFTISRDNSKNTLYLQMNSLKIEDTAVYYCAR
Mustela putorius furo V172 ighv AGTQ01071429.1 1389 VQCEVQLVESGGDLVEPGGSLRLSCAASGFTFSNYDMNWIHQVPGKGLQWVAWIRSDGNSIYYADSVKDRFTISRDNGKNTLYLQMNSLRTEDTAMYYCAT
Mustela putorius furo V173 igkv AGTQ01071771.1 1472 SHGEITMTQSPGSLAVSPGQRVTMNCRASQSVNNYVNWYQQKPGQAPRRLIYYTSNRDTDIPDRFSGSGSGTDYTLTISNLQAEDVGNYYCMQYDSS
Mustela putorius furo V174 igkv AGTQ01071772.1 1371 SHGDIMMTQSPGSLAVSPGQRVTLNCRASQSVSNYVAWHQQKPGQAPRLLIYRASNRATDIPGRFSGSGSGTDFTLTISNLQAEDVGNYYCLQYDSFP
Mustela putorius furo V175 ighv AGTQ01072019.1 2327 VECEVQLVESGGDLVKPGGSLRLSCAASGFTFSSYGMHWVRQAPGNGLQWVAVIWYDGSKTYYADSVKGRFTISRDNGKNMLYLQMNSLRAEDTAVYYCVK
Mustela putorius furo V177 iglv AGTQ01072335.1 13507 SVASYVLTQPPSVSVALGQTAQVTCGGNNIGNKFVHWYQQKPGQAPVLIIYNSNKRPSGIPERFSGTKSGNTATLTISGSRAEDEADYYCQVWDRSSD
Mustela putorius furo V178 igkv AGTQ01072389.1 1630 SSGEVVLTQTPLSLSVTPGEPASISCRASQSLVHSNGNTYLSWYLQKPGQSPQGLIYKVSNRFTGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCFQG
Mustela putorius furo V179 igkv AGTQ01072390.1 27552 SSGEVVMTQTPLSLTVTPGEPASISCRASQSLVHSDGNTYLHWYLQKPGQSPQLLIYSHFTGVPDRFSGSGSGTDFTLTINRVEADDVGVYYCQQG
Mustela putorius furo V180 igkv AGTQ01072853.1 1638 AHGDITMTQSPGSLAVSPGQRVTLNCKASQSVSNYVKWYQQKPGQSPRLLIYYASGRASGIPDRFSGSGSGTDYTLTISNLQAEDVGNYYCLQYDSF
Mustela putorius furo V181 iglv AGTQ01072930.1 2225 FVAAYELTQPPLMSVNLGRTASITCSRDNIGNTYVSWYQQKLGKAPMMIIYSGSNRPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCLSYKSGSGN
Mustela putorius furo V182 iglv AGTQ01073378.1 3356 SMASYVLTQPPSMSVNLGQTVRMTCGGNNIGRKSVPWYQQKPGLAPVMIIYGDSSRPSGIPDRFSGTNSGNTATLTISGVRAEDEADYYCQVWDNSAD
Mustela putorius furo V183 ighv AGTQ01073896.1 718 VYTQVHLLQSGAEVRNPGASVKVSCKASGYTFTDYYMHWVRQAPERGLEWMGRIDPEDGATNIAQKFQARVTLTADTSTSTAYMELRSLKSEDTAVYYCA
Mustela putorius furo V184 iglv AGTQ01074245.1 1743 SVVSSELTQTPFVSVAPGQTATITCSGEELDYGYVQWYQQKPGQAPLMVIYLDNERASGIPERFSGSKSGNTATLTISSVQAEDEADYFCQSYDSSGN