WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Saimiri boliviensis boliviensis AGCE00000000.1 (AGCE01) 149 28 14 29 35 35 2 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Saimiri boliviensis boliviensis V62 trav AGCE01022737.1 48557 AHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGTKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Saimiri boliviensis boliviensis V72 trdv AGCE01026515.1 21429 RGMLCDNVIQSSPDQTVVSGSEVVLLCTYNARYSNRDLFWYRVKPDHSFQFILYEDDTRSQVAGFAQDRFSGRYVPTKKTFDLVISPVRTEDSASYYCAF
Saimiri boliviensis boliviensis V153 trbv AGCE01061992.1 28542 HTEPEVTQIPSHQVIRMGQEVILWCVPIPNHINFFWYRQILGKKVEFLVYFYNDKILEKSEIFDNRFSVKRPDGTNFTLKIQSTKPEDSATYFCASS
Saimiri boliviensis boliviensis V154 trbv AGCE01061995.1 4897 PVTAGVTQTPKFQVLKSGQSMTLQCAQDMNHDGMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRSNTKDFPLRLEAAAPSHTSVYFCASSD
Saimiri boliviensis boliviensis V155 trbv AGCE01061995.1 16811 PLDSAVSQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYNNKEPILNETVPNRFSPESPDKAHLNLHIESLELGDSAVYFCASSQ
Saimiri boliviensis boliviensis V156 trbv AGCE01061995.1 20782 PMDTGVTQTPKHLVMGMAHNKSLKCEQNLGHNAMYWYKQKAKMPLELMFIYSFQKQTENNSVSSRFTPECPDSSHLHLHLHALQPEDSALYLCASSQ
Saimiri boliviensis boliviensis V157 trbv AGCE01061995.1 27182 LGEAGVTQTPRHLIKMRGQQVTLRCSPVSGHNRVFWYQQAPGQGPQFLFNYYNEMQRQKGNFPDRFSGHQFSNHSSEMNVSALELGDSALYLCASSL
Saimiri boliviensis boliviensis V158 trbv AGCE01061995.1 36453 PVNAGVTQTPKFQVLKTGQSITLQCAQDMNHDRMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYKVSRSNTKDFPLRLEAAVPSQTSMYFCASSD
Saimiri boliviensis boliviensis V159 trbv AGCE01061996.1 2397 HTGAGVSQSPSNKVTEKGKDVILRCDPISGHNALYWYRQSPGKGLEFLIYFQGKDAPDKSGLPSDRFFAERAGGSSSTLKIQRTEQNDSAVYLCASSL
Saimiri boliviensis boliviensis V160 trbv AGCE01061997.1 5737 HTGAGVSQSPSHKVTEKGKDVALSCDPISGHTVLYWYRQSPGQGPEFLIYFQGKNIADDSGLSSDRFSAERPMGSVSTLQIQRTEQADSAVYLCASSL
Saimiri boliviensis boliviensis V161 trbv AGCE01061997.1 11311 PVQAEVTQSPTHLIQTRGQQVTLRCSPISGHTSVSWYQQASGQGPQFIFEYVDELKRSEGNFPGRFSGYQFSDYHSEMNISTLELEDSALYLCASSL
Saimiri boliviensis boliviensis V162 trbv AGCE01061997.1 14020 PVDSGVTQTPKHLLTAIGQQVTLRCSPRSGDLSVYWYRQSLDQSLQFLIQYYNKNEGEKGNIPERFSGNQFPNMSSELNLSSLELGDSALYFCASSI
Saimiri boliviensis boliviensis V163 trbv AGCE01061998.1 1698 HGDAEITQSPRHKGTETGRQVTLKCHQTWNHNYMYWYRQDLGHGLRLIHYSYGVQDINKGEVSDGYVASRSNLEDFPLTLESALSSQTSVYFCASSD
Saimiri boliviensis boliviensis V164 trbv AGCE01062000.1 937 QTDAGVIQSPRHKVTQMGQSVTLRCEPISGHNDLLWYRQTLVQTLELLSYFRSQTRVDDSEMPQDRFSAEMPNASFSSLRIQPTEPRDSALYLCA
Saimiri boliviensis boliviensis V165 trbv AGCE01062000.1 15552 HGDAEITQSPRHKVTKTRRQVTLKCHQTWNHNYMYWYRQDLGHGLRLIHYSVAADNTEKGEVSHGYVVSRSNTEDFPLTLESATHSQTSVYFCASSD
Saimiri boliviensis boliviensis V166 trbv AGCE01062000.1 27288 CTDTGIIQSPKHEVTEMGQAVTLRCEPILGHNLLFWYRQTLVQGLELLSYFRGRSIIDDEQMPKDRFSAERPDGSFSTLRIQPAEQGDSAVYICASRL
Saimiri boliviensis boliviensis V167 trbv AGCE01062002.1 429 PVNAGVTQTPKFQVLKKGQSMTLQCAQDVNYDCMYWYRQDPGMGLRLIYYSVDEGITDKGEVHHGYNVSRSNREDFPLRLEAAALFQTSVYFCAISA
Saimiri boliviensis boliviensis V168 trbv AGCE01062002.1 6171 HTGAGVSQSPRYKVTKRGLDIAFRCDPISGHEMLYWYRGTLGQSPEYLTYFQYEVQQDKSGLPSDRFSAERTGGSFSTLKIQRTEQEDSAVYLCASSS
Saimiri boliviensis boliviensis V169 trbv AGCE01062004.1 4600 PVEAGVTQNPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPEFILEYYEKKERNRGNFPHRFSGHQFRDYSSDLNVSNLERGDSALYLCASSL
Saimiri boliviensis boliviensis V170 trbv AGCE01062006.1 796 PVEAGVTQNPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQGPEFILEYYEKKERNRGNFPHRFSGHQFRDYSSDLNVSNLERGDSALYLCASSL
Saimiri boliviensis boliviensis V171 trbv AGCE01062008.1 592 HAGAGVSQDPRHKVTKTGQNVTFRCDPISGHNSLYWYRQTLGQSPEFLTYFQNEVQLDKSGLPSDRFFAERTKGSFSTLKIQRTEQGDSAMYLCASSL
Saimiri boliviensis boliviensis V172 trbv AGCE01062008.1 6799 SVAAGVIQYPRHLIKEKRKTAILKCYPIPGHDTVYWYQQGPGQGLQFLISYYEKTQRDKGSIPDRFTAQQFSDYHSELNMSSLELGDSALYLCASSL
Saimiri boliviensis boliviensis V173 trbv AGCE01062009.1 1449 HMDGRITQSPRHKVTETGTPVALRCHQTENHRYMYWYRQDLGHGLRLIYYSYGVKDISKGEVPDGYNVSRSNTEDFPLTLESTTGSQTSVYFCASSD
Saimiri boliviensis boliviensis V174 trbv AGCE01062009.1 16505 HTDAGVIQSPQHKMTEMGQEVTLRCEPISGHTQLFWYRQTVMRGLELLTYFNNENLIDDSGMPKDRFSAQMPNASFSTLKIQPSEPGDSAVYFCASSL
Saimiri boliviensis boliviensis V175 trbv AGCE01062009.1 38767 HTAAGVTQFPSHRVIEKGQAVTLRCDPISGHEYLYWYRRVMGKEIKFLIYFLRDSKQDESGMPNHRFSAERTGGTNSTLKVQSAELEDSGIYFCASSL
Saimiri boliviensis boliviensis V176 trbv AGCE01062009.1 43863 HGDAMVIQNPRYQVTQSGKPVTLSCSQNLKHNAMYWYQQKPSQAPKLLLYYYDKDLNTEADTPDNFQSRRPNTSFCFLDIRSSGLGDAATYLCASSR
Saimiri boliviensis boliviensis V177 trbv AGCE01062009.1 48815 SPGEEVTQTPRHLVKAKGQKAILYCIPIIGHDYVFWYQQVRKEFKFLISFQNENIFDETGMPKKRFSAKCTQNSPCSLEIQATEMQDSAVYLCASSQ
Saimiri boliviensis boliviensis V178 trbv AGCE01062011.1 9644 LSNAGVTQNPRHLVRRKGQEARLRCSPVKGHNHVYWYQQLLGEGLKFMIYLQRESTIDESGMPKEQFSAEFPKEGPSVLRIQQAERGDSAAYFCASSV
Saimiri boliviensis boliviensis V179 trbv AGCE01062012.1 2299 IVVGGITQSPKYLFRKEGQAVTLGCEQNLNHDAMYWYRQDPGQGLRLIYYSWIVDDFEKGDITEGYIVSREKKESFPLTVTSAQWNHTAFYLCASSI
Saimiri boliviensis boliviensis V180 trbv AGCE01062012.1 4861 GSGLGAVVSQHPSRVICKSGTSVKIECRALDFQATTMFWYRQSQKEGLMLMATSNEGSKATYEQGFSEDHFPISHPDLTSSSLTVASAQPEDSSFYLCSGR
Saimiri boliviensis boliviensis V181 trbv AGCE01062012.1 11527 SLDTKVTQRPRHVVTAKEQKAKMDCVPIKGHGYVYWYHKKLEEELKFLFYLQNGEIIQKAEEINERFSAQCPENSPCALEIQSTESGDAGLYFCASSK
Saimiri boliviensis boliviensis V182 trbv AGCE01062013.1 9617 SFHAKVTQTPGYLIKRKGQKTEMDCTPEKGHTFVYWYQQNQNKELMFLISFQNEQILEEMEMYKKQFSSQCPRNSPCRLTILSSDPGDRALYLCASSQ
Saimiri boliviensis boliviensis V184 trbv AGCE01062014.1 31846 FKNAIVTQFPRHGIIGTGKEFILQCSQNMNHVAMFWYRQDPGFGLKLIYYSSGPGSTEKGDVSEAYHVFRNNMTYFPLTLKSASTNQTSVYLCASSS
Saimiri boliviensis boliviensis V185 trbv AGCE01062014.1 50746 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSNNVDLVDKGDVPEGYNVSRKEKRNFPLILERPRPNQTSLYLCASSL
Saimiri boliviensis boliviensis V186 trbv AGCE01062014.1 56059 LVEVKVTQNPRYLVKRVGEKVFLECAQDMDHGRMFWYRQDPGLGLRLIYFSYDIKTDEEGDVPDGYSVSREKKEQFSLILGSARTNQTSVYLCASSS
Saimiri boliviensis boliviensis V187 trbv AGCE01062014.1 68616 SVFGAVVSQKPSRGVCQRGTSMTIQCHVDSQVTLMFWYRQLPGQSMTLIATANQGSDATYEKGFAKDKFPISRPNLVFSTLNVSNVSPEDSGVYFCSAG
Saimiri boliviensis boliviensis V392 igkv AGCE01134597.1 30725 STGDIVMTQTPLSLPVTLGEPASISCRSSQSLLHSNGYTYLNWYLQKPGQSPQLLIYRVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQA
Saimiri boliviensis boliviensis V393 igkv AGCE01134598.1 8617 ARCDIQMTQSPSFLSASAGDRVTITCQVSQGISNELPWYQQKPGKAPTLLIFAATRLQSGIPSQFSGPGSGTDFTLNISSLQPDDFATYYCQQDYSYP
Saimiri boliviensis boliviensis V394 igkv AGCE01134599.1 6645 ARCDIQMTQSPSSLSASVGDRVTITCRASRSISTELDWYQQKPGKAPVLLIYAASSLQTGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYSYP
Saimiri boliviensis boliviensis V395 igkv AGCE01134600.1 5152 SSGDIVMTQSPLFLPVTPGKPASISCRSSQSLLYSDGNTYLNWFLQKPGQPPRRLIYKVSTRDSGVPDRFSGSGSGTDFTLKISQVEAEDVGVYYCMQA
Saimiri boliviensis boliviensis V396 igkv AGCE01134600.1 15932 SREDIVMTQTPLSLSVTPGKPASIVCRSSQSLFDSEDGNTYLNWYLQKPGQSPQLLIYDASTHASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQA
Saimiri boliviensis boliviensis V397 igkv AGCE01134600.1 26943 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGYTYLDWYLQKPGQSPQLLIYTVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQA
Saimiri boliviensis boliviensis V398 igkv AGCE01134600.1 34926 TRCDIQMTQSPSSLSASVGDKVTITCQASQGINSWLAWYQQKPGKAPRLLIYAASSLQTGIPSRFSGSGSGTHYTLTISSLQPDDFATYYCQQTYSTP
Saimiri boliviensis boliviensis V399 igkv AGCE01134600.1 45694 ARCDIQMTQSPTFLSASVGDRVTITCQASQSIGSALAWYQQKPGKATRLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPDDFATYYCQQYSSFP
Saimiri boliviensis boliviensis V400 igkv AGCE01134602.1 4966 SSGDIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGNTYLHWFLQKPGQSPQRLIYRVSNLASGIPDRFSGSGSGTDFTLKISRVEAEDIGVYYCVQSIQTP
Saimiri boliviensis boliviensis V401 igkv AGCE01134603.1 27344 SSGDTVMTQTPLSLPVTLGEPASISCRSSQSLLHSNGNTYLHWYLQKPGQSPQLLIYKVSNRASGVSDRFSGSGSGTDFTLKISRVKAEDIGVYYCMQSTWFP
Saimiri boliviensis boliviensis V402 igkv AGCE01134603.1 35327 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLYSDGKNYLYWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIELP
Saimiri boliviensis boliviensis V403 igkv AGCE01134604.1 11430 TRCDTQMTQSPSSLSASVGDRVTITCRASQSISNWLAWYQQKPGQVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKCNSAP
Saimiri boliviensis boliviensis V404 igkv AGCE01134604.1 23702 SSGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSNGNTYLSWYLQKPGQSPQLLIYKVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQDTKTP
Saimiri boliviensis boliviensis V405 igkv AGCE01134604.1 38299 STGDIVMTQSPLFMPVTLGKPASISCRSSQSLLHSNGNTYLSWFLQKPGQSPRRLIYKVSTRDSGVPDRFSGSGAGTDFTLKISTVEAEDVGVYYCLQS
Saimiri boliviensis boliviensis V406 igkv AGCE01134608.1 5002 SRGDIVMTQSPAFFSGTPGEKVTITCRASEGISKYLHWYQQKPDQAPKLLIQYASQSISGVPSRFSGSGSGTDFTLTISSLEVEDAATYYCQQGNKW
Saimiri boliviensis boliviensis V407 igkv AGCE01134609.1 1165 SSGDIVMTQTPLTLPVTLGKPASISCRSSQSLLYSDGKNYLHWYLQKPGQSPQLLIYTASNRFSGVPDRFSGSGSGTDFTLKISTVEAEDVGVYYCMQAIKHP
Saimiri boliviensis boliviensis V408 igkv AGCE01134610.1 3124 TRCDIQMTQSPSSLSASVGDKVTITCQASQGISNNLAWYQQKTGKAPRLLINEASSLESGVPSRFSGSGSGTDFTLTISSLQPEDSATYYCQQHNSYP
Saimiri boliviensis boliviensis V409 igkv AGCE01134612.1 804 ARCDIQMTQSPSSLSASVGDKVTITCQASQGINNYLAWYQQKPGKAPRLLIYYASSLDSGVPSRFSGSGSGADYTLTISSLQPEDFATYYCQQYNSYP
Saimiri boliviensis boliviensis V410 igkv AGCE01134613.1 4843 ARCDIQMTQSPSSLSASVGDKVTITCQASQGINNYLAWYQQKPGKAPRLLIYYASSLQSGVPSRFSGSGSGADYTLTISSLQPEDFATYYCQQYSSYP
Saimiri boliviensis boliviensis V411 igkv AGCE01134614.1 11224 ARCDIQMTQSPSSLSASVGDKVTITCQASQGISKWLAWHQQKPGKAPKLLIYEASKLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSNP
Saimiri boliviensis boliviensis V412 igkv AGCE01134616.1 2367 STGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASTRATGIPDRFSGSGSGTEFTLTISSLEPEDFAVYYCQQYNNRP
Saimiri boliviensis boliviensis V413 igkv AGCE01134616.1 22983 SSGDIVMTQTPLSLPVTRGELASISCRSSQSLLHSNGNTYLWWYLQKPGQSPQPLIYKVSNRFSGVPERFSGSGSETDFTLKISRVEAEDVGVYYCMQG
Saimiri boliviensis boliviensis V414 igkv AGCE01134616.1 27067 ARCDIQMTQSPSSLSASVGDTVTITCQASQGISKWLAWYQQKPGKAPKLLIYDASKLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNSNP
Saimiri boliviensis boliviensis V415 igkv AGCE01134617.1 5602 TSGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQGPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLEPEDFAVYYCKQYNNWP
Saimiri boliviensis boliviensis V416 igkv AGCE01134618.1 1447 SNGEIVLTQSPTSMAVSQGERVTISCMASSSVSTSYLHWYQQKPGSPPRLLVYSTSSLASGVPARFSGSGSGTSYTLTISSMEADDAASYYCQQGDSF
Saimiri boliviensis boliviensis V443 ighv AGCE01147749.1 15996 VHSQVQLVQSGAEVKKPGASMKVSCKASGYTFTDYYMNWVRQAPGKGLEWMGDIDPENGETSYAQKFQGRVTMTADTSTSTAYMELRSLRSEDTAVYYCAR
Saimiri boliviensis boliviensis V444 ighv AGCE01147750.1 13333 VQCEVQLVESGGGLVQSGWSLRLSCVASGSTFSDYYMHWVCQAPGKGLEWIGQINPNGRSTYFTDFVKGRFTISRDNAKNSLYLQMNNLKTEDTAVYYCAG
Saimiri boliviensis boliviensis V445 ighv AGCE01147755.1 7719 WGRLCKAWGGSLRLSSRVRPLDSPSVTIGCTKSARLWERGWSWVGRIHPNGDSTGYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCAR
Saimiri boliviensis boliviensis V447 ighv AGCE01147864.1 2105 VCAEVQLVQSGAEVKRPGESLKISCKASGYSFNSYWISWVRQMPGKGLEWMGIIYPGNSDTRYSPSFQGHVTISADKSTSTAYLQWSSLKASDAAMYYCA
Saimiri boliviensis boliviensis V448 ighv AGCE01147864.1 20913 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSAINTDGSSTYYADAVKGRFTISRDNAKNSLYLQMNSLRAADTAVYYCAR
Saimiri boliviensis boliviensis V449 ighv AGCE01147865.1 13025 VLSQVTLKESGPAQVKPTQTLTLTCTFSGFSLSTYGMGVSWIRQPPGKALEWLATIYWDDDKYYSPSLKSRLTISKDTSKNHVVLTMTNMDPVDAATYYCARE
Saimiri boliviensis boliviensis V450 ighv AGCE01147865.1 20281 VQCEVQLVESGGGLVQPGGSLRLSCAASVFTFSDYHMSWVRQAPGKGLEWVGLIRNKANGGTAEYAESVKDRFTISRDDSENSLYLQMSSLKPEDTAVYYCTR
Saimiri boliviensis boliviensis V451 ighv AGCE01147866.1 3710 AHSQGQLVQSGAEVKKPGASVKVSCKASGYSFTSYVISWVRQNPRQGLEWMGGIYPGNGGTNYAQKFQGRVTMTTDKSTSTAYMELSSLRSEDMAMYYCAG
Saimiri boliviensis boliviensis V452 ighv AGCE01147870.1 13128 VQCDVQLAESGGGLVQPGGSLRLSCAASRFTFSSYDMDWVCQAPGKGLQWVSAVSAGGSNTYYADSVKGRFTISRDNGKKFLYLQMNSLRAEDTAVYYCAKK
Saimiri boliviensis boliviensis V453 ighv AGCE01147874.1 2402 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKALEWVSAIGTGGSTYYADAVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCAR
Saimiri boliviensis boliviensis V454 ighv AGCE01147875.1 4613 VQCEVQLVESGGGLVQPRGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISTDGSGTSYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYHCER
Saimiri boliviensis boliviensis V455 ighv AGCE01147944.1 864 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSSYYMDWVRQAPGKALEWVSAISTDGSGTSYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCAT
Saimiri boliviensis boliviensis V456 ighv AGCE01147945.1 15996 VHSQVQLVQSGAEVKKPGAPVKVSCKTSGYTFTDYYMHWVRQAPEQGLEWMGRIYPGSGNTNYAQKFQGRVTMTRDTSTSTAYMELSSLRSEDTAVYYCAR
Saimiri boliviensis boliviensis V457 ighv AGCE01147948.1 14515 VLSQVQLQESGPALVKPSQTLSLTCAISGDSVSSNSATWNWIRQSPGRGLEWLGRTYYSSKWYYNYAASLQSRITINPDTSKNQFSLQLNSVTLEDTAVYYCAR
Saimiri boliviensis boliviensis V459 ighv AGCE01148055.1 1637 VHSQVQMVQSGPELKQPGPSVRVSCKASGYTFNSYAINWVGQVPGQGLEGMGWINTYTGKPTYAQGFTGRFVFSMDTSISTAYLQISSLKAEDTAVYYCV
Saimiri boliviensis boliviensis V460 ighv AGCE01148057.1 4265 VQCEVQLVESGGGLAKPGGSLRLSCAASGFVFSSYHMHWVRQAPGKGLEWVSFISSDGGSTYYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCAR
Saimiri boliviensis boliviensis V461 ighv AGCE01148067.1 2198 VQSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMNWVRQAPGQGLEWMGWINPYNGNTGYAQKFQGRVTMTVDKSTSTAYMELSSLRSEDTAVYYCAK
Saimiri boliviensis boliviensis V462 ighv AGCE01148231.1 5901 VCAEVQLMQSGAEVKRPGESLKISCKASGYSFNSYWIGWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGHITISADKSTSTAYLQWSSLKASDAAMYYCAR
Saimiri boliviensis boliviensis V548 trdv AGCE01026517.1 55009 VSLDIILESDTKALTVLAGEAASFRCSVTGGDLKNYQVSWYKKSEDNALISVFKLSNSSNYNLGNNFMGKTDALKNLFMLDIQKATTKDVGTYYCAAD
Saimiri boliviensis boliviensis V549 trdv AGCE01026517.1 33794 AMSAIELVPEHQTVTVSLGDPATLRCSMKGEAITNYYINWYRKTQGNTMTFIYREKDIYGPGFKDRFQGEIDPEKDQAVLEILAASERDEGSYYCASD
Saimiri boliviensis boliviensis V550 trav AGCE01026519.1 57880 LRGELKVGQSPLFLSTQEGKNCTIYCNYSTTTSGRLHWYRQDPGKSLGSLFVLLSNGAVIQEGQLTASLDTKARLSTLHITAPVHGLSATYFCAV
Saimiri boliviensis boliviensis V551 trav AGCE01026519.1 46908 GTNSNSVKQTDQVIISEGASVTMNCTYTAMGYPTLFWYVQYPNKPLQFLQEETMENSKNFGARNIKDKNSPIAKHSVQVSDSAMYYCLLRDTVLR
Saimiri boliviensis boliviensis V552 trav AGCE01026519.1 41131 VSAANNEVQQSPQDLTVQEGEFITINCSYSVGLTSLQWLQQHPGGGIVSLFTLSSEKKKNGRLTATINLQEKHSSLHITASQPRDSAIYICAV
Saimiri boliviensis boliviensis V553 trdv AGCE01026520.1 84724 SSMSQKVIQYQPAISVQEGETVKLDCLYETNIVYYILYWYKRPPSGEMISLIHQLTDAETNVTKGQYSVSLHEATKTIQLIISPSQPEDSATYFCCLR
Saimiri boliviensis boliviensis V554 trav AGCE01026520.1 66811 IMSDAKTTQPNSVESNEEEPVHLPCNHSTMSGADYIYWYRQLPSKGPEYVIHGLTSNVNNRMASLTIAEDKKSNTLILHRATLRDAAVYYCILR
Saimiri boliviensis boliviensis V555 trav AGCE01026520.1 61901 ISSQELEQSPQSWIIQEGENLTINCRSSKTLYALYWYKKKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHTGIYLCGAD
Saimiri boliviensis boliviensis V556 trav AGCE01026520.1 50233 VSGQQLNQSPQSMSIQEGEDVSMNCTSSSTFDTLLWYKQETGEGPVLLITLYKGGELTRNGRLTAQFGITRKDSFLNISASVPGDVGTYFCAG
Saimiri boliviensis boliviensis V557 trav AGCE01026520.1 45473 VSSEDKVVQSPPSLVVHEEDSVTLNCSYEAADFRSLLWYKQEKKAPTFLFILTSSGIEKKSGSLSSILDKTEHFSILNITATQTRDSATYLCAAEAQCSL
Saimiri boliviensis boliviensis V558 trav AGCE01026520.1 18298 SSMAQTVTQSQPEMSVQEAETVTLNCTYDTSNSNYYLFWYKQPPSRQMILIIRQEGFKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAYR
Saimiri boliviensis boliviensis V559 trav AGCE01026520.1 9158 FSIAQRVTQSESEMSVQEAETVTLNCTYDSSDSDYYLFWYKQPPSRHMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAYR
Saimiri boliviensis boliviensis V560 trav AGCE01026521.1 26053 VSAQQLEQSPRFLSIQEGENFTVYCNSSSTFTNLKWYRQDPGEGPVLLVMLVKGGEVKKQKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAG
Saimiri boliviensis boliviensis V561 trav AGCE01026522.1 80227 LSGEDQVTQSPEALRLQEGDSSSLNCSYTVGNFGGLLWYRQDPGKGPEFLFILYSAGEEKQKERLKATLTKKESFLRITAPKPEDSATYLCAVQ
Saimiri boliviensis boliviensis V562 trav AGCE01026522.1 68846 VSSKQEVTQIPAALSVPEGESLVFNCSFTDSAIYYLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSRYSTLHIAASQPGDSATYLCAV
Saimiri boliviensis boliviensis V563 trav AGCE01026522.1 59069 VRGIQVEQSPPDLILQEGANYTLWCNFSTSVNNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVSTERYSLLHISSSQTTDSAIYFCAVVPQCSP
Saimiri boliviensis boliviensis V564 trdv AGCE01026522.1 42045 FSVAQKVTQAQLPISMPVGKTVTLNCLYETRQKFYCILWYKQLPSRKIVFLIRQCSSDQNVKNDRYSVNFQKARKSIDFIISALQLEDSATYLCALWE
Saimiri boliviensis boliviensis V565 trav AGCE01026522.1 33422 VSSILNVEQSPQLLRVQEGDGTNFTCSFPSSNFYALHWYRWETAKSPKNLFVMSLNGDEKKKGRINVTLNTKEGYSYLYIKGSQSEDSATYLCAI
Saimiri boliviensis boliviensis V566 trav AGCE01026522.1 28074 VNGQQIMQIPHFQHVQEGEDFTIYCNSSRALSNIQWYKQRPGGHPVFLIKLVKSGEMMKQKRLTFRFGEARKNSSLLITATQTTDVGTYFCT
Saimiri boliviensis boliviensis V567 trav AGCE01026522.1 16824 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQSYSQEPQYVIHGLKNNETNEMASLIIAEDRKSSILILPHATLRDTAVYYCIVRV
Saimiri boliviensis boliviensis V568 trav AGCE01026522.1 10238 GTRAQSVTQLDGHITVSEGAPLKLRCNYSYSTTPYLFWYVQYPSQSLQLLLKDLTGATQVKGIKGFEAEFRKSETSFHLRKPSAHVSDTAVYFCAAS
Saimiri boliviensis boliviensis V569 trav AGCE01026527.1 28344 VNSQQGEEEPQTLSIQEGENAIINCSYKTSITSLQWYRQDSNRGLTQLILIRSNEREKHSGRLRFMLDTSMKSSSLFIAAAQAADTAAYFCATE
Saimiri boliviensis boliviensis V570 trav AGCE01026527.1 23109 RTYGDSVTQTEGPVTLPEGAALTLNCTYQSSYSVFLFWYVQYLDKEPQLLLKSSENQETDSRGFQASHVKSDSSFRLEKPSVQLSDSAVYYCALR
Saimiri boliviensis boliviensis V571 trdv AGCE01026527.1 19890 SSMAQKVTQAQTEISVVEKEDVTLDCVYETSDTTYYLYWYKQPSAREMIFLIRQNSFNEQNEISGRYSGNFQKSTSSFSLTIAASQVIDSAVYFCALSE
Saimiri boliviensis boliviensis V572 trav AGCE01026528.1 18701 GTGAKSVNQLDSQVSVSEGTSVELRCNSSFSFSLSLLWYVRYPNQGLQLLLKYASGPTLVKGFNGFEAEFKKNETSFHLRKPSAHVSDAAEYFCAVN
Saimiri boliviensis boliviensis V573 trav AGCE01026528.1 6016 ETRAQRVTQPEKTLSVFEGTPVKLKCNYSYSGSPDLFWYVHYPKQRLQLLLRHISRESVKGFTANLNKGETSFHLEKPFVQEEDSATYYCALS
Saimiri boliviensis boliviensis V574 trav AGCE01026529.1 4633 VWSQQKEVEQNPGSLSVPEGAIASLSCTYSNRAFQYFMWYRQYSRKGPELLTFIYSSDKKEDGRFTAQLNKSSQYISLFIRDSQPSDSATYLCAM
Saimiri boliviensis boliviensis V575 trav AGCE01026530.1 44054 GTRAQSVTQLDGQVTVSEGAPVLLKCNYSSSVSAVYLFWYVQYPNQGLHFLLKYVSGPTLVKGIKGFEAEIKKSESSFHLKKSSVHVSDAAEYFCAVS
Saimiri boliviensis boliviensis V576 trav AGCE01026530.1 40276 DARAQSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLRYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVS
Saimiri boliviensis boliviensis V577 trav AGCE01026530.1 27773 VNGENVEQHPSTLSVQVGDSSVINCTYSDSASNYFPWYKQELGKGPRLIIDIRSNVDKRKDGRMTVLLNKAAKHFSLHITDTQPGDSALYFCAAG
Saimiri boliviensis boliviensis V579 trav AGCE01026530.1 8116 VWSQQKVEQNSGPLNVPEGVIASLNCTYSDRGSQSFYWYRQYPGKSPELLMSVYSSGNEDGRFTAQLNRASQYVSLLIRDSQLSDSATYLCAV
Saimiri boliviensis boliviensis V580 trav AGCE01026530.1 3452 GTRAQSVTQLDGQVTVSEGAPVLLKCNYSSSVTVYPFWYVQYPNQGLHFLLKYVSGPTLVKGIKGFQAEIKKSENSFHLKKSSAHVSDAAEYFCAVS
Saimiri boliviensis boliviensis V581 trav AGCE01026531.1 551 VWSQQKEVEQDPGPFNVPEGTTVAFNCTYSNSASQYFFWYRQDPRKGPKLLMSVYSSGNEDGRFTAQLNRASQYVSLLIRDSQLSDSATYLCAV
Saimiri boliviensis boliviensis V582 trav AGCE01026534.1 46777 GLRAQSVAQPEDRVTVAEGNPLTVKCTYSVSGTPYLFWYVQYPNQGLQFLLKYITGDNLVKGSCGFEAEFNKSQTSFHLKKPSALVSDSASYFCAVR
Saimiri boliviensis boliviensis V583 trav AGCE01026534.1 35888 TWSLAKTTQPISMDSYEGQEVNISCSHDNMATNDYIFWYQQFPNQGPRFIIQGYKTNVANEVASLFIPADRKSSTLSLPRVALSNTAVYYCVVG
Saimiri boliviensis boliviensis V584 trav AGCE01026534.1 27926 MSSGEDVEQSRFLSVQEGDSVVMNCTYTDSSSSYLYWYKQEPGASLQLLAYILSNTDMKQDQRLTVQLDKKNKHLSLHVAEAQTGDSAIYFCAES
Saimiri boliviensis boliviensis V585 trav AGCE01026534.1 17606 DARAQSVSQPDYHVILSEGASLELRCNYSYGGTVTLFWYVQNPGQDLQLLLKYYSGDTLVKGIKGFEAELMKSSSSFNLKKPSVQWSDTAEYFCAVK
Saimiri boliviensis boliviensis V586 trav AGCE01026534.1 6840 GISGDSVVQTEGEVLLSEGDSLTVNCSYESTGYPSLFWYVQYPGKGPELLLKATKGNDKGSNKDFEAIYRTETTSFHLEKGSVRESDSAVYFCALS
Saimiri boliviensis boliviensis V587 trav AGCE01026535.1 4919 AESKDQVSQPSTVASSEGAVAEIFCNHSVSNAYDFFWYLHFPGRAPRLLVKGSRPSQQGRYNMTYERFSSSLLILQVQEADAAVYYCAVEGTEAGN
Saimiri boliviensis boliviensis V680 trbv AGCE01062016.1 1218 AKSQTIHQWPATLVQPVGSPLSLECTVKGTSNPYLYWYRQSADRGLQLLFYSVSTGQVDSEVTQNLSASRPQDGQFILSSKKLLPSDSGFYLCAWS
Saimiri boliviensis boliviensis V694 trgv AGCE01067087.1 69210 HLEQPQISSTKTLSKTARLECVVFGVTISATSIYWYRERPGEAIQLLVYISSDGSVRMESGITSGKFEVDRIPETSTSTLTIHNVEKKDIATYYCAFWE
Saimiri boliviensis boliviensis V695 trgv AGCE01067087.1 44278 TSGDNLITQLVTSITKKKGNTAFLECRIKPNTFKKNVCVHWYHQKPDRSLKRILYISSNENIVHEQGFSEERYEAKKWQSDLSSSLRIHRVTEEDAGMYYCACW
Saimiri boliviensis boliviensis V844 iglv AGCE01112644.1 25691 SVASYELTQPRSVSVSPGQTASITCSGDKLGDKYAYWYQQKPGQAPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAVDEADYYCQV
Saimiri boliviensis boliviensis V845 iglv AGCE01112645.1 1186 LCALPVLTQPPSASASLGASVKLTCTLSSEHSNYFIYWYQQRPGRSPQYIMKVNSDGSHSKGDGIPDRFSGSSSGADRYLTISNLRSEDEAEYYCGE
Saimiri boliviensis boliviensis V846 iglv AGCE01112648.1 15875 FVTSYELTQPHSVSVAPGQTARITCGGNNIGGKYTYWYQQKSGQSPVLVIYRDNNRPSGIPERFSGSNSGNTATLTISGVQAGDEADYYCQVWDSSSNH
Saimiri boliviensis boliviensis V847 iglv AGCE01112648.1 7648 SVVSSAMTQEPAVSVALGQTARITCQGGGIGTYSANWYQQKPGQAPVLVIYDNNNRPSGIPDRFSGSSSGNTASLTITGAQVEDEADYYCGSWDSSGTH
Saimiri boliviensis boliviensis V848 iglv AGCE01112652.1 2360 SATSYELTQPHSVSVAPGQTARITCGGNNIGRKNVHWYQQKSGQAPVLVIYNDNNRPSGIPERFSGSNSGNTATLTISGVQAGDEADYYCQVWDSSTDH
Saimiri boliviensis boliviensis V849 iglv AGCE01112674.1 2796 SWAQSVLTQPPSASGAPGQRVTISCSGSSSNIGNNYANWYQQLPGKAPKLLIYGNSNRPSGSPDRFSGSKSDTSATLAITGLQSADEADYYCETWDSSLNA
Saimiri boliviensis boliviensis V850 iglv AGCE01112675.1 5942 SLSQPVLTQPPSTSASLGASVTLTCTLSSGYSNYAVDWYQQRPDKGPRFVMRVGTSGIVGSKGDGIPDRFSVSGSGLNRYLTIKNIQEEDESDYYCGS
Saimiri boliviensis boliviensis V903 igkv AGCE01134619.1 46554 AYGDIVMTQSPDSLAVSLGERVTVNCKSSQSLLYFNNKNYLAWYQQKPGQDPKLLISWASSRPAEVPDQFSGSGSGTDFTLTINSLQAEDVGLYYCQQYYSFP
Saimiri boliviensis boliviensis V904 igkv AGCE01134619.1 29684 TYGDIVMTQSPGSLAVSLGERVTINCKSSQSLLSSSKNYLAWHQQKPGQAPKQIIVWASTRVSGVPDRYSGSGSGTDFTLTISSLQAEDVAVYYCQQFYSAP
Saimiri boliviensis boliviensis V905 igkv AGCE01134619.1 18087 VRGNTVLTQSPALLSASLRDTIFMSCSANQSISDYLTWYQQKPGQPPKILVYDADNLYSGVSSRFSGIQSGTNFILTISSVEADDAATYYCQQDYAIP
Saimiri boliviensis boliviensis V906 igkv AGCE01134619.1 3066 TRAETTLTQSPTLVSVTPGDKVTISCKASQDIDNDIYWYQQKPGEAPIFIIQEATTLVSGIPPRFSGSGYGTDFTLTINNIELEDAAYYFCQQDDNFP
Saimiri boliviensis boliviensis V907 iglv AGCE01135277.1 1422 CWAQSVLTQPPSVSGNPGQRVTISCSGSSSNIGSSYVNWYQQLPGTAPKLLIYDSNQRPSGVSDQFSGSTSGNSASLTITGLQSADEADYYCQSYDSNLKA
Saimiri boliviensis boliviensis V908 iglv AGCE01135283.1 5007 SWAQTVLTQPPLASGNPGERVTISCSGSSSNVGSNSVHWYQQLPGTAPLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLRLEDEADYYCSAWDDSLKA
Saimiri boliviensis boliviensis V909 iglv AGCE01135286.1 5649 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGTVTSSNYPCWIQQKPGQAPRTLIYNTNSKYSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCLLYYSGA
Saimiri boliviensis boliviensis V934 ighv AGCE01147916.1 2188 AHSQMQLVQSEAEVKKPGASVKVSCKASGYTFTYHYMHWVRQAPGQGLEWMGWIMPYNGNTNYAQKVEGRVTITRDTSMSTIYMELRSLRSEDTAVYYCAR
Saimiri boliviensis boliviensis V935 ighv AGCE01147919.1 5417 AHSQVQLVQSGAEVKKPGASVKISCKASGYTFTSYSMHWVQQAPGQGLEWIGYINTNTGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLKSEDTAVYYCAR
Saimiri boliviensis boliviensis V936 ighv AGCE01147920.1 18037 AHSQVQLVQSGPEVKKPGASVKVSCKASGYAFSTYAISWVRQAPGQGLEWMGVIVPMPIVGSTKYAQKFQGRVTITADRSTSTAYMELSSLRSDDTAVYYCAR
Saimiri boliviensis boliviensis V937 ighv AGCE01147923.1 8597 VHSQVQLVQSGPELKQPGASVRVSCKASGYTFNSYAINWVRQVPGQGLEGMGWINTNTGKPPYAQGFTGQFVFSMDTSVSTAYLQIGSLKPEDRAVYYCAR
Saimiri boliviensis boliviensis V938 ighv AGCE01147923.1 5349 VLSQVQLQESGPGLVKPSDTLSLTCAVSGYSISSGYWWSWIRQPPGKALEWIGSIYYSGSAYYNPSLKSRVTISTDMSKNQFSLRMSSVTAADTAVYYCA
Saimiri boliviensis boliviensis V939 iglv AGCE01147938.1 6009 SNSQAVVTQEPSLTVSPGGTVTLTCAASTGAVTGSNYPYWIQQKPGQAPRTLIYNTNSKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYYCLLYYSAPEA
Saimiri boliviensis boliviensis V940 iglv AGCE01147939.1 13155 VDSETVVTQEPSYLVSPGGTVTLTCGLSSGSVSTSHYPSWYQQTPGQAPQMLIYSTNTRPSGVPDRFSGSILGNKAALTIKGAQADDETDYYCMLYMGSGI
Saimiri boliviensis boliviensis V941 ighv AGCE01148076.1 1061 VLSKVQVQLQQWGPGLVKPSETLSLTCAVYGYFISSDYWWSWIRQPPGKGLEWIGRISYIGSTYYNPSLKSRVTLSTDTSKSQFSLRLSSVTTADTVVYYCA
Saimiri boliviensis boliviensis V942 ighv AGCE01148081.1 506 VQSQVQLVQSGAEVKKPGASVKVSCKTSGYTFTNYYMYWVRQAPGQGLEWMGWIYPGNGNTKYAQNFQGRVTMTADKSTSTAYMELSSLRSEDTTVYYCAR
Saimiri boliviensis boliviensis V943 ighv AGCE01148188.1 1013 VQCEVQLVESGGGLAKPGGSLRLSCAASGFTFSDYWMGWVRQAPWKGLEWVGEINHNGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Saimiri boliviensis boliviensis V944 ighv AGCE01148199.1 1862 VQCEVQLVESGGGLAQPGGSLRLSCAASGFTFSNYWMNWVCQAPGKGLEWVGRIKSKADGGTAEYTASVKGRFTISRDDSKNMLYLQMRSLKTEDTAVYYCA
Saimiri boliviensis boliviensis V945 iglv AGCE01148346.1 20516 SLSQPVLTQSPSASAALGASVKLTCTLSSGHSNYAIAWHQQQPGKAPRYVMKLTGDGSYNKGDGIPDRFSGSSSGADRYLTISNLRSEDEADYYCQTWDTG
Saimiri boliviensis boliviensis V946 iglv AGCE01148346.1 14472 SLSQLVLTQPSSHSEPSGASARLTCTLSSGFRVGDFWIRWYQQKPRNPPRYLLYYRADSDKGQGSGVPSRFSGSSDASANAGILHISGIQPEDEADYYCCT
Saimiri boliviensis boliviensis V947 ighv AGCE01148386.1 4556 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTLSEYGMHWVRQAPGKGLEWVSFISYNGGYIHYADSVKGRFTISRDNAKNSLYLQMSSLRAEDTAVYYCA