WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sorex araneus AALT00000000.2 (AALT02) 282 95 52 57 45 23 4 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sorex araneus V238 iglv AALT02069029.1 9642 SQPTLSQPDSMLVFPGQVAQLSCTLSFPHVTIGDYGVSWYQQRAGSAPRLLVYYRSKEDHHRAAGIPDRFSVAMDEAHNACILTISPVQPEDDADYYCSVGSIF
Sorex araneus V307 trdv AALT02087820.1 23168 QGTECDLVNQNSQVQSVVQGGQVRLLCTYITDLSDPDLFWYRIRPDHSFQFVLYKDNSYFFDADFTEGRFSVQHDGRKKTFHLVISSAQTEDSATYYCALS
Sorex araneus V402 ighv AALT02103707.1 945 AAGGVWGRLGAARGSLRLSCVASGFNFGSYYMGWVRQAPRKGLEWISYISPGDNTYYADSVKGRFTISRDISQNTLSLQMSSLREEDTALYYCVR
Sorex araneus V403 ighv AALT02103707.1 15053 VQCEVQLVESGGDLVKPGGSLRLSCAASGFNVGSYWMNWVRQAPGKGLEWVSCITSSGGTYYADSVKGRFTISRDNSQNTLSLQMSSLREDTALYYCLR
Sorex araneus V501 ighv AALT02129698.1 3626 VLSQEQMQESGPSQVMPSQTLSLTCSVSGFSLTSYHVNWVRQAPGKGLDWIGSIRTGGSTAYNPSFQSRVSISRDTKNQVYLKLSNSVTEDTAVYYCAR
Sorex araneus V502 ighv AALT02129699.1 484 VQCEVQLLESGGDLVQPRGSLRLSCEASGFTFSDYWMSWVRQAAGKGLEWVSRIRYDSDYISYADSVKGRFTISRDNSKNTLYLQMSSLMGEDSALYYCVR
Sorex araneus V546 iglv AALT02135852.1 2429 SWAQTGLTQERSVSRSVGQTVTLTCTGTISNVGTYGAGWYQQIPGAAPKTVMIGSTRPTGIPDRFTGSKSRSKASLTISGVQPEDEADYYCSSLDDRMSS
Sorex araneus V590 ighv AALT02148151.1 525 VLSQVQLKESGPSLVTPSQTLSLTCSVSGFSLTSYSVHWVRQAPGKGLDWIGVIWNGGGTTYTPSLQSQLGISRDTSKNQVFLKLSNSVTEDTAMYYCAR
Sorex araneus V682 ighv AALT02180139.1 614 VLSQVQLQESGPNLVTPSQTLSLTCSVSGFPITSSSSGMDWFRQLPGKGLDWIGGISTVGSTFYNPSLQSRVSISRDTSKNQVYLKLSNSVTEDTAVYYCAR
Sorex araneus V683 ighv AALT02180142.1 459 VNSQVQLVQSGAEMAKPGTSVKISCKASGYTFASSYMSWVRQAPGQGLEWMGWIYPGNGNTNYAPKFQGRLTVTADKSKDTAYMELSRLSTEDTAVYYCAR
Sorex araneus V684 ighv AALT02180154.1 4471 VQCEGQLVESGGVLVKPGGSQRFSCTASGFTFSDYWMNWIRQAPGKGLEWILCISGSSGTIRYADSVKGRFTIFRDNSKNMFYLQMNSLREEDTALYYCV
Sorex araneus V685 ighv AALT02180156.1 1169 VHSQAQLVQSGAEERKAGTSVKIFCKASGYTFTDHWIQWVRQAPGQGLEWVGRIYPDGGDTRYSQKFEGRVTFTLDESTTTAYMELSRLSTEDTAVYYCAR
Sorex araneus V686 ighv AALT02180806.1 8714 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTLSDYWMNWFCQAPGKGLEWVSTISSDSRFTYYADSMKGRFTISRKSSKNTLYLQMSSLREEDTALYYCMR
Sorex araneus V687 ighv AALT02180810.1 674 ALSALTLQESGPGLVKPSQTLSLTCSVSGGSVTSSYYWHWIRQRPGKGLEWMGYWSGSTNYNPVFQGRITITADPSKNQLFLQLSSVTTEDAAVYYCA
Sorex araneus V688 ighv AALT02180815.1 1934 VNSQVQLVQSGAEVAKPGTSVKISCKASGYTFASYYMNWVRQAPGQGLEWMGEIYPGNGGTTYAPKFQGRLKLTADTSKDTAYMELSRLSTEDTAVYYCA
Sorex araneus V689 ighv AALT02180816.1 200 VQCEVQLVESGGDLVQPGGSLRISCVASGFNFGNNDMNWFRQVPGKGLEWISYIRYDSAYVNYANSVKGRFTISRDNSKNTIYLQMSSLREEDTALYYCAR
Sorex araneus V690 ighv AALT02180818.1 691 TAGAVRGLVGKPGTSVKISCKTSGYTFGDAYVNWLRQAPGHGLEWMGRRYPGYSAFDYAPKFQGRLTLTADTSKNTVYMELSRLSIEDTAVYYCVK
Sorex araneus V692 ighv AALT02180835.1 9864 VNSQVQLVQSGAELGKPGTSVKISCKASGYTFTSYAVHWVRQTPGQGLEWMGWVYPNNGGTKYAQKFQGRLTLTADKSKDTAYMELSRLSTEDTAVYYCAK
Sorex araneus V693 ighv AALT02180851.1 17635 AVSTLTLQESGPGLVKPSQALSLTCSVSGFSITTSGYCWHWIRQPPGKGLLWLGDICASGNTYYSQSFKGRVSITRDTNKNQFSLQLSSVTPEDTAVYYCA
Sorex araneus V694 ighv AALT02180851.1 22224 SGALVESGGDLVKPGGSLRLSCAASGFNFGSYYMSWVHQAPGKGLGWISYISPGGGTYYADSVKGRFTISRDNSKNTLSLQMSSLREEDRALYYCAR
Sorex araneus V695 ighv AALT02180944.1 2373 VNSQVQLVQSGAEVGKPGTSVKISCKASGYTFTNHWISWVRQAPGQGLEWMGEIYPGNGNTKYAQKFQGRLTITADTSKDTAYMELSRLSTEDMAVYYCAR
Sorex araneus V696 ighv AALT02180955.1 902 VLSQVQLQESGPSLVTPSQTLSLTCSVSGFSISNNHVHWVRQGPGKGLEFIGSIGSTGIIYYNPSLQSRLSISRDTSKNQVYLKLSNSVAEDTALYYCAG
Sorex araneus V697 ighv AALT02180957.1 5229 VNSQVQLVQSGAEVEKPGTSVKISCKASGYTFTSYVMHWVRQAPGQGLEWMGWVGPSSGGTKYAPKFQGRLTLTADKSKDTAYMELSRLSTEDTAVYYCAR
Sorex araneus V698 ighv AALT02180957.1 18310 VQCEVQLVESGGDLVQPGRSLTLSCAASGFNVGSYWMNWVRQAPGKGLEWVSSISSGGGTYYADSVKGRFTISRDNSKNTLSLQMNSLREEDTALYYCAR
Sorex araneus V700 ighv AALT02180958.1 9167 VNSQVQLVQSGAEVGKPGTSVKISCKASGYTFTSKWMHWVRQAPGQGLEWMGTIDPSDGYTNYASKFQGRLTVTADKSKDTAYMELSRLSTEDTAVYYCAR
Sorex araneus V701 ighv AALT02180962.1 3837 VNSQGQLVQSGAEVGKPGTSVKISCKASGYTFTNYCMSWVRQTPGQGLEWMGYISPNTGGTVYASKFQGRLTLTAYKSKDTAYMELSRLSTEDTAVYYCWV
Sorex araneus V702 ighv AALT02180968.1 3259 TAAGVGTKPGDTPSETLSLTCSVSGFSLTTYALHWVRQAPGKGMEWIGIMWVGGSTDYNPSLKSRVSISRDTAKNQVYLKLNNSVTEDTAVYYCAKE
Sorex araneus V703 ighv AALT02180970.1 3399 VQCEVQLVESGGDLVQPGGSLTLSCAVSGFDLGSSYMNWIRQAPGKGLEWVSHITSSGGTYYADSVKGRFTISRDNSKNTLSLQMSSLREEDTALYYCAR
Sorex araneus V704 ighv AALT02180971.1 12643 AVSALTLQESGPGLVKPSQTLSLTCSVSGGSVTSSDYWNWIRQRPGKGLEWMGSGGTRYNPAFQGRISITADPSKNQFSLQLSSVTPEDTAVYYCA
Sorex araneus V705 ighv AALT02180974.1 4109 VLSEIQLQESGPGLVAPSQTLSLTCSVSGFSITTSGYCWDWIRQPPGKGLVWLGEICYNGNTNYSPSLKSRVSITRDTNKNQFSLQLSSVTPEDTAVYYCAR
Sorex araneus V706 ighv AALT02180978.1 4979 VNSQVQLVQSGAEVGKPGTSVKISCKAPGYTFGDAYVNWVRQAPGQGLEWMGRLYPGFSAFDYAPKFQGRLTLTVDTSKDTAYMELSSTEDTAVYYCAR
Sorex araneus V707 iglv AALT02181171.1 1939 SFSQPVLTQAPSVSASLKTSVKLTCTLSSGYSGYIVGWYQQSTGKGPRFVMSVGPSGQVGSKGDGIPDRFLGSGSGLDRFLTIQNIQAEDEADYICGAGSSNF
Sorex araneus V708 iglv AALT02181171.1 10918 SLSQPVLTQEPSVSASPGSTAKLTCTLSSGFSVGNHRIYWYQQKTGNSPRYLLNYYASTSLGSGVSNRFSGSKDTSANAGLLHISGLQPEDEADYYCRIGYSGT
Sorex araneus V709 iglv AALT02181176.1 1720 TVAQEGLTQNPAVAHSPGQKATLTCTGNNNNVGYQGAVWIQQHSDQAPTTVMFRTNNRPSGISDRFSGSRSGSVATLTISRLRPEDDADYYCTAWDRSLS
Sorex araneus V710 iglv AALT02181176.1 7007 SSSQAVVTQDPSLAVSPGGTVVLTCASSTGAVTDGHYPYWFQQKSGQAPRTMIYNTNKKHSWTPARFSGSIRGDKAALTISGAQSEDEAEYYCWLVYSGV
Sorex araneus V711 iglv AALT02181180.1 6802 SLSQPVLTQEPSVSAPLGKTVILWCTLSSGFSVGSYKISWYQQKTGNSPRFLLNYHETSTEFGSGAFNHFSGSKHISANAGLLHIFGLQPEDEADYYCMI
Sorex araneus V712 iglv AALT02181185.1 1078 VDSQTVVTQEPSLSVLPGETATITCGLSTGSVSTGNYPGWYQQTPGHAPRTMIYNTNSRPSGVPDRFSGSISGNKAALTITRALTEDDAEYYCMLYMGS
Sorex araneus V713 iglv AALT02181191.1 2070 TVAQEGLTQKPAVAHSLGQKATLTCTGNNNNVGHEGAVWIQQHSDQAPTTVMIRTNNRPSGISDRFSGSRSGSVATLTISGLRPEDEADYYCTAWDRSLN
Sorex araneus V715 iglv AALT02181196.1 10261 ATSQTVTQEIFLSTTPGGTVTLTCDPSTGSISTSNYASWIQQKPYQAPSSVISSTNNRLPGVPPRFSGSLLGNKAVLTITGAQAEDEAEYYCVLWFSNH
Sorex araneus V716 iglv AALT02181206.1 506 SWAQSSLIQPLSVSEALGRTVTISCGGSSNDIGYYSDGVSWYQQRPGTAPKLLIYDTSYRPSDIPNRFSGSKSGNTATLTISELKAEDETEYYCC
Sorex araneus V717 iglv AALT02181208.1 19751 TQAQNVLTQLPSVSGTEGQRVTISCAGTSDDIGISNDVSWYQQHQSTALKILIYYVKNRPSGIPDRFSGSKSGNTATLTISGLKPEDEADYYCC
Sorex araneus V718 iglv AALT02181208.1 27007 TWAQNVLTQPLSVSGTQGQTVTISCTGTSNDIGGYDYVSWYQQNENTTLKILIYYVSSRPSGIPDRFSASKSGSTATLTISGLKPEDEADYYCGSYRTGG
Sorex araneus V719 iglv AALT02181209.1 3573 SWTQHGLTQPSSVSEALGGAVTISCIGSSNDIGYYTKGVSWYQQLPGTAPKLLVYGTSRPTDIPDRFSGSKSGNTATLTISGLKPEDETDYYCC
Sorex araneus V721 iglv AALT02181212.1 187 IWAQSALTQPPSVSGTPGHTVTISCTGTSNDIGGYNDVSWYQQQEGTAPKMLIYNVNKRPSGIPDRFSGSKSGNTATLTISGLRPEDEADYYCASYRSANK
Sorex araneus V723 ighv AALT02182231.1 608 VNSQVQLVQSGAEVAKPGTSVKISCKASGYTFTGYWMHWVRQAPGQGLEWMGMVNPSNDGTQYAQKFQGRLTLTVNRSKDTAYMELSRLSTEDTAVYYCA
Sorex araneus V724 ighv AALT02182233.1 1664 VLSQIHLKELGPSLVPPSKMLSLTCSVSGFSITDYHVHWVRQAPGKGLDWVGLMWNYGVTKYNPSLKSRLSITRDTSENQVYLKLSSSVTEDTAVYYCAREQH
Sorex araneus V725 ighv AALT02182235.1 8369 AVSALTLQESGPGLVKPSQTLSLTCSVSGGSVTSSDYWHWIRQRPGKGLEWMGRWSGNTIYNPAFQGRISIMADPSKNQFSLQLSSVTSEDTALYYCA
Sorex araneus V726 ighv AALT02182244.1 489 VLSQVQLQESGPGLVAPSQTLSLTCSVSGFSITTIGPCWHWIRQPPGKGLLWLGKICYAGDTNYTPSLKTLVSITRDTNKNQFFLKLSSVTPEDTAVYYCAR
Sorex araneus V727 ighv AALT02182762.1 9323 VQCEVQLVESGLVKPEGNLRLSCVACGFNFGSYAMGWVSQAPGKGLEWLSTISHGGSKIYYADSVKGRFTISRDNSKNTLSLQMSSLRVQDTALYYCVK
Sorex araneus V728 ighv AALT02182780.1 2857 VLSQVQLQESGPGLVIPSQMLSLTCSVSGFSLTNYYMHWVCQAPGKGLEWIGVIYISGEINYNPSLQSRVSISRDTSKNQVYLKLSNSVTEDTAVYYCA
Sorex araneus V729 igkv AALT02182803.1 6069 ARCDIQLTQRPSVSESLGEKVTITCKASQSVSKSFLHWYQQKPGTAPRLLIYSATNLGPDVPSRFSGSGSGTDYTLTISSLEPEDAATYYCQQYDSSP
Sorex araneus V730 igkv AALT02182808.1 3914 SWCDIQMSQPPSVSASLGEKVTITCKASQSIGKLVAWYQQKPGKAPRLLIYASSSLRPDVPSRFSGSGSGTDFSLTISSLTSEDAATYYCQQHAYLP
Sorex araneus V731 igkv AALT02182811.1 16811 ARCDIQMTQPPSMSASLGEKITITCKASQNIYSYIAWYQQKPGKAPRLLIYSATSLGPDVPPRFSGSGSGTDFTLTISSLEPEDAATYYCQQHSSYP
Sorex araneus V732 ighv AALT02182863.1 120 VNSQGQLVQSGAEVGKPGTSVKISCKASGYTLTSYGIQWVRQAPGQGLEWMGWINPYNDVANYAQKFQGGLTLTADKSKDTAYMELSRLSTEDMDVYYCAR
Sorex araneus V733 iglv AALT02183144.1 635 TWAQYVLSQIPSVSGSPGEKVTISCTLSSGNIGSNYAHWYQQRPGSGPTNVIYKDNQRPSGVPDRFSGSINRSSNAAHLTITGVQPEDEADYYCQSGYS
Sorex araneus V734 iglv AALT02183148.1 4488 SWAQTGLTQELSVSGSVGQTVTLSCTGNSHNVGDKGAGWYRQITGAAPKAVMYRSSRPTGIPARFTATKSGNRAYLTVSGVQPQDEADYYCASWDNSISN
Sorex araneus V735 iglv AALT02183148.1 19306 SLSQSVLTQPPSVSESPGTTAKISCTLSSDLSVRGTNMYWYQQKSGSHPQFFLYYYSDTDKQLGPGVSNRVSGSKDTSTNTAYLLISDLQSGDEADYYCQLYNNN
Sorex araneus V736 iglv AALT02183151.1 3921 SMAHTGLTQQPTVIQTLGQMVTLTCTGNSNTVGYHGAVWMQQHPGHTPKSVMSRDNNRPSGISDRFSGSRSDNVATLTISGLRPEDEADYYCAAWDRSLN
Sorex araneus V737 iglv AALT02183239.1 790 FCVPATLTQTPSASASPGASTRLICTLSQEQSSYYIEWYQQIQGKAPTFLMQVKSDGTFSKGDNIPFRFSGSSSGADRYLTISNIQSVDEAEYYCGVSNTGVY
Sorex araneus V738 iglv AALT02183243.1 1367 FCAPAMVTQTPSASASPGASTRLTCTLSQEHSSYRIEWYQQIQGKAPTFLMYVKSDGTFSKGDNVPDRFSGSSSGADRYLTISNVQPVDEAEYYCGVRGSGY
Sorex araneus V739 iglv AALT02183244.1 2220 TWTQHALTQPSSMSESLGQTVTISCVGSSNDIGYSKLVVSWYQQRPGIAPKLLIYRTTSLPSDIPDRFSASTSGNTATLTISGLKAEDESDYYCCSYTKS
Sorex araneus V740 iglv AALT02183248.1 3164 TWAQNVLTQPPSVSGTQGQTVTISCTGTSNDIGAYNDVSWYQQQEGTAPKMLIYNVNKRPSGIPDRFSGSKSGNTATLTISGLKPEDENDYYCSSYTRS
Sorex araneus V741 ighv AALT02183349.1 2223 VQCEVQLVEFGGGLVKPEGTLRLSCAASGFNFGSYYMNWVRQAPGKGLEWTLEISGSGGTSYADSVKVQFTISRDKSKNTLHLQMSSLREEDMALYYCAR
Sorex araneus V742 iglv AALT02183537.1 6111 TLAQSALNQPPSVSGTLGQTVTISCTGTSDDIGRYDDVSWYQQQEGTAPKMLIYKVNIQPSGIPDRFSGSKSGNTATLTISGLKPEDEADYYCGSYRAFNK
Sorex araneus V743 iglv AALT02183537.1 12760 IRAQNVLTQPPSVSGTPGQTVTISCTGTSNDIGAYNYVSWYQQQEGTAPKMLIYDVNNRPSGIPDRFSGSKSGNTATLTISGLKPEDEADYYCGLPRIG
Sorex araneus V744 iglv AALT02183541.1 72 TWAQNVLTQPPSVSGTQGQSVTISCTGTSNDIGTYSSVSWDQQQDSTTPKTLIYDINKRPSGIPDRFSGSKSGNTATLTISGLKPEDEADYYCDSYRRG
Sorex araneus V745 iglv AALT02183548.1 1988 FCAPPMVTQTPSASASPGASTKLTCTLSQEHSSYRIEWYQQIQGKAPTFLMYVKSDGTFSKGDNVPDRFSGSSSGADRYLTISNVQSVDEAEYYCGVGYSLY
Sorex araneus V746 ighv AALT02183743.1 18926 VLSQVQLQESGPGLVAPSKTLSLTCSVSGFSITTSYSCWEWVRQPPGKGLLWLGRICYNGNTYYSFKSRISITRDTNKNQFSLQLSSVIPEDTAVYYCSR
Sorex araneus V747 ighv AALT02183744.1 1437 VNSQVQLVQPGAEVGKPGTSVKISCKASGYTFVDYYMHWVRQSPEQGLEWMGWIYPGNSETGYSQKFQGRLTLTADKSKDTAYMELSRLSTEDTAVYYCTI
Sorex araneus V748 ighv AALT02183747.1 104 VQCEVQLVESGGDLVQPGRSLTLSCVASGFNLGSSYMNWVRQAPGRGLEWVSRISSGGSTYYADSVKGRFTISRDNSKNTLSLQMSSLREEDSALYYCARE
Sorex araneus V749 ighv AALT02183763.1 172 VLSQVQFQESGPSLVPPSQMLSLTCSVSGLSLTSYDVNWVRQAPGKGLDWIGTMWSNGNTYYNPSLQSRASISRDTAKNQVYLKLSNSVTEDTAVYYCA
Sorex araneus V750 ighv AALT02183765.1 403 VNSQVQLVQSGAELAKPGTSVKISCKASGYTFTGYYMHWVRQAPGQGLEWMGNIYPGNGGTNYAQKFQGRLTFTVDKSKDTAYMELSRLSTEDTAVYYCTR
Sorex araneus V751 ighv AALT02183833.1 2244 VNSQVQLVQSGAEVGKPGTSVKISCKASGYTFTSKGMHWVRQAPGQGLEWMGWLNTNSGSTGYAPKFQGRLTFTVDKSKDTAYMELSRLSTEDTAVYYCAR
Sorex araneus V752 ighv AALT02183942.1 1841 VHCEVQLVESGGDLVQPGRSLRLSCAGSGYNFGSYYMNWVRQVPGKGLEWVSRILPGGTTYYADSVKGRFTFSRDKSKNTLSLQMNSLREEDAALYYCVREID
Sorex araneus V753 igkv AALT02183961.1 5272 ARCDIQMTQTPSMSASLEEKVTITCKASQNVGKYLAWYQQKPRKAPRLLIYYTSNLQSGVPSRFSGSGSGTDFTLTISSFKPEDAATYYCQQGYTP
Sorex araneus V754 ighv AALT02183999.1 1448 VQCEVQLVESGGELVQPGGSLKLSCVASGFTFSDYRMHWVHQAPGKGLEWISEIISSGANTYYADSVKGQFTISRDNSKNMLSLQMSSLKEEDIALYYCA
Sorex araneus V755 ighv AALT02183999.1 9835 VLFQVQLQESGPSLVPSWQMLSLTCSVSGFSLTSYDVNWVRQATGKGLEWIGVIHASGSTKYNRRLQSQLSISRDTSKNRVNLKLSNSVTEDTAVYYCAR
Sorex araneus V756 ighv AALT02184039.1 619 VLSQVQLQESGPGLVKPSQMLSLTCSFCGFSLTCYSMNWVRQAPGKGLDWIGRIRYDGNTYYNPSLQSRVSISRDTSKNQVYLKLSNSETEDTAVYYCAR
Sorex araneus V759 iglv AALT02184286.1 636 SLSQPVLTQLPSLSASPGTTVRLSCTLRSGISVGNYRISWYQQKPGSPPWYLLNYHTDSDKGQGSGVPSRFSGSKDASANAGILHISGLQPEDDAEYYCATYYS
Sorex araneus V761 ighv AALT02184977.1 1267 IQCEVQMVESGGGLVKPEGNLRLSCVASGFNFGSYAMGWVRQAPGKGLEWVSSISSGGSTYYADSVKGRFTISRDNSMNTFSLQMSSLREQDTALYYCA
Sorex araneus V763 ighv AALT02185608.1 63 VNSQVQLVQSGAEVAKPGTSVKISCKASGYTFSSYGINWVQQAPGQGLEWMGWINTNTGVANYAPKFQGRVTITKDTSIDTAYMELNRLSTEDTAMYYCAR
Sorex araneus V764 iglv AALT02185880.1 4667 TWAQFVLTQIPTVSGSPGEKVTISCTRSSGDIGSEWVHWYQQRPGSAPTKVIYNDNKRPSGVPDRFSGSIESASNAAHLTITGVQPEDEADYYCQSSDSSY
Sorex araneus V769 ighv AALT02190162.1 769 VQCEVQLVESGGDLVQPGGSLRLSCVDSGFSISDKSMNWVRQAPGKALEWISYIRYDGGFTSYADSVKGRFTISRDKSKNTLYLQMSSLREEDTALYYCVR
Sorex araneus V770 iglv AALT02190191.1 168 SMAHTRLTQQPTVIQTLGQMVMLTCTGNSNTIGHHGTVWMQQHPCHTPKSVMSMDNNWPSGITDRFSDSRSDHVATLTISGLRPEDEADYYCTAW
Sorex araneus V771 ighv AALT02193216.1 533 VNSQIQLVQSGAEMEKPGTSVKISCKASGYTFTNPWISWVQQAPGQGLEWMGRVSPYNGNTNYAQKFQGRLTLTADTSKDTAYMELSRLSTEDTAVYYCAR
Sorex araneus V773 iglv AALT02194421.1 1024 SWAQTGLTQEGSVSRSVGQTVTLTCTGTRNNVGINGAGWYQQIPGAAPKTVMLGSKRPSGIPDRFAGSKSGNKASLTISGLQPEDEADYYCASWDNSVSG
Sorex araneus V775 ighv AALT02197428.1 784 VNSQVQLVQSGAEVEKPGTSVKISCKASGYTFTSYDINWVRQAPGPGLEWMGDIYPNSGGTNYAPKFQGRLTITTNKSKDTAYMELSRLSTEDMAMYYCA
Sorex araneus V913 trdv AALT02041907.1 25085 ARAQAVQVNDSMSGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGTKQNVAIYNPSMGVSVLMPYRQRVQFLRPSFVDGTIRLSRLELEDEGVYICEF
Sorex araneus V976 trgv AALT02062749.1 51792 SLGQMSLEQPEKSVSMTLEKSATISCKMHNGDFYNAYIHWYRQKRNKNMERLIYVSTTTPANRHIDGKSKLVASKNTQTSTATLMIKSLEKEDEATYYCACW
Sorex araneus V977 trgv AALT02062749.1 46240 TSADILITQMKTSIIKKEGNTAFLECQVKTTALKRNVYLHWYRQKPEQPLQRILYISSNENVVHEQGISEERYEARKLQSELPASLRIHQTKDEDAGLYYCACWD
Sorex araneus V978 trgv AALT02062749.1 43454 GNTNIRISQDQSFTRRLDKTVHLSCKLSGIPLDNAIVHWYEQKEGEPLRRILYGSTKSFKQDNLNPRLETDKKDNGIFYLIINNVIESDGATYYCACWD
Sorex araneus V979 trgv AALT02062752.1 7362 SQEAFRLLQDPVVVGRVDTSASLTCKSSTAVRYIHWYRQQEGRAPQWLLRLDMLDSDVRLSSVLGADKVTALTTTKDCSCSLVVLKLEHRDQGMYYCASW
Sorex araneus V1000 iglv AALT02069030.1 7474 SETQPVLKQPPSVSSPLGTTVRLACALSSDYDISNYAIYWYQQRPGHPPRFLLRYFSPSNKQNGANIPPRFSGSKDVSLNTGYLSISELQPEDEALYYCAVGTA
Sorex araneus V1021 trbv AALT02077755.1 22184 LMKAEVTQSPRHLVKKMGETVLMECSQNMNHDRMFWYRQDPALGLRLLHFSYGAGTTEKGDVPEGYSVSRKEKKSFSLTVQSAELSQTSVYLCASSL
Sorex araneus V1022 trbv AALT02077755.1 17616 SVFGVLLSQNPVRDICQGGNSVTIQCQLDTQMSLLYWYQQLPGQSLKMIATANQGNEATYERGFSKDKFPISRPTLTFSSLTVNNLSSEDSSLYFCSA
Sorex araneus V1023 trbv AALT02077757.1 10510 SMDVGITQTPRSRVTKTGTSLSLECSQMRGDDSMYWYRQAPGRGLRLIYSSSGVGDISKGEMKEGHSGSPGWKEKFALSIAAATSIHSPLYFCASRY
Sorex araneus V1024 trbv AALT02077757.1 4823 ITGAGISQTPRRWVTGAGKKVTLECSQTMDHSYMYWYRQDSGMELQMIHYSYDVNVVAKGEFSSESTASRISKETFLLNLESANPSQTSQYFCASSE
Sorex araneus V1025 trbv AALT02077758.1 4153 SIDIKVIQTPAYLVKNQGQRAKMTCTPHKGHAFVYWYQQIQDKEFRFLVYLQNQEIIDQIDVNKKWFSAECPSSSPCSLEIKSSEPENSALYFCASSQ
Sorex araneus V1026 trbv AALT02077760.1 19334 STEAGVTQTPRHVVTAKGQAVTLRCRPISGHSGLFWYRQTSDQGPTLLIYFHNQEPLDNSGMPKERFSAEMPEESLSTLKIQPVDPGDSALYLCASSL
Sorex araneus V1027 trbv AALT02077760.1 16949 HPVGTTVFQSPRFLVIQKGHAVTFNCFQNLGHDSMYWYKQKLSQGPKLLLYYYDLNLNREKDTSENFQASRPNASFCSLVIRSPDVEDSAVYLCASSR
Sorex araneus V1028 trbv AALT02077760.1 12159 SLQAQVTQTPGQLVKGKGQEARMSCTPQKGHDYVYWYQQIRNEEFKFLISFQNDEIFYEGEMPKERFSPACPKGSPCVLKIQPTEPQDSAVYFCASSD
Sorex araneus V1029 trbv AALT02077760.1 8092 DGFGALVSQHPRRAICQNGASVTIQCRPEGFQATVMFWYRQSLGQGLQLMATSNAGSSATYETEFTKDKFPITHPNFTFASLMVTSVQPKDSDVYFCAAS
Sorex araneus V1030 trbv AALT02077763.1 17444 HESAGVTQSPRNRVTGRGQEVVLRCDPISGHFGLYWYQQAPGQGPRFLMIFQGDKATDTSGMPPDRFSAERPEGSYSTLKIQSTEPGDSAVYLCA
Sorex araneus V1031 trbv AALT02077763.1 2759 HASAGVTQSPRNRVTTRGQEVVLRCDPISGHFGLYWYQQAPGQGPRFLVFFQNKDATDTSGMPQDRFSAERPEGSYSTLKIQSAEPGDSAVYLCA
Sorex araneus V1032 trbv AALT02077764.1 14208 PADAEVTQSPRHLVTARGQPVTLRCNYESGHESVYWYQQTLGKGPRFLIQYFSGTMRDKGDIPERFSVQQFSKDSSSELSVSSVEGADSALYLCASSL
Sorex araneus V1033 trbv AALT02077764.1 6558 PADAEVTQSPRHLVTARGQPVTLRCNYESGHQYVYWYQQAVGKGPLFLARYVNGEENVKGDIPAHFSVQQFSQEYRSELSVSSVEGADSALYLCASSL
Sorex araneus V1034 trbv AALT02077765.1 12741 PADAEVTQSPRHLVTARGQPVTLRCNYESGHLSVFWYQQALGQGLKFLIQYYSGEEREKGDIPARFSVQQFSQDSRSELSISSVQGADSALYLCASS
Sorex araneus V1035 trbv AALT02077765.1 6999 TVDAEVTQSPRHLVTARGQPVTLRCNYESGHDSVYWYQQALGQGPKFLIQYYSGEEREKGDIPAHFSVQQFSKDSRSELNISSVEGADSALYLCASS
Sorex araneus V1036 trbv AALT02077765.1 3810 TVDAEVTQSPRHLVTARGQPVTLRCNYESGHYNVYWYQQAFGKSLQFLIQYDSGEMRDKGDIPARFSVQQFSQDSRSELSISSVQGADSALYLCASSL
Sorex araneus V1037 trbv AALT02077766.1 2830 PADAEVTQSPRHLVTAKGQPVTLRCNYESGHNSVYWYQQALGQGPKFLIQYFNEAVGEKGDIPARFSVQQFSKDSRSELNISSVQGADSALYLCASS
Sorex araneus V1038 trbv AALT02077769.1 2498 PADAEVTQSPRHLVTARGQPVTLRCNYESGHWYVYWYQQALGKGPDFLVSYYNGQENEKGSITARFSVQQFKDNSSSELSVSSVEVADSALYLCASS
Sorex araneus V1039 trbv AALT02077770.1 5862 PADAEVTQSPRHLVTARGQPVTLRCNYESGHSSVYWYQQMLDQGPQFLVQYYNGKEYQKGSIPARFSVQQFKDSSSSELSVSSVEGADSALYLCASS
Sorex araneus V1040 trbv AALT02077770.1 2725 PVDAEVTQSPRHLVTARGQPVTLRCNYESGHDSVYWYQQDLGQGPVFLVQYYGGQEYKKGSIPERFSVQQFSKDSRSELNISSVEGADSALYLCASS
Sorex araneus V1041 trbv AALT02077774.1 747 PADAEVTQSPRHLVTAKGQPVTLRCNYESGHQYVYWYQQALGKGPDFLVSYFGEQEYQKGSIPARFSVQQFSKDSRSELNISSVDGADSALYLCASSL
Sorex araneus V1042 trbv AALT02077785.1 4765 PVNTEITQTPKYLIMGMTSKKTLKCKQDMGHNAMYWYKQSPQVPLDLMFIYNFKNLLENKTVSSRFSPECPDSSQLYLHVGALNPEDSALYLCASSK
Sorex araneus V1043 trbv AALT02077786.1 2233 FMEPGITQTPKHLVTVMGGRGTLKCKQHLGHSAMYWYKQNPQEPPELMFYYNNKELLDNKTVSNRFSPECPDKSQLFLHMGALQPGDSALYLCASSK
Sorex araneus V1088 trdv AALT02087822.1 28658 APMDIILEPDTRTLTVQVGEPVTFRCSVTGGDLKNYQMSWYKKNEDNALVLVYKLSNNSNNNLRNNFKGEINILMSQYILDIPKATTKDVGTYYCGSD
Sorex araneus V1089 trdv AALT02087827.1 1170 SCNSNSITQSTHAMYKQEGDFGLMDCSISVSYTSYFLYWYRRRPSSGEMIHVINMYSERKMEKKNRYTVTFQKEKKSLRLTISDLTPSDSAVYFCAASD
Sorex araneus V1091 trav AALT02087836.1 6010 VSSEDKVTQNLPILVVHEGENASLSCNYEVTAFQSLHWYKQQENGPTLLLKLFESGNKRDSGRLVGMLHKKERLSTLSIIVTKPEDSATYLCAVE
Sorex araneus V1092 trav AALT02087838.1 745 VSGQQLNQSPQSVLLKEGESVSMNCNSSTVFNMFAWYKQHAGKGLVLLVTLYKGGDSIPKGRMTAKVGERRMDSSLSISASAPEDAGTYFCAG
Sorex araneus V1093 trav AALT02087839.1 9456 ITGNAKTTQPQSMQSVEGEPVSLPCTHSSISGNEYIYWYRQLPHQGPEFIIYGLKSNETNEKASLMIATDRKSSTLILPHGTLRDSAIYYCFLRQ
Sorex araneus V1094 trav AALT02087840.1 2468 VQSLQVEQSPPSLIVQEGEGVTIHCSSLKTFYSLHWYRQKPGEGPLSLMVLLQGGEKKTNDEITATLNDKKQQSTLHITASQASHSGTYFCAAE
Sorex araneus V1095 trav AALT02087841.1 16555 VSTQQLEQSPRLQKIQEGENFTVSCKSSSTLSSLQWYRQEPGKGPVLLIILTKGGEPKTQKRLTFLFDNSRKNSSLFITDARPEDTAIYICAA
Sorex araneus V1096 trav AALT02087841.1 10651 VKVQMNVDQSPGVLMVQEGELSSLTCTFSVTMTSVQWFRQNPGGSLVSLFYIASGMKEEGRLKCTVNVKEQNSHLYIRDSQPGDSGTYFCAV
Sorex araneus V1097 trav AALT02087841.1 2444 VKSNDQRQVIQNTVFLSVEEGGVSIIDCDYNSNMLDYFYWYRMYPAKGPELLITISSVKDKNENGRFTVFHDKTAKHLSLNIKATVLGDSALYLCAGR
Sorex araneus V1098 trdv AALT02087842.1 103640 SSMTQKVTQAQSTVFMVEKEATTLNCIYETRTHVFYLFWYKQLPNGKMIFLIHQESYERNATNGRYSLNFQKSTSSISLTISDSQLQDSAVYFCALRD
Sorex araneus V1099 trav AALT02087842.1 89435 ESTGDSVNQTTGPVTLSEGEPLVLNCIYQTTYLAPYLFWYVQYEHKGLELLLKSSSENRETQTGFRADLEKTSSSFHLQHPSVQISDSAVYYCALR
Sorex araneus V1100 trdv AALT02087842.1 79776 FSLTQEVTQAQSTVPRLEKESVTLDCEYKTSATNYYLHWYKQLSSGEMIFLILQESYKKNAVKGRYSLNFQKPTSSISLTITSLQPGDSAVYFCALSE
Sorex araneus V1101 trav AALT02087842.1 69258 GLRAEDRVEQSPQTWRILEGQSLDLTCNYTVSYFRGLYWYRQDPGRGPEFLFSLLSAGDNKHKDGLRATLSKEGSSLHFTAPKPEDSATYLCAVE
Sorex araneus V1102 trav AALT02087842.1 56912 VSSKQEVNQSPPALNGQEGNGFILKCNYTDSAIYFVQWFRQDPGIGLTSLLKIQPNQEERLNERIRGSADKSSRESALYITASQPSDSSTYLCAV
Sorex araneus V1103 trav AALT02087842.1 53599 GTRTQSVTQPDVHITVDEGDPLEVRCIYTSSVPPYLFWYVQYPNQELQLLLKYVSTENIVSGIKGFEAEFRKTDTSFHLRKSSAHWSDSAQYFCGVK
Sorex araneus V1104 trav AALT02087842.1 43959 VRGQVEQSPAVLSLQEGTNGTLWCNCSNAMNGVQWFRQNPGGPLISLFYIASGTKHNGRLKATAVPLERRSLLHISSSQPTDSAIYFCAVSHSAPQ
Sorex araneus V1105 trav AALT02087842.1 27052 ARSNMDVKQDPQPLQVQEGKDTNFTCNFPSGSFYALHWYIWKPTESPKILYVISSRTYEKDEEHMRVTLNADKGTSYLYIKGSQLEDSAMYLCAF
Sorex araneus V1106 trav AALT02087843.1 19690 ETRAQTVVQPEYHISVLEGNPVMVKCNYSYSGSPYLFWYVQYPKKGLQLLLKHISEQRVNGFTAKHNKDEKSYHLEKASAQEEDSATYYCALS
Sorex araneus V1107 trav AALT02087843.1 11671 VNSQQDDEQNLQVLSIQEGENITVKCSYKTTINNLQWYRQDPGKGLTQLVLMYSNEKNKDKGRLQFKLDNSAKNSSLFIIGAQAADAATYFCAVD
Sorex araneus V1108 trav AALT02087843.1 4039 GIRGDSVTQTEETVTLLEGQPLTLSCTYQTSYTPYLFWYVQYANRGLELLLKSSTDNQKAPHRFQATLMKSDKTYHLQNPSVQVSDSAVYYCVLS
Sorex araneus V1109 trav AALT02087844.1 1628 TRSQENKVEQSSEPLRVPEGATASLKCTYSNSASQYFSWYRKYPGRGPEFLIAMYSTEDKDIGKFAVKLNKTNLHFSLFIRESRSSDSATYLCAVS
Sorex araneus V1110 trav AALT02087845.1 13765 QTLGDSVSQTEGQVTLSEAASLTITCNYSVSYAYPTLYWYVQYPGEGLKVLLKAQKDKEVGRERGFEATYRQDSKSFHLEKAAVQESDSAVYYCASS
Sorex araneus V1111 trav AALT02087845.1 8936 MSGKPHVEQNPSSLVIQEGDNCSLQCNYTLTPFNNLRWFKQDSGRGLVPLIILTYSDSRKSSRRYTVTLNPTSFRSSLHITAARLQDAASYICAVG
Sorex araneus V1112 trav AALT02087846.1 4334 TSRGENVEQHPSAMNVQEGKTVVLNCTYPDSFSTYFFWYKKEPGKSLQPILYILSNKPIDQDQRFTVLLRKNDKQLSLEITDIQLGDSAVYYCAVK
Sorex araneus V1113 trav AALT02087848.1 15417 VSGGEKVVQSPSLSVQQGSKAVINCTYSKSVSDYFPWYKKEPGKSLQLMIYIRSPKPQEQKERYKVLLNENEKHLSLHIDDTQPGDSAVYFCAE
Sorex araneus V1114 trav AALT02087848.1 10302 SSIAQNVEQTQSPIQVQETETVTLDCMYNTTSYSYSLFWYKQPNHREMIFLLRQDSYGKENVREGRYSVDFQETSKSIKLVISASQVEDSAVYFCALRE
Sorex araneus V1115 trav AALT02087848.1 1761 QIRGDSVTQMEGQVTLSEKASLTINCTYSVSGYPRLFWYVQYPGEGPKVLLKAQRDKEVGREKGFEATYRQDSKSFHLEKAAVQESDSAVYYCASS
Sorex araneus V1116 trav AALT02087849.1 3029 SSIAQNVEQSQTPIQVQETETVTLDCMYDTSYPSYTLFWYKQPSHREMIFLLRQDSYGEENVREGRYSLDFQKTSKSIKLVISASQVEDSAVYFCALRE
Sorex araneus V1117 trav AALT02087850.1 1254 VSGGEKVEQSPSLSVQQGSKAVINCTYSNSASDYFPWYKKEPGKSLQLMIYIRSTKEREQKERYTVLLKKNEKHLSLHIDDTQPEDSAVYFCVE
Sorex araneus V1118 trav AALT02087853.1 11631 VSGGEKVVQSPSLSVQQGSKAVINCTYSDSASDYFPWYKKEPGKSLQLMIYIRSTKELEQKERYTVLLKKNEKHLSLHIDDTQPGDSAVYFCAER
Sorex araneus V1119 trav AALT02087853.1 6585 SSIAQNVEQAQSPIQVQETETVTLDCMYNTTSYSYSLFWYKQPNHREMIFLLRQDSYGKENVREGRYSVDFQETSKSIKLVISASQVEDSAVYFCALSE
Sorex araneus V1120 trav AALT02087854.1 13509 PSIAQTVKQTQTPIQVQETETVTLDCMYNTSSTSYSLFWYKQPSHREMIFLIRQDSYAKENVREGRYSVDFQETSKSIKLVISASQVEDSAVYFCALRE
Sorex araneus V1121 trav AALT02087854.1 2580 VSGGEKVVQSPSLSVQQGSKAVINCTYSDSASDYFPWYKKEPGKSLQLMIYIRSTKELEQKERYTVLLKKNEKHLSLHIDDTQPGDSAVYFCAER
Sorex araneus V1122 trav AALT02087855.1 2580 VSGGEKVVQSPSLSVQQGSKAVINCTYSDSASDYFPWYKKEPGKSLQLMIYILSTKELEQKERYTVLLKKNEKHLSLHIDDTQPGDSAVYFCAER
Sorex araneus V1123 trav AALT02087856.1 9885 QIRGDSVTQEEGQVTLSEKAPLTINCTYSASGYPTLYWYVQYPGEGLKVLLKAQKDKGVGREKGFEATYRQDSKSFHLEKAAVQESDSAVYYCASS
Sorex araneus V1124 trav AALT02087857.1 8909 VSRGEKVEQRPSTLSVQQGSKAVINCTYSDSASSYFPWYKKEPGKSLQLIIYTRSTKEREQNERYTVLLKKNEKHLSLHIADTQPGDSAVYFCAAS
Sorex araneus V1125 trav AALT02087859.1 33150 AVGAQSVTQPDPQASVSEGESLELSCKYSGTAPYLYWYVQYPGQGLQLLLKYFSGDPLVKGIKDFEAELKKTETSFNLKKRVAHLSDSAKYFCAVS
Sorex araneus V1126 trav AALT02087859.1 18265 RSSGDSVTQTKGQMTLSAGASLTVNCSYETTQYPALFWYVQYPGESPQVLLKAVKATETGRGKGFKATYDSETTSFHLKKAAVQESDSAVYYCASS
Sorex araneus V1127 trav AALT02087859.1 6988 AVGAQSVTQPDPPASVSEGESLELSCKYSYGATPYLFWYVQYSGQGLQLILRYFSGDPLVKGIKDFEAEFNKTDSSFNLKKRFAHWSDSAKYFCAIS
Sorex araneus V1128 trav AALT02087861.1 1449 AVGAQSVTQSDPQASVSEGESLELSCKYSGTALYFYWYVQYPGQGLQLLLKYLSGDPLVKGIKDFEAELKKTETSFNLKKRIAHLSDSAKYFCAVS
Sorex araneus V1129 trav AALT02087862.1 2484 AVGAQSVTQPDPQASVSEGESLELSCKYSGTALYFYWYVQYPGQGLQLILRYFSGDPLVKGIKDFEAELKKTETSFNLKKRVAHLSDSAKYFCAIS
Sorex araneus V1130 trav AALT02087865.1 15970 AARAQSVTQPDAHVSISEGTALELRCKYSYSVGTPFLFWYVQYSGQALQLLLKTSGGTFVKGIKDFEAELKKTESSFNLKKRVAHWSDSAKYFCVVS
Sorex araneus V1131 trav AALT02087865.1 10795 AVGAQSVTQPDPQASVSEGESLELSCKYSYSAGTPYLYWYVQYPGQGLQLLLKYFSGDPLVKGIKDFEAELKKTETSFNLKKRVAHLSDSAKYFCAVS
Sorex araneus V1132 trav AALT02087865.1 1461 AVGAQSVTQSDPQASVSEGESLELSCKYSYSGSTPYLYWYVQYPGQGLQFLLKYFSGDPLVKGIKDFEAEFNKTKSSFNLKKRIAHWSDSAKYFCAIS
Sorex araneus V1133 trav AALT02087866.1 11684 GVRGMKVEQTPSSLSLQEGTSSTLRCNFSTTANYVQWFRQNPGGGLISLFFIASEPKKSGRLSATMSLKERFSTLKLTASQLQDSATYFCAA
Sorex araneus V1134 trav AALT02087866.1 5237 VSCQKIEQNTHSLSILEGEKAILTCDYTNYSPVNFQWYRQDAGRGLVFLLLIRESEGEKKAGRLKATFDPATKQSSLHISGSQPADSATYFCAAD
Sorex araneus V1135 trav AALT02087867.1 11675 TLSLAKTIQHISLDSYEGQEVNISCSHTSIATNEYIFWYRQFSNQGPQFVIRGFKLNEKNEIASLFISDDRKTSTLSMSRIALRDAAVYYCIVS
Sorex araneus V1136 trav AALT02087867.1 2088 GAGAQSVTQPDAHISVSEGAPLELRCIYSYSGTPYLSWYVQYPNQGLQLLLKHIVGKAQVRGTNNFMAEFRSQETSFHLKKSSATWNDSAQYFCALE
Sorex araneus V1137 trav AALT02087868.1 1117 GLSAQSVTQPENQVTVTEGELLTVKCNYSTSGSPFLFWYVQYPNQGLQFLLKYITGNNLVKGSRGFEAELDKSQTSFHLKKPSVVGSDSAVYFCAVS
Sorex araneus V1211 igkv AALT02108703.1 16681 CRGHITLTQFPEVLAALPGGFVSITCRSSTEVGTSMAWYQQKPKKAPKLLIFGTSARAAGTPARFRGSSYGSDFSLSIHGVEAEDAGVYYCQQHFSRP
Sorex araneus V1212 igkv AALT02108703.1 9419 SSGQIVLTQADKSLAVSPGESVSIRCRASESLLFKDGKHYLSWYKHSPGKSPQVLIYHASTLLIGVSSRFSGSVSGTDFSLTIRNLEPEDYAHYYCLQTFKNP
Sorex araneus V1392 igkv AALT02152389.1 1707 CRSDAVLTQSPLSLSIIKGEPTSISCTSSQSLIYNGNTYLNWCHQKPGQSPRLLFYKVSNRKPGVPDRFSVSGSDTKFTLQINRVEPEDVGIYYCMQDL
Sorex araneus V1393 igkv AALT02152392.1 10736 SRCDVQMTQTPSMSASLGDKVTITCKASQSVSNWLSWFQQKPGKAPRLLIYDATNLETDVPSRFSGSGSGTDFTLTISSFKPEDAATYYCQQYNKLP
Sorex araneus V1394 igkv AALT02152393.1 3839 SRSISVMTQSPLSLSIVKGEPSSISCTSSESIVHDGNTYLNWFHQKPGQPPRLLFYKVSNRLPGVPDRFSASGSGTKFTLQISRVEPEDVGIYYCNQTTWYP
Sorex araneus V1395 igkv AALT02152395.1 6158 SRSDVVMTQSPLSLSIVKGQPTSISCTSSESITTGAGNTYLSWYHQKPGQPPRLLFYKVSNRLTGVPDRFSASGSGTKFTLQISRVEPEDVGVYYCNQATKDP
Sorex araneus V1396 igkv AALT02152399.1 874 SRSDVVMTQSPLSLSIVKGQPTSISCTSSESITTGAGNTYLSWYHQKPGQPPRLLFYKVSNRLTGVPDRFSASGSGTKFTLQISRVEPEDVGVYYCNQATKDP
Sorex araneus V1397 igkv AALT02152403.1 3284 SSSDIVLTQSPLSLSIVKGKPTSISCTSSESLLYSDGTTYLCWFHQKPGHPPKRLFYHVSKRDPGVPDRFSSSGSETKFTLQISSVEPEDVGVYYCFQGTKT
Sorex araneus V1398 igkv AALT02152405.1 2301 ARCDIPMSQSPSVSASLEDKVTITCKTTQSISNQLVWYQQKLGKAPRLFIYQAIQLGQDIFPRFSGSQSGTDFTLTISSLKPEDAATYYCLQYRDNP
Sorex araneus V1399 igkv AALT02152408.1 7225 SRSDVVMTQSPLSLSIVKGEPTSISCTSSQSLIYSDGNTYLRWFHQKPGQPPRLLFYKVSNRQPGVPDRFSASGSETKFTLQISRVELEDVGVYYCVQSSWYP
Sorex araneus V1431 iglv AALT02163602.1 6772 FVSSYELNQPPSLSVSPGGEAKMTCRGNNIDGYYVQWFQQKPGQAPVQVIYQSTQRPSGIPDRFSGSNSGGTATLTIRGVRTEDEADYYCQVWDSNN
Sorex araneus V1432 iglv AALT02163605.1 995 SVYSYELNQPPSLSVSPGGEAKMTCTGNILGSNYGNYVYWYQQKAGQAPELVIYRNTGRPSWIPDRFSGSKSGDTATLTISGVRPEDEADYFCQVWTGIN
Sorex araneus V1433 iglv AALT02163608.1 1543 SVSSYELNQPPSVSVSPGGEAKMTCRGNSIGSYYVYWYQQKPGKAPVLVIYESNKRPSGIPDRFSGSNSGGTATLTISGVRTEDEADYYCQVWDSNS
Sorex araneus V1497 igkv AALT02178473.1 874 ARCDIQMTQTPSMSASLGDKVTITCKASQSVSYDLNWYQQKPGKAPRLLIYGAKYLGPDVPPRFSGSGYGTDFTLTISSFKPEDAATYYCQQGYSS
Sorex araneus V1498 igkv AALT02178476.1 2971 ARCDIQMTQPPSMSASLRDKVTITCKASQGICIGLAWYQQKPGEAPRLLIYDATSLGPDIPPQFSGSRYGTDFTLTISSLEPEDAATYYCQQDNSYP
Sorex araneus V1499 igkv AALT02178477.1 884 GRCDIQMSQPPSVSASLGDKVTITCKASQNINKNLAWYQQKPGKAPRLLIYGATNLGPDVPPRFSGSGSGTYFSLTISSFKPEDAATYYCQQGYTP
Sorex araneus V1500 igkv AALT02178481.1 1124 SKCDVQISQPPSLSASLGDKVTITCRASENIKSLLAWYQQKPGQDPRLLIYGANNLGPGAPPQFSGSGSGTDFTLTISSLLPEDAATYYCYLT
Sorex araneus V1501 igkv AALT02178487.1 8830 SWCDIQMSQPPSISASLGERVTITCRASENINSWLAWYQQKPGETLRLLIFKSTSLGPDVPSRFSGSGSGTDFTLTISSLKPEDAATYYCYQHNTNP
Sorex araneus V1502 igkv AALT02178488.1 48707 SRSAVVMTQSPLSLSIVKGEPTSISCTSSESIVHGNGNTYLRWFHQKPGQPPRLLFYKVSNRHDGVPDRFSASGSGTQFTLQISRVEPEDVGVYYCMQSTKVL
Sorex araneus V1503 igkv AALT02178488.1 34435 SWCDVQMTQTPFMSASLGDKVTITCKASQSVSSYLNWYQQKPGKAPRLLIYWIDSLEPDVPSRFSGSGSGTDFTLTISTFKAEDAATYYCQQGDNFP
Sorex araneus V1504 igkv AALT02178488.1 21867 ARCDIQMSQPPFVSASLGDKVTITCKASQNVGKYLAWYQQKPGKATRLLYNGNTGLGPGVPSRFSGSGSGTDFTLTISSLELEDVATYYCHQHGNV
Sorex araneus V1505 igkv AALT02178488.1 12148 SRCDIQMSQPQSMSASLEEKVTITCKASEKIYNRLAWYQQKPGKAPRLLIHTTTNLGPDVPPRFSGSGSGTDYTLTISNFKPEDAATYYCQQGWSNP
Sorex araneus V1506 igkv AALT02178490.1 9656 SRCDIQMTQTPFMSASLEDKVTITCKSSQSVSSHLNWYQEKPGKAPRLLIYWATNLGPDVPSRFSGSGSGTDYTLTISSFKAEDAATYYCQQSTSYP
Sorex araneus V1507 igkv AALT02178492.1 1631 SRCDVQMTQIPSMSASLGDKVTITCKASQSISNYLDWYQQKPGKAPRLLIYDATNLGPDVPSRFSGSGSGTDFTLTISTFKAEDVATYYCLQYYKLP
Sorex araneus V1508 igkv AALT02178505.1 5021 SRCDIQMTQPVSLSASLGDKVTITCKASQSISKWVAWYQQKPGKAPRLLIYAATSLGPDVPPRFSGSGSGTDFTLTISNLKPEDAATYYCQQHYTSP
Sorex araneus V1509 igkv AALT02178511.1 8528 ARCDIQMSQGPSESASLGDKVTITCKASQNIYGALSWYQQKPGKAPRLLIYDATNLGPDVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQGNNLP
Sorex araneus V1510 igkv AALT02178515.1 1165 SRSDVVMTQSPLSLSIVKGQPTSISCTSSESITNNKGITYLNWFHQKPGQPPRRLFYQISNRDPGVPDRFSGSGSGTKFTLQISRVEPEDVGVYYCNQGKWLP
Sorex araneus V1511 igkv AALT02178521.1 5617 FRSDVVMTQSPLCLSIIKGEPTSFSCTSSESLLYSDGNTHLYWFHQKPGQPPRRLFYLVSNRDPEVPDRFSSSGSGTDFTLRISRVEPEDVGVYYCMQTTKHP
Sorex araneus V1512 igkv AALT02178528.1 7206 SRSAIVMTQSPLSLSIVKGEPTSISCRSSESIVNSDGNYLSWYHQKPGQPPRLLLYEISHRGPGVPVRFSGSGSGTQFTLQISRVEPEDVGVYYCYQGSKT
Sorex araneus V1513 igkv AALT02178530.1 5929 SRSDVVLTQSPLSLSIVKGEPTSISCTSNESLLYSDGNTSLKWYHQKPGQSPRQLFYEISNKLPWVPDRFSGSGSETKFTLQISRVESEDIGVYYCRQATKVP
Sorex araneus V1514 igkv AALT02178532.1 2715 SRSDVVLTQSPLSLSIVKGEPTSISCTSSESLLYSDGNTYLKWYHQKPGQSPRQLFYEISNKLPWVPDRFSSSGSGTQFTLHISRVESEDIGVYYCMQATKHP
Sorex araneus V1515 igkv AALT02178535.1 616 ARCAIQVTQSPSVSAYLEEKVTITCKASQSISNWLAWYQKKPGKASFLLIHLASNLGPDIPPRLSGSGSGADYTLTISSMKPEDAAIYYCQQHELP
Sorex araneus V1516 igkv AALT02178536.1 1245 SQCDIQMSQPPSVSASLGEKVTITCKASQSINSGLAWYQQKSGNAPRLLIYLATNLGPDVPPRFSGSQSGTDFTLTISNLKPEDAATYYCHQHNAYP
Sorex araneus V1517 igkv AALT02178539.1 11724 SKSDVVMTQSPLSLSIVKGEPTSISCTSSESIVHANGKTYLNWFYQKPGQPPRILFNLVSNRQPGVPDRFSGSGSGTHFTLQISRVEPEDVGIYYCMQATKYP
Sorex araneus V1518 igkv AALT02178545.1 2715 ARCDIQMSQPSSVSASLGEKVTITCKASQNNYNNLHWYQQKRGKAPRLLISYATSLGSDVPSRFSGSGSGTDFTLTISSFKPEDAAIYYCQQSSSYP
Sorex araneus V1519 igkv AALT02178546.1 20395 SRCDIQMTQTPSVSASLGDKVTITCKASQGINNWLAWYQQKPGKAPRLLIYDATNLGPDVPSRFSGSGSGTDFTLTISSLMSEDAATYYCQQRQAYS
Sorex araneus V1520 igkv AALT02178546.1 10560 SRSAVVMTQSPLSLSIVKGEPTSISCTSSESLLYSDGNTYLNWFHQKPGQPPRLLFHKVSNQQPGVPDRFSSSGSGTQFTLQISRVEPEDVGLYYCMQVSWYP
Sorex araneus V1521 igkv AALT02178547.1 4973 SRSDIVMTQSSLSLSIVKGEPTSIACTSSKSLVHNNGNTYLSWYHQKPGQPPRILFYKVSERQSGVPDRFSGSGSGSYFTLSISRVEPEDVGIYYCNQVTEVP
Sorex araneus V1522 igkv AALT02178549.1 3209 SRSDIVMTQSSPSLSIVKEKPTSISCTSSESLLYSDGKTYLNWFHQKPGQPPRRLFYQVSNRDAGVSDRFSGSGSGTEFTLQISRVEPEDVGVYYCN
Sorex araneus V1523 igkv AALT02178551.1 17653 SWCDIQMSQPPFVSASLGDKVTITCKASQSVSNWLYWYQQKPGKAPRLLIYKVTNLGPDVPSRFSGSGSGTDFTLTISSFKAEDAATYYCEQFDKLP
Sorex araneus V1524 igkv AALT02178551.1 10748 SRCDIQMTQPPFLSASLGEKVTITCKASQSINSGLVWYQQKSGKAPRLLIYLATNLGPDVPPRFSGSRSGADFTLTISSLEPEDAATYYCHQYNAYP
Sorex araneus V1525 igkv AALT02178551.1 2900 SRSDVVLTQSPLSLSIIKGEPTSISCRSSESLLHNNGNTYLSWFHQKPGQSPRRLFYKVSNRDPGVPDRYSSSGSGTQFTLQISRVETEDVGVYYCFQGTNAP
Sorex araneus V1526 igkv AALT02178568.1 9017 SRSDVVMTQSPLSLSIIKGESTSISCRSSKSIQYTNGKTYLNWFHQKPGQPPRILFSLISNRNPGVPDRFSGSGSGTEFTLHISRVEPEDVGVYYCMQASWE
Sorex araneus V1527 igkv AALT02178570.1 11297 SRSDIVMTQSPLSLSIIKGEPTSISCTSSESLLYSDGNTYLSWFHQKPGQPPRLLFYLVSNRHDGVPDRFSSSGSGTQFTLQISRVEPEDVGVYYCMQAKIFL
Sorex araneus V1528 igkv AALT02178570.1 1482 VSCAPQMSQPPSVSASLGEKVTITCKASQSIFSALAWYQQKPGKAHRLLISHATSLQLEAPPQFSGSGYWTDFSLTISRLESEDAATYYCLQYSHQP
Sorex araneus V1534 ighv AALT02180736.1 5527 VNSQVQLVQSGAEVGKPETSVKISCKASGYIFSNYDMSWVRQAPGQGLEWMGDINPSHGGTAYAPKFQGRLTLTADKSKDTAYMELSSLSTEDMAVYYCAR
Sorex araneus V1535 ighv AALT02180747.1 3691 TSEGVGTKPGATLVDAVPHLLSLWMLYNCYHVHCVLQAPGKGLDWVGLMWNNGDTKYNPSLKSRLSITRDTFKNQVYLKLSSSVTEDPAMYYCAREQD
Sorex araneus V1536 ighv AALT02180747.1 675 VNSQVQLVQSGAELAKPGISVKNSCKAYTFTSNWINWMWQAPGQGFEWMGGIDPNTGGTSYTQKFQGRLTITADKSKDTAYMELSMLSTEDTAMYYCAR
Sorex araneus V1537 ighv AALT02180750.1 3960 VLSQIQLQESGPGLVAPSQTLSLTCSVSGISIFSGYCWAWISQAPGKSVLRLGHIYSSGSTYYSPSLKSRISITRDTNKNQLSLQLSSVTPEETALYYCV
Sorex araneus V1538 ighv AALT02180753.1 9909 VNSQVQLVQSGAEVAKPGTSVKISCKASGYTFTSYYINWVRQVPGKGLEWMGRIHPGGSDTYYAPKFQGRLTLTADKSKNTAYMELSRLRTEDTAVYYCA
Sorex araneus V1539 ighv AALT02180767.1 22522 VNSQEQLVQSGAEVGKPGTSVKISCKASGYTFTSYAISWVRQAPGQGLEWMGYIYPGSGGTNYAQKFQGRLTFTADKSKDTAYMELSRLSTEDTAVYYCAR
Sorex araneus V1540 ighv AALT02180782.1 10344 VQCEVQLVESGGDLVQPGGSLRLSCAASGFTFSDYWMSWIRKAPGKGLEWVSAINQNSGTKNYAASVKGRFSISRDNSKNTLYLQMSSLREEDSALYYCAS
Sorex araneus V1541 ighv AALT02180786.1 2041 VLSQVQLQESGPSLVKPSQMLSLTCSVSGFSLTNYYMHWVRQAPGKGLDWIGVIRSSGSTEYNPSLQSRVSISRDTAKNQVYLKLSNSVTEDTAVYYCAR
Sorex araneus V1542 ighv AALT02180791.1 878 VLSQIQLQESGPSLVKPSQMLSLTCSVSGFSISRIGVNWVRQAPGKGLDWIGAIWGDGSTYYNPSLKSRLSISRDTAKNQVHLKLSNSVTEDTAVYYCAR
Sorex araneus V1543 ighv AALT02180848.1 947 VLCEVQLLESGGDLAQPRASLRLSCVASGFNFGSDYMGWVRYAPGKGLEWISYISPDGSTYYANSVKGRFTISRDNSQRMLSLQMSSLREEDTALYYCA
Sorex araneus V1545 ighv AALT02181453.1 324 AVSTLTLQESGPGLVAPSQTLTLTCSVSGFSITTRGYCWEWILQPPGKGLLWLGDICASRSTNYSLSFKGRVSITRDTNKNQFSLQLSSVTPEDTAVYYCA
Sorex araneus V1546 ighv AALT02181455.1 5805 FQCEVQLVESGGDLVQPGGSPRLSCAASGFNFGGYAMNWVCQAPGKGLEKISYISSGGSTYYADSVKGQFTISRDNSKNTLSLQMSSLREEDTALYYCAR
Sorex araneus V1547 ighv AALT02181459.1 596 VLSQVQLQESGPSLVKPSQTLSLTCSVSGFSLTDYGVIWVRKTPGKGLGWIGVIYGFGGTEYDTSLQSRVTISRDTAKNQVYLKLSNSVTEDTAVYYCAR
Sorex araneus V1548 ighv AALT02181462.1 1149 VNSQVQLVQSGAEVGKPGTSVKISCKASGYTFTKYWIQWVRQAPRQGFEWMGEVDPSNGNTNHAPKFQGRLKLTADTSKDTAYMELSRLSTEDTALYYCMR
Sorex araneus V1549 ighv AALT02181468.1 4649 VLSQAQVQESGPGLVAPSQTLSLTCFVSIIFITSSGSCWAWVRQLQGKGLLWLGRVCWDGNTYYSPSLKSRLSFTRDTNKDQFSLKLSSVTPEDTAVYYCARE
Sorex araneus V1550 ighv AALT02181468.1 1171 VQCEVQLVEFGGGLVNPEGKLRLSCMASGFNFGSYGMGWVRQAPGKGLEWVSSISYNGGSTNYANSVRGRFTISRDNSKNMLSLQMSSLREEDTALYYCVK
Sorex araneus V1551 ighv AALT02181518.1 1194 VLSQVQLQESGPSQVPPWQMLSLTCSISGFSLTSYEVNWVRQAPGKWLEWIGGIYASGSTKYDRRFQFRVSISRDISKNQVYLKLSNSVTEDTGVYYCAR
Sorex araneus V1552 ighv AALT02181526.1 985 VLSQVQLQESGPGLVAPSQTLSLTCSVSGFPITTSGYCWAWIRQPPGKGLLYLGLICYNGNTNYSPIFKSRISITRDTNKNQFSLQLSSVTPEDTAVYYCARE
Sorex araneus V1553 ighv AALT02181528.1 11370 AAAGVGPKIGVPSQTLSLTCSVSGYSISSGYCWAWVHQPPGKGLLWLGHICSTGSTNYSPTFKSRISITRDTNKNQFSLQLSSVTPEDTAVYYCAR
Sorex araneus V1554 ighv AALT02181528.1 3463 VLSQVQLQESGPSLVTPSQMLSLTCSVSGFSLTDYSVSWVCQAPGKGLDWIGAIWYDGRTYYNPSLQSRVSISRDTSKNQVYLKLSNSVTEDTAVYYCAR
Sorex araneus V1555 ighv AALT02181538.1 1953 VNFQVQLVQSGAEVGKPGTSVKISCKASRYTFTNYWMHWVRQAPGQGLEWMGYIYHNTGGTTYAPKFQGRLTLTADESKDTAYMELSRLSTEDMAVYYCAR
Sorex araneus V1556 iglv AALT02182296.1 1227 SVSSYEVNQPPSLSVRPGGEAKMTCAGNNIGSKVAYWYQQKPGQAPVLVMSDSNRPSGIPDRFSGSNSGNLATLTIRGVQAEDEADYYCAAAGTID
Sorex araneus V1557 iglv AALT02182300.1 24331 FVSSYELNQPPSVSVSPGGEAKMTCRGNNIGGKNVYWYQQKPGQAPVLVIYEDSKRPSGIPDRFSGSNSGGTATLTIRGVRTEDEADYYCQVGDSG
Sorex araneus V1558 iglv AALT02182300.1 21850 SVSSYELNQPPSLSVSPGVEAKMTCRGNNFGSKYVYWYQQKPGQAPVLVIYEDSNRPSGIPDRFSGSNSGSTATLTIRGVRTEDKADYYCQVVDGNS
Sorex araneus V1559 iglv AALT02182300.1 7243 SVASYDLNQPPSVSVSPGVEAKMTCMGSNIGSKYVQWYQQKPGQAPVLVIYQNKYRPSGIPDRFSGSNSGGTATLTITGVRTEDEADYYCQVGDSG
Sorex araneus V1560 iglv AALT02182302.1 1850 SVSSYELNQPPLFSVSPGGDAKMTCRGSNIGSYAVNWYQQKPDQAPVLVIYYDNRRPSGIPDRFSGSNSGGTATLTITGTRPEDEADYFCHVWDSSSS
Sorex araneus V1561 iglv AALT02182304.1 8553 FVSSYELNQPPSVSVSPGGEAKMTCRGNNIEAKNVFWYQQKPDQAPVLVIFDSTNRPSGIPDRFSGSKSGNTATLTIRGVHTEDEADYYCMVWDSNN
Sorex araneus V1562 iglv AALT02182305.1 1263 SVSSYELNQPPSLSVSPGGEAKMTCRGNNIGSKSVHWYQQKPDQAPVLVIYYDNKRPSGIPDRFSGANSGDTATLTITGVRTEDEADYYCQVWGSGY
Sorex araneus V1563 iglv AALT02182307.1 2904 YVTSYELIQRPSISVVPGQAATITCSGELLNERYTEWYQQKPGQRPVLLIYKDSERPSGIPDRFSGSSSRTTTTLTISNTQAEDEADYYCLSSDSSGIN
Sorex araneus V1565 ighv AALT02182918.1 6255 VNSQVQLVQSGAEVAKPGTSVKISCKASGYTFTSYNINWVRQALGQGLEWMGGISPSNGGTDYASKFQGRLTLTADKSKDTAYMELSRLSTEDTALYYCAR
Sorex araneus V1566 ighv AALT02182936.1 11597 VLSQVQLQDLGPSLVMPSRTLSLTCSVSGFFLTSDAVHWVCQAPGKGLDWIGAMWRGGSTDSNPSLQSRVSISKDTSKNQVYLKLSNSVTEDTAVYYCAR
Sorex araneus V1567 ighv AALT02182936.1 3786 VNSQVQLVQSGAEVGKPGTSVKISCKVSGYTFTNYYMNWVRQAPEQGLEFMGRVNTLTDGTDYVQKFQGRLTLTVDRSKDTAYMELNRLSTEDTAMYYCWV
Sorex araneus V1569 ighv AALT02183101.1 953 AAGGVWGRLGAAGGSLRLSCAASGFSISDQSINCVRQAPGKGLEWISYISHDGGFTNYADSVKGRFTISRDNSKNTVYLQMSSLREEDSALYYCVR
Sorex araneus V1570 ighv AALT02183112.1 12616 AVSALTLQESGPSLVKPSQTLSLTCSVSGGSVTSSNYWHWICQRPGKGLEWMGYWTGGTNYNPAFQGRISITADTSKNQFFLQLNSVTPEDTAMYYCAR
Sorex araneus V1571 ighv AALT02183112.1 5633 VQCEVQLVESGEDLMQPGGSLRLSCAASGFNFGGCAINWVCQAPGKGLEWISYISTHGGTYYADSVKGRFTISWENSKSKLYLQMSSPREEDTALYYCMR
Sorex araneus V1572 ighv AALT02183112.1 3052 VLSQVQLQESGPSQVTPPQTLSLTCSVSGFSLTSSYAVHWVRQAPGKGLDWIGAILYNGNTDYNPSLQSRVSISRDTSKNQVFLKLSNSVTEDTAVYYCARN
Sorex araneus V1573 ighv AALT02183207.1 742 VLSQVQLQEAEPSLVTPSETLSLTCSVSGFSLTSYALHWVRQAPGKGLEWIGIMLAGGSTFYNPSLQSRVSISRDTAKNQVYLKLSNSVTEDTTMYYCA
Sorex araneus V1574 ighv AALT02183210.1 756 ENSQVQLVQSGAEVGKPETSVKISCKASGYTFTSYVMSWVRQAPGQGLEWMGDINPSHGGTAYAPKFQGRLTLTADKSKDTAYMELSSLSTEDMAVYYCAR
Sorex araneus V1575 ighv AALT02183379.1 1358 VNSQVQLVQSGAEVAKPGTSVKISCKASGYTFIDHHMHWVQQAPGQGLEWMGMIHPGNSGTNYAQKFKGRVTITADKSKNTAYMELSRLSTEDTAMYYCMS
Sorex araneus V1576 ighv AALT02183384.1 1521 VLSQVQLQESGPGLVAPSQTLSLTCSVSGYSISSGYCWAWIRQPPGKGLLWLGYICSSGSTYYSPSFKSRISISRDTNKNQFSLQLSSVTPEDTAVYYCAR
Sorex araneus V1577 ighv AALT02183727.1 5358 AGVGSRTGGPLPDPLPHLLCLWILHPNQWLLLGLHLQPPGKGLLWLGRTYSDGNTNYSPSVKSRISITRDTIKNHFSLQLSSVTPEDTAVYYCAR
Sorex araneus V1578 ighv AALT02184036.1 6279 VNSQVQLVQSGAEVGKPGTSVKISCKASGYTFTSYYKNWVWQALGQGLEWMGAVNPNSGGTNYAQKFQGRLTLTADTSKDTAYMELSRLSTEDMAVYYCAR
Sorex araneus V1579 igkv AALT02184108.1 8673 ARCDIQMTQTPSMSESLGDKITITCKASQSIGNRLNWYQQKPGKAPRLLIKYATSLGPDVPSRFSGSGSGTDFTLTISSFKAEDAATYYCQQSNSYP
Sorex araneus V1580 igkv AALT02184110.1 6604 SRSDTVLTQSPLSLSIVKGEPTSISCTSSESIKNSDGNTHLSWYHQKPGQPPRRLFYKVSNRDPGVPDRFSGSGSETQFTLQISRVEPEDVGIYYCYQGTNAP
Sorex araneus V1581 igkv AALT02184111.1 16162 ARCDIQMSQPPSVSASLEDKVTITCKASQNIYNSLAWHQQKPGKAPRLLISYATSLQPEVPPRFGGSGSGTDFTLTISSLEPEDAATYYCQQYDSYP
Sorex araneus V1582 igkv AALT02184111.1 9738 ARCDIQMSQPPSVSASLGEKITITCKASQSISNALAWYQQKPGKAPRLLIYGATSLQPDVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQHYSFP
Sorex araneus V1584 igkv AALT02184111.1 462 ARCDIPMSQLPSMSASLEDKITITCKSTQSISNWLAWYLQKLGKAPRLLIYKATGLGQDVPPQFSGSQSRTDFTLTISSLKHEDAATYYCLQYWDNP
Sorex araneus V1585 igkv AALT02184112.1 11971 SRSDIVMTQSQLSLSIVKGKPTSISCTSSESIQYTNGKTYLNWFHQKPGQPPRILFNLVSNRKPGVPDRFSASGSGTDFTLQISRVEPEDVGTYYCMQASWYP
Sorex araneus V1586 ighv AALT02184126.1 1479 VQCEVQLVESGGDLVQPGGSLKISCAASGFTFSDYWMNRVRQAPGKGLEWVSCISSDSSITRYADSVKGRFTISRENSKNTLSLKMNSLREEDRALYYCAG
Sorex araneus V1587 ighv AALT02184132.1 4175 VNSQVQLVQSGAEVGKPGTSVKISCKASGYTFTSYYIYWVRQVLGHGLEWMGRIYPGSSGTNYAQKFQGRLTLTADKSKDTAYMELSRLSTEDTAVYYCAR
Sorex araneus V1588 ighv AALT02184359.1 7478 VLSQVQMQELGPGLVTLSWMLFLTCSVSGFSLNDYSVNWVRQAPGKGLDWIDGIGTGWGTDYNPSLQSRVSISRDTSKNQVYLKLSNSVTEDTAVYYCAR
Sorex araneus V1589 ighv AALT02184381.1 7519 VLSQVQLQESGPGLVAPSQTLSLTCSVSGFSITTSGYCWEWICQPPGKGLLCLGRICWDGSTYYSPSLKSRVSITRDTNKNQFSLQLSSVTPEDTAVYYCA
Sorex araneus V1591 iglv AALT02184439.1 644 SWAQTGLTQEGSVSGSVGQTVTLTCIGTSSNVAIYTTGWYQQIPGAAPKTVLIGSTRPSGIPDRFTGSEFVNKASLIISGMQPEDEADYYCSAWDSILEM
Sorex araneus V1592 iglv AALT02184442.1 865 SWAQTGLTQEVSVSGSVGQTVTLSCTGTSSNVGNYNTGWYQQIPGAAPKTVMFGSNRPTGIPNRFTGSKSGNKASLIISGMQPEDEADYYCSAWDKSINN
Sorex araneus V1593 ighv AALT02184460.1 4010 VQCEVQLVESGGDLVKPGGSLRLSCEASGFTFSNYWMSWIRQSPGKGLEWVSSIKYDSSTTDYADSVKGRFTISRDNSKNTLSLQMSSLREEDTVLYYCVR
Sorex araneus V1594 iglv AALT02184498.1 3222 FCAPSTLTQTPSASASPGASTKLTCTLSQEQSSYTIEWYQQIQGKAPTFLMQVKSDGTFSKGDNVPDRFSGSSSGADRYLTISNVQSVDEAEYYCGVGYSGIY
Sorex araneus V1595 iglv AALT02184499.1 871 TWAQNVLTQPPSVSGTQGQKVTISCTGSSNVIGAFDYISWVQQQEGRAPKMLIYNVNKWPSGIPDRFSGSKSGNTMTLTISGLKFEDEADYYCISYTISDA
Sorex araneus V1596 iglv AALT02184500.1 1413 TWAQNVLTQPPSVSGTPGHTVTISCTGTSNDIGAYNYVYWFQQQEGTAPKTLIYDVNKRPSWIPDRFSGSKSGNTATLTISGLKPEDEADYHCSSYTRS
Sorex araneus V1597 ighv AALT02184552.1 5141 VQCDVQLVESGGDLVQPGGSLRLSCAASGFDFSQYGMHWVRQAPGKGLEWVAIIYYNGATAYYADSVKGRFTITRDNSINKLYLQMSSLRKEDTALYYCVK
Sorex araneus V1598 ighv AALT02184556.1 545 VNSQVQLVQSGAEVGKPGTSVKICKSSGYTFTNYYMSWVRQAPGQGLEWMGYISPNTGGTVYTPKFQGRLTLTADKFKDTAYTELSRLSTEDTAVYYCW
Sorex araneus V1599 igkv AALT02184812.1 1446 SRCDIQVSQPPSMSASLGEKVTITCKASQSVGSCLDWYQQKPGKAPRFLIYDATNLGPDVPSRFSGSGSGTDFTLTISGLKPEDAAIYYCLQRQAFP
Sorex araneus V1600 igkv AALT02184820.1 1214 SRSDIVMTQSPLSLSIVKGEPTSISCKSSESLLYSDGKSYLYWFHQKPGQPPSLLFYLVSNRQPGVPDRFSSSGSGTDFILQISRVEPEDVGIYYCMQQIKYP
Sorex araneus V1601 ighv AALT02184854.1 6752 VQCEVQLVESAGDLVQPGGGEGVPDTLLCSFEFTFSDYWMYWVLQAPGKGLERVSSIRYDSDYTSYADSVKGRFTISRDNSKNMLSLLMSSLREEDSALYYCAG
Sorex araneus V1603 iglv AALT02186524.1 2733 SWAQNGLTQEVSVSGSVGQTVTLTCTGTISNVGTYSTGWYQQIPGAAPKTVMLGSTRPTGIPDRFTGSKSRNKASLIISNVQPEDEADYYCASYDYDIYN
Sorex araneus V1604 iglv AALT02186637.1 9236 SWETQYALTQPSSLSEALGQTVTISCDGSKSDIGFYLYSVSWYQQHPGTPPKVLVYGTSSRPSDIPDRFSGSRSGNTATLTISGLKPEDETDYYCC
Sorex araneus V1605 iglv AALT02186949.1 7905 IRAQNVLTQPPSVSGTQGQTVTISCTGTSNDIGRYDYVSWYQQQDSTTPKMLIYGVKNRPSGIPDRFSGSKSGNTATLTISGLKPEDETDYYCM
Sorex araneus V1606 iglv AALT02187116.1 1909 FCAPPTVTQTPSASASLGASTKLTCILSQEHHNYIIRWYQQIQGKAPTFLMRVNSDGTFSKGDNVPDRFSGSSSGADRYLTISNIQSVDEAEYYCGVSYSGGY
Sorex araneus V1608 ighv AALT02187848.1 2521 VLSQVQLQESGPGLVTPSKMMSLNCSVSGFSLTSDHVHWVHQAPGKRLDLIGVMYTDGGTNYNPSLKSRVSISRDTSKNQVYLKLNNSVTENTAVYYCAR
Sorex araneus V1611 ighv AALT02194006.1 693 VQCEVQLVESGGDLVKSGGSLRLSCAASGFTFNNYGMNWIRQAPGKSLEWISYISTAGGTVRYANSVKNRFIISRENSKNTLSLQMSSLSAEDTALYYCV
Sorex araneus V1613 igkv AALT02194716.1 807 SRSDVVLTQSPLSLSIIKGETASISCTSSESLVYSDGNTYLRWFYQKPSQPPRILFYEVSNRQPGVPDRFSGSGSGTQFTLQISRVEPEDVGIYYCYQGTKS
Sorex araneus V1615 igkv AALT02197776.1 1124 SRSDVVLTQSPLSLSIIKGEPTSISCTSNKTLVNSKGTFLNWYHQKPGQPPRLLFYKVSNGHPGVPDRFSASGSETKFTLQISRVEPEDVGIYYCIQGSWKP
Sorex araneus V1616 igkv AALT02199174.1 1022 ARCDIQMTQTPYMSASLEDKVTITCKASENINSYLAWYQQKPGKAPRLLISGATNLGPDVPLRFSGSGSGTDFTLTISSFKPEDAATYYCEQYSNLP