WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ornithorhynchus anatinus AAPN00000000.1 (AAPN01) 220 40 16 10 74 6 37 29
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ornithorhynchus anatinus V12 trgv AAPN01009915.1 661 GQKALTMDQSMISLTKQTGKTATFLCKFSDERITYIHWYWQQLGKAPQRLLYYNLATSKPTLESRLSSEKFSAFQIKDQSFILNVRKLEVSDAGTYYCASWD
Ornithorhynchus anatinus V24 igkv AAPN01029322.1 185 ARRDITLTQTPTFLSVALGEKVTINCKASQDVNKEVSWYQEKPGLPIKSLVHAASTLSPGAPARFSGSGSGSDYIFTISRVEADDIANYYCMHDYGWP
Ornithorhynchus anatinus V25 igkv AAPN01029322.1 9384 SKGATVVTQSPEFLTESPGGSVTINCKISTSTSYVAWYQQKPGQTPKLLIYKVSNRPSGVPDRFSGSGSGTDFTFTINRVEADDAADYYCQYHGSTP
Ornithorhynchus anatinus V26 igkv AAPN01029322.1 13186 SNGDIVLTQSPDFLTATPGDQVKINCKASSSVSNDMAWYRQKPGQAPKLLINYGNNRPSGVPDRFSSSGSGTNIIFTISRVETDDGGDYYCQQHNSYP
Ornithorhynchus anatinus V27 igkv AAPN01029322.1 23740 SCGAKVLTQSPDSQSVSPGDKFTINCKSSETLTHSNGNNYLNWYQQKPGHPPKLLIYIASTRASGVPARFSGSGAGTDFTLTISSVEADDAADYYCGQATWVP
Ornithorhynchus anatinus V29 igkv AAPN01029322.1 33400 STGAVVVTQSPEFVTESPEGSVTINCKMSSSTSYVSWYQQKPGQAPKLLIYSISSRPSGVPNRFSGSGSGTDFTFTISKVESDDAADYYCQYAYS
Ornithorhynchus anatinus V30 igkv AAPN01029325.1 6288 SRGQIVLTQTPESLAKAPGESATIKCKASSSVSSYLHWYQQKPGQAPKLIIKQVTTLMPGIPARFSGSGSGTDFTLSINSVEAGDAADYYCQQSNSW
Ornithorhynchus anatinus V31 igkv AAPN01029326.1 3151 SSGQTVLTQSPVFLATSPGQKVTLECQASKTITHSDGINYLHWYQQKPGQSPKLLIYKASTRHTGVPARFSGSGSGKDFTLTISGVEADDDADYYCLFWPG
Ornithorhynchus anatinus V32 igkv AAPN01029329.1 4801 TSGDIMMIQTPSSLTVSPGESVIIQCKSNQSISTSYLHWYQQKPGQGPKLLIYSRSTLASGVPNRFSGSGSGTDFTLTISGAEADDAANYYCQQSSSLP
Ornithorhynchus anatinus V52 trmv AAPN01054342.1 5243 SEGAVQLVESGGGVKYSGESLRLSCQASGFTFGDYWMGWYREAPGKSREFVSSISYWAGSEKRYADAVKGRFSISRDNANSRLYLQMDRLQVEDTARYICAR
Ornithorhynchus anatinus V53 trgv AAPN01056014.1 1327 THGAIVLTQPEPVMVRKKGKTVTLGCTIKGASSSEPYIHWYRQKPGKTLERVVYFSTKANAAYEAGIDSNRFDVEQLGGGIFNLKIHKLVEEDAATYYCASWE
Ornithorhynchus anatinus V54 trgv AAPN01056014.1 4585 ANGEVVLKQPNPVIVKAKDKTAYLNCKGERASSFKDQYIHWYRQRRGNTLERIVYFSTQATAVYKQGIDSDRFKVDKSLVESSSNLIIYKLVEEDVATYYCAF
Ornithorhynchus anatinus V55 trgv AAPN01056014.1 6308 ANGQRAQNRLDTEISRKMGKTVSIDCKADLTNFRSNYIHWYYQRAGQAPERIPYVSKDDKVSFDQEKSKTKFETQKRDSSYYLRIHKLVEEDAGMYYCAYWD
Ornithorhynchus anatinus V56 trgv AAPN01056014.1 8876 ANGQTEVKQPKPLIILNEYNVTSIDCEVKMNEFWYENIYWYRQRVGQAPEWILYVSSDTGVSYKSKEDKSKFQLQKSATGSFYYLRIINPDKKDAGMYYCASWY
Ornithorhynchus anatinus V57 trgv AAPN01056014.1 10919 TNGQRGQNHFGRVVSNKKGNSVFVNCQMDLTKDITYIHWYRQRADQAPERILYITKDNQVTFDQKKFETKFVAQRKVSSCHLRIPKLDEEDAGMYYCAYWD
Ornithorhynchus anatinus V58 trgv AAPN01056014.1 12742 ANGQIGQNQLGAVISKKEGRSVTVDCKANFKSDYIHWYLQGADQVPKRILYIYKDKVFTDQEKEKTKYEAPPKDSSYHHLRIHRLVEKDSGMYYCAYWN
Ornithorhynchus anatinus V59 trgv AAPN01056014.1 17928 GSRAVKMEQKEQYVTKPLTKTVRINCEVSEVDFSSANIHWYQQKPGEALKRLLYVSSTGATQYDPNTDKKRFGADKRTASSTSILTITNIVSEDTATYYCACWD
Ornithorhynchus anatinus V60 trmv AAPN01056308.1 4125 IESLVESGGAVKLAGESLFLSCTASGFNFGDYEMGWYRKASGRGPEWVSHIDPTGRNLQYAEAVRGRFTISRDNTKDQLYLVLDNLQAGDSGRYYCVR
Ornithorhynchus anatinus V100 trav AAPN01120469.1 135 ARGEGKVEQTPPFLSIQEGENRTINCSFTSSGFGSLQWYRQDPGKGPDFLMSLYLDGEENTKGKFTAKLEKGAKRSFLRIPDAQPGDSATYLCAVETQ
Ornithorhynchus anatinus V129 iglv AAPN01173604.1 172 SIHSSVLTQPPSVSVALGQTATITCSGGNTGTFGASWYQQKPGRAPMLVIYSNLGNHDRPSGIPDRFSGSKSGSTATLTISRAQAEDEADYYCQSLTSSG
Ornithorhynchus anatinus V142 ighv AAPN01193183.1 676 VLSQVQLVESGPGVVKPSEPLRLSCAVSGFLITTSAYCWHWNWQTPGKELEWVGAICYEGSVYYASSFKSRATISRDMAKNEFSLQLNSVTDADTALYYCARE
Ornithorhynchus anatinus V143 ighv AAPN01193183.1 3287 VQGDVQLTESGGDVKQPGGSLSLSCKASGFTFSSHSLSWVRQAPGKGLEWVAGITSSGNTYYIDSVKGRFTISRDNANRQVQLQINSLKTEDTALYYCAR
Ornithorhynchus anatinus V144 ighv AAPN01193184.1 10051 IQCEGQLVESGGDLRQPGASLRLTCTNFLFAPSKDYYMHWVRQAPGKGLEWVAAIRGDEGYPTYADSVKGRFTISKDNANRLMHLQMNSLKTDDTARYYCAK
Ornithorhynchus anatinus V145 ighv AAPN01193184.1 14222 VQGDVQLMESGGDMTQPGGSLRLSCKASGFSFNSNYYMSWFRQASGKRLEWVATISTSDGSTYYADSVKGRFTISKDNANSLVYLQMDNLKTEDMALYYCA
Ornithorhynchus anatinus V146 ighv AAPN01193185.1 5047 VQGDVQLVESGGDLRQPGGSLRLSCKASGFSFSSGYWMSWVRQAPGKGLEWVASIATSSGSTYYADSVKGRFTISKDNANSLVHLQMNSLKTEDTALYYCAR
Ornithorhynchus anatinus V147 ighv AAPN01193187.1 1507 VQGDVQLVESGGDLRQPGGSLRLSCKASGFSFSSNYWMSWVRQAPGKGLEWVASIATSSGSTYYADSVKGRFTISKDNANSLVHLQMNSLKTEDTALYYCAR
Ornithorhynchus anatinus V148 ighv AAPN01193187.1 3881 VQGDVQLVESGGDLRQPGRSLRLSCKASGFSFSSSYGISWVRQAPGKGLEWVAGICTSGGSTYYADPVKGRFTISKDNANSLVHLQMDSLKTDDTALYYCAR
Ornithorhynchus anatinus V149 ighv AAPN01193191.1 1829 VQGDVQLVESGGDVRQPGGSLSLSCKASGFTFSSYCMYWICQAPGKGLEWIAYISSSGSSTSYADSVKGRFTISRDNSNSLVNLQMNSLKTEDTALYYCAR
Ornithorhynchus anatinus V151 ighv AAPN01193191.1 9787 VQGDVQLVESGGDMKQPGESLRLSCKASGFTFTNYNMEWVRQAPGKGLEWVAHINSQGGTAYQNSVKGRFTISRDNANNLVQLQMNSLKTEDTALYYCTR
Ornithorhynchus anatinus V153 trbv AAPN01197957.1 3342 PTEAGVTQTPRHVLAWPGKALALTCKQDLGHSYMYWYRQDLGQGLRLIYYSAGVGEKDKGEAPGEFDVDRSKIQIFFLKKPALKTTDSSRYFCASSV
Ornithorhynchus anatinus V163 trgv AAPN01214194.1 529 GQTALTMDQPMVSITKQIGKIASLPCKFSSQSITYIHWYRQQPGKAPQRLLYCKVATSQPTLDSGFSSDKFYTYKTKDQSCTLSVRKLEVSDAGTYYCASWD
Ornithorhynchus anatinus V164 trgv AAPN01214196.1 1246 GQTALTIDQPVVSLTKNARASASFICKLSEKSNTYIHWYRQQPGKAPQRLLYCNTATSQPSLDAGFSSDHFSTYKSMDYTCTLKVRLLSISDAGTYYCAIWD
Ornithorhynchus anatinus V165 trgv AAPN01214197.1 739 GQTAVNIDQPIVSITRKAGTLAPFLCKFSGPRNTYIHWYHQQPGKAPHRLLYCNVGTSKAWLESGFHSDKLLTYKFVDHTCTLKIQNLKKSDAGTYYCASWD
Ornithorhynchus anatinus V166 trgv AAPN01214197.1 3366 GQTALTLHQPVVSITRQTRKIAKIPCEFSDSSIKYIHWYRQEPGKAPQRLLYYNLASSQSTHDAGFSSDKFYAYKSKDQSCTLEVQKLGTSDAGIYYCASWD
Ornithorhynchus anatinus V167 trgv AAPN01214197.1 6981 GQTALTMDQPMISVTGQAKAIASFLCDFSNQRITYIHWYRQQPGKGPQRLLYYNLETSQHKLEAGFSSDKFYVDKSKDQKCTLRVRKLEMNDAGTYYCASWD
Ornithorhynchus anatinus V168 trgv AAPN01214197.1 8658 GQTAITLVQPVVSITRQARKIAKIPCEFSQKSITYIHWYHQQPGKALQRLLYYHLATSKQTMNAGFSSNKFYAYKSKDQSCTLEVQNLGTSDAGIYYCASWD
Ornithorhynchus anatinus V169 trgv AAPN01214197.1 10442 GQSALTMDQPVVSITRQAGKTAKILCQLSQKSITYIHWYRQQPGKAPQRLLYYDMAASKQTLDAGFTSDKFYAYKSKDQSCTLTIEKLGTNDAGTYYCASWD
Ornithorhynchus anatinus V182 trgv AAPN01223053.1 421 CQTALTMDQPTVSHTKRAGSSASFLCKPSDQSTTYIHWYRQLPEKAPQRLLYCNLATLQTKLDAGASSVKFSTYKTMNQSCTLKVQKLSMSDTGTYYCASWN
Ornithorhynchus anatinus V183 trgv AAPN01223054.1 434 AQTALTMNQPMVSITKQAGKSARIHCEFAQKSITYIHWYRQQPGKAPQRLLYYNLGTSKQTLDSGFSSDKFSAYRKKDLNCFLEIETLGTSDAGTYYCAGWD
Ornithorhynchus anatinus V187 ighv AAPN01225556.1 3567 VQGDVQLVESGGDLKQPGGSLSLSCKASGLTSSYYYMNWVRQAPGKGLEWVARVHSNGGSTNYADSVKGRFTISWDKASSLLSLQMNSLKTEDTALYYCAT
Ornithorhynchus anatinus V188 ighv AAPN01225556.1 12301 VQGDVQLVESGGDLKQPGGSLRLSCKASGLTSSYYNMIWVRQAPGKGLEWVASIYNYDSSTYYADSVKGRFTISWDKANSLLSLQMNSLKTEDTALYYCAV
Ornithorhynchus anatinus V199 trmv AAPN01242758.1 217 IESLVESGGAVKPAGESLRLSCTASSFIFENSEMDWYRQAPGREPEWVSHIDPSGKNPRYAEAVRGRFSISRDNAKGHLYLQMGNLQVGDSGRYYCVR
Ornithorhynchus anatinus V200 iglv AAPN01243144.1 730 FVRSAPTQQPSASVALGQTATLTCSGVSSSYAAWYQQKPGRAPVLVIYQNDKRPSGIPDRFSGSKSGSTATLKIAGAQAEDEADYYCQDYGSSYG
Ornithorhynchus anatinus V202 trgv AAPN01247435.1 17 GQMAVTLDQPVISITKKVGVLAMIPCRFSDKRITYIHWYVQHLGRAPQRLLYYHLAKSEVRLDAGFRSDKFFASKNKDGSCNLLIQNLRESDAGTYYCASWD
Ornithorhynchus anatinus V203 trgv AAPN01247496.1 366 GQTALTMDQPVVSITKQAGTLASVLCKFSNNEANYVHWYLQQPGKGPQRLLYYNLAMAQPRLDAGFSSDKFYAYKSKDQSCSLSIRKLEVSDAGTYYCASWD
Ornithorhynchus anatinus V217 iglv AAPN01271015.1 912 SVSSSVLTQPPSVSVAPGQTATITCSGGNIGALGANWYQQKPGRAPVLVIYISISSHNRPSGIPDRFSGSNSGNTATLTIARAQAEDEAIYYCQEAISAD
Ornithorhynchus anatinus V218 iglv AAPN01271019.1 164 FVRSVPTQQPSASVALGQTATLTCSGVTGSYIHWYQQKSGRAPVLVIYDKSKRPSGIPDRFSGSKSGSTATLTIAGAQAEDEADYYCLDYASSNN
Ornithorhynchus anatinus V247 ighv AAPN01326721.1 1518 VLSEIQLVESGPGVVKPSESLRLSCQVSGESITTGKIWNWIRQDPGKGLEWMGYGYYSSSTWNAYYASSLQNRITIAAEPSKNEFSLQLNRVTPADTAVYYCAR
Ornithorhynchus anatinus V248 ighv AAPN01326722.1 9640 VQGQRHLVESWGDLRQPGGSLHLSCKGSGFTFSSYDMDWIRQTPEKGPEWVSGITPGSAVYYADSVKGRFTISRDNANSLLHLQMNNLKIEDTALYYCVR
Ornithorhynchus anatinus V249 ighv AAPN01326722.1 14065 VQGQIQLVESGGDLKQPGGSLRLSCKASGFTFNSYAMSWVRQAPGKGLEWVAAISSSGSTYYADSVKGRFTISKDNANSLLQLQMNSLKTEDTALYYCAR
Ornithorhynchus anatinus V250 trdv AAPN01327385.1 583 SSMSQSIYQDQTEASGLVGDILTLPCTYSTSYTYYYLFWYKQPPTGEMIYLIVQGSSVQENSRTGRYSVSFQKAKKSFSLTITVLQPEDSGVYFCALSE
Ornithorhynchus anatinus V256 trgv AAPN01339672.1 31 GQTALTLHQPVVSITRQTRKIAKIPCEFSDSSIKYIHWYRQEPGKAPQRLLYYNLASSQSTHDAGFSSDKFYAYKSKDQSCTLEVQKLGTSDAGIYYCASWD
Ornithorhynchus anatinus V259 trbv AAPN01346988.1 5657 PVDAEVTQTPRHLVTSQGQNVTLSCVPISSHSVLFWYRQRMRKGLELVMFIQNKQIIQGMQSNDSSRFSISWFQKNSCHLHVKHSSTSDSAVYLCASS
Ornithorhynchus anatinus V282 iglv AAPN01406920.1 1160 YVSSVPTQPPSASVALGQTASITCSGVSSSYGANWYQQKPGRAPVLVIYYDNKRPSGIPDRFSSSKSGSAATLTISRAQAEDEADYYCQDTYYS
Ornithorhynchus anatinus V299 trdv AAPN01426443.1 24129 RRSAGALVTQSSPDLTVMEGSKVTLQCHYDKSYSNPDLYWYRRRPDHSLQFILYRDNTRSTDADFVQGRFSVLHNKDQGAFHLEIAAVRVEDGSVYYCVVK
Ornithorhynchus anatinus V306 trbv AAPN01439125.1 2955 SGLGILISQWPSRAIWRRGTTVKIQCYQNNSDPNFLYWYRQLAGQSLVLMASANLGSSASYENGFEESKFPIQCPELRFSSLEVKELEPEDSGLYFCATSG
Ornithorhynchus anatinus V313 iglv AAPN01002222.1 309 FVSSVPTQPPSASVALGQTATITCSGLSTGYMAWYQQKSSRAPVLVIYSTSSGSKRPSGIPDRFSGSGSGSTSTLTISRAQAEDEAGYYCQDTYSY
Ornithorhynchus anatinus V328 trav AAPN01015979.1 523 AASTYVSQPPWLWGLRGKPLSLPCTLKDSQYPQMFWYRQRTGEAPVILFSSYGTDAMNYTEEPLTAKRKGDDLELSWQRLREADSAMYFCACSTV
Ornithorhynchus anatinus V331 trmv AAPN01017767.1 1362 IESLIESGGTVKPAGKSLRLSCTASSFIFGNSEMAWYQQAPGREPEWVSHIDPSGRNPWYAEAVRGRFSLSRDNAKGQLYLQMDNLQVGDSGRYYCVR
Ornithorhynchus anatinus V341 igkv AAPN01029329.1 12059 SSGQMAVTQSPDSLSGSPGETVTINCKTGQSINTRMYWYQQITGQVPKLIIKDATTLIPGVPAHFSGSGSGKDFTLTIRGMEVDDVADYYCAQDNDYL
Ornithorhynchus anatinus V342 igkv AAPN01029329.1 9157 SSGQITVTQTPNIRSANLGETVTIYCKTSSSVSGSGRVYLQWYQQKRGQGPKPIIKFASTLLPGVSARFSGSGSGTDFTLTIRDVETDDAADYYCQQSYGNPL
Ornithorhynchus anatinus V343 ighv AAPN01030190.1 3116 VQGDVQLVESGGDLRQPGGSLRLSCKASGLTYSSYFMHWVRQAPGKGLEWVARVYHDGNYIGYADSVKGRFTISWDKANSLLSLQMNSLKTEDTALYYCAT
Ornithorhynchus anatinus V344 ighv AAPN01030191.1 716 VQGDVQLVESGGDLRQPGGSLSLSCKASGLTSSYYYMHWVRQAPGKGLEWVAMVDEDGSSTNYADSVKGRFTISWNKASSLLSLQMNNLKTGDTALYYCAT
Ornithorhynchus anatinus V364 iglv AAPN01053568.1 793 FVRSAPTQQPSASVALGQTATLTCSGVSSSYATAWYQQKPGRAPVLVIYQNDKRPSGIPDRFSGSKSGSTATLKIAGAQAEDEADYYCQDYDSSYG
Ornithorhynchus anatinus V365 trgv AAPN01055122.1 1049 GQTALSIDQPMVSVTKRAGALASFLCELSDKSITYIHWYRQQPAKSPQRLLYCNVATSQATLDTGISSGKFYTYKGKDHSCSLRVWKPDESDVGTYYCASWD
Ornithorhynchus anatinus V369 trgv AAPN01057299.1 5448 GQTALTMDQPMVSITKQTGKMASLPCEFSSRSITYIHWYRQQPGKAPQLLLYFNLATSQQKLVSGFSSDKFYTYKTKDQSCTLSVRKLEVSDAGTYYCASWD
Ornithorhynchus anatinus V370 trgv AAPN01057299.1 2505 GQTALTMDQQIVSTTREAGTSASFPCKFSGQSITYIHWYRQQAGKAPQRMLYCNLATSQHTLDSGFRSDKFYTYKSNYLSCILKVWKLSMSDVGTYYCASWD
Ornithorhynchus anatinus V371 trgv AAPN01057304.1 1892 GETALSLNQPVVSISRQYGMSATILCEFSDSKSSYIHWYRQQPGKAPQRILYYNIRTSQTTMDSGFSSWKFQPDKIDDKSCTLLIKDLGWSDTGIYYCAIWD
Ornithorhynchus anatinus V372 trgv AAPN01057305.1 777 AQTALILDQPTFSITKNTGKSATIPCKFSEKKITYVHWYRQQPGEAPQRLLYYDLANSQTTVDSRFDSKNIYAYKYQDRSCMLVVEKLGVSDAGIYYCASW
Ornithorhynchus anatinus V408 trbv AAPN01112440.1 792 PADTRVADSRVTQTPRYRLVQKWENVTLSCEQKMDHEATYWYQQDPGLGLQLIHFSRNTDFIEPRDNPQGYLVSQKMKAHFPLTLWSAGMIQSSLYFCMSSV
Ornithorhynchus anatinus V412 ighv AAPN01116734.1 406 VRGDVQLVESGRDVRQPGGSLHLSCKASGFTFSSYSMHWVRQTPGKGLEWVALIYSDGSSTYYAESVKSRFTISRDNANSQLHLQMNSLKTEDTALYYCAKD
Ornithorhynchus anatinus V420 ighv AAPN01126676.1 2794 VQGDVQLVESGGDVRQPGGSLRLSCKASGFTFSSYYMYWVRQAPGKGLEWVASIGSDGSSTCYPDSVKGQFTVSRDNTNSLLNLQMNSLKTEDTALYYCAK
Ornithorhynchus anatinus V421 ighv AAPN01126677.1 1971 VQGDVQLVESGGDVRQPGGSLRLTCKASGFTFRSCAMSWVRQTPGKGLEWVAYIDTSSSPIYYLDAVKGRFTISRDDANSLLHLQMNSLKTEDTALYYCTI
Ornithorhynchus anatinus V422 ighv AAPN01126678.1 3083 VQGDVQLVESGGDVRQPGGSLRLSCKASGFTFSNAYMSWVRQAPGKGLEWVTAIYSSGNTYYADSVKGRFTISRDNANSLLHLQMNSLKTEDTALYYCTT
Ornithorhynchus anatinus V423 ighv AAPN01126681.1 852 VLSQIQLLESGPGVVKPSEPLRLSCVVTGDSIASTNANWNWIRQQPGKELEWMGHVYGPSGGISYVPSLKNRISITRDTSKNEFFLQLNSSTAVDTAMYYCAR
Ornithorhynchus anatinus V424 ighv AAPN01126686.1 7936 VQGAQLVESGGDLRQPGGSLRLSCKASGLTYSSYYMHWVRQAPGKGLEWVARVYHDGNYIGYADSVKGRFTISWDKANSLLSLQMNSLKTEDTALYYCAT
Ornithorhynchus anatinus V425 ighv AAPN01126687.1 7099 ILGEVQLVESGGDVTQPEGSLRLSCKASGFTFSDYCMYWFRQAPGKGLEWVAAIRNQAHSQTTEYASSVKDRFTISRDNANSLLHLQMNSLKTEDTALYYCVRE
Ornithorhynchus anatinus V426 ighv AAPN01126687.1 5022 VQGAQLVESGGDLRQPGGSLRLSCKASGLTYSSYYMHWVRQAPGKGLEWVARVYHDGNYIGYADSVKGRFTISWDKANSLLSLQMNSLKTEDTALYYCAA
Ornithorhynchus anatinus V427 ighv AAPN01126688.1 3075 VQGDVQLVESGGDLKQPGGSLSLSCKASGLTSSYYYMNWVRQAPGKGLEWVTQVKSNGNYINYADSVKDRFTISWDKASSLLSLQMNSLKTEDTALYYCAT
Ornithorhynchus anatinus V428 ighv AAPN01126691.1 1667 VLGEVQVVEYGGDVIQSEESLRLSCKASGFTFSDYCMYWCCQAPGKELEWVAAIRNQAHSQTTEYTSSVKDRFTISRDNANSLLPLQMNSLKTEDTALYYCVRE
Ornithorhynchus anatinus V429 ighv AAPN01126693.1 789 VQGAQLVESGGDLRQPGGSLRLSCKASGLTYSSYYMHWVRQAPGKGLEWVTQVKSNGNYINYADSVKDRFTISWDKANSLLSLQMNSLKTEDTALYYCAA
Ornithorhynchus anatinus V430 ighv AAPN01126694.1 11095 VQGDVQLVESGGDLRQPGGSLSLSCKASGLTSSYYNMHWVRQAPGKGLEWVARVYSNGGSTNYADSVKGRFTISWDKASSLLSLQMNSLKTEDTALYYCAT
Ornithorhynchus anatinus V431 ighv AAPN01126694.1 1172 ILGEVQLVESGGDVTQPEGSLRLSCKASGFTFSDYCMYWFRQAPGKGLEWVAAIRNQAHSQTTEYASSVKDRFTISRDNANSLLHLQMNSLKTEDTALYYCVRE
Ornithorhynchus anatinus V432 ighv AAPN01126696.1 21917 VRGDVQLVESGRDVRQPGGSLHLSCKASGFTFSSYSMHWVRQTPGKGLEWVALIYSDGSSTYYAESVKSRFTISRDNANSQLHLQMNSLKTEDTALYYCAKD
Ornithorhynchus anatinus V433 ighv AAPN01126696.1 17024 VQGDVQLVESGGDLKQPGGSLSLSCKASGLTSSYYYMHWVRQPPGKGLEWVAWLDTDDSRTNYADSVKGRFTISWDKANSLLSLQMNSLKTEDTALYYCAT
Ornithorhynchus anatinus V434 ighv AAPN01126696.1 10127 VQGDVQLVESGGDLRQPGGSLSLSCKASGLTSSYYYMHWVRQAPGKGLEWVAMVDEDGSSTNYADSVKGRFTISWNKASSLLSLQMNSLKTGDTALYYCAT
Ornithorhynchus anatinus V435 ighv AAPN01126696.1 7399 LQGEVQLVESGGDMKQPKGSLRLSCKASGFTFSDNCMYWFCQAPGKGLEWVAVIRNRSHSQTTEYASTVKDRFTISRDHANSLLHLQMNSLKNDDLSLYYCVR
Ornithorhynchus anatinus V436 ighv AAPN01126696.1 5327 VQGDVQLVESGGDLRQPGGSLRLSCKASGLTYSSYFMHWVRQAPGKGLEWVARVYHDGNYIGYADSVKGRFTISWDKANSLLSLQMNSLKTEDTALYYCAT
Ornithorhynchus anatinus V437 ighv AAPN01126697.1 1346 VLSQLQLLESGPGVVKPSETLRLSCAVSGGSVSSSYYWSWIRQQPGKGLEWMGYWSGSTYYNPAFQNRITITADTSKNQFSLQLNGVTLADTALYYCAR
Ornithorhynchus anatinus V441 trgv AAPN01131486.1 43702 AQTALTMEQPMVSITKQAGKSTKIACEFSQKGIAYIHWYRQQSGKAPQRLFHCSLATSKASLDAGFSSNKFSAYKSKDQRCTLMVQHLGTSDTGTYYCAAWD
Ornithorhynchus anatinus V442 trgv AAPN01131486.1 41383 VQTALTMDQQITSITKVVGTVASLSCEFSDQSITYIHWYRQQQGKAPQRLLYYNLAKSEVTLESGFNSNKIHAYKSKDRRCSLLIQKVDKNDAGTYYCASWD
Ornithorhynchus anatinus V443 iglv AAPN01131571.1 7025 SGCQPTLIQAPSVAAARGSTVQLVCTLSGVPGGLSVQWFQQRAGKAPQFVLHVPGHGGRGSRGYGIPDRFGGSSSGYHRYLTIRDVQPEDEADYYCGM
Ornithorhynchus anatinus V479 trgv AAPN01184782.1 2983 GQTAVTLDQPVISITKKVGVLAMIPCRFSDKRITYIHWYVPHLGRAPQRLLYYHLAKSEVRLDVGFRSDKFFVSKNKDGSCNLLIQNLRESDAGTYYCASWD
Ornithorhynchus anatinus V488 iglv AAPN01203841.1 2203 FVRSAPTQPPSASVALGQTATLTCSGLSTAYGASWYQQKPGQVPVLVIYKSNKRPSGIPDRFSGSGSGNTATLTIARAQAEDEADYHCQDGSDYG
Ornithorhynchus anatinus V489 iglv AAPN01203842.1 5438 FVRSAPTQPPSASVALGQTATLTCSGVSTSYWTSWYQQKPGQAPVLVIYDNDKRPSGIPDRFSGSKSGSTATLTISRAQAEDEADYYCQDASSYA
Ornithorhynchus anatinus V490 iglv AAPN01203842.1 505 FVRSAPTQPPSASVALGQTATLTCSGLSSSYATAWYQQKSGRAPVLVIYYSNKRPSGIPDRFSGSKSGSTATLTISRAQAEDEADYYCQDASSYA
Ornithorhynchus anatinus V492 trbv AAPN01205286.1 2361 PADAGITQTPRHLVTGRQQNVTLHCEQDQNHDAMYWYRQDPGQGPQTLFYFYYEKLQDNNTVPERFFPEQPKKSVRLTVRVLAPEDSAVYLCASSK
Ornithorhynchus anatinus V494 iglv AAPN01206495.1 1546 AVGSYVLTQPPSASVALGQTATLTCSADNIGSKSVQWYQQKPSQTPVLVIYSDSSRPSGIPDRFSGSNPSGSSKATLTISRAQADDEADYYCQVWDGSSNA
Ornithorhynchus anatinus V495 iglv AAPN01206496.1 2351 SGTQPVLTQTAFMDASLRDTVKLTCTLSSGYSNYYILWYQQLPGKAPRYVMKVNSDGTHTKGDEIPDRFSGSSSGGNRYLTISSVQSEDEATYYCG
Ornithorhynchus anatinus V506 trmv AAPN01232893.1 358 SMGEVQLVESGGGVKYSGESMRLSCQGSGFSFGSYNMNWYRDAPGKSREFVASISYGESNKNYADAVKGRFTIFRDNANSKLYLQMDKLREEDTARYICH
Ornithorhynchus anatinus V508 trgv AAPN01235823.1 3583 TNGQLELQQPKAPVIKKKGSTAFLDCKVQGTDFASAYIHWYRQRANQAPERILYLSTNGQVNFDQQQYKQKFEATKRNSDSTCTLRILKLDEKDVGTYYCASW
Ornithorhynchus anatinus V514 trmv AAPN01251390.1 1712 IESLVESGGAVKPAGESLHLSCTASSFIFGNSEMAWYRQAPGREPEWVSHIDPFQRNPRYSEAVRGRFSISRDNAKGQLYLQMDNLQVGDSGRYYCVR
Ornithorhynchus anatinus V521 trgv AAPN01262496.1 1189 RQMALTLDQRVISITRQAGKSATFICEFSDKKISYIRWYRRQQGQTLQRLLYYDLTMSQPRLDAGFSLDEISAYKTNGQTCTLVVLNLGESDAGTYFCASWD
Ornithorhynchus anatinus V522 trgv AAPN01262497.1 5516 QTALTMNQPLSSITKKSGRYARLPCELSDKSITYIHWYLQQPGKAPQRLLYYNLATSASTPESGFTSDKIYAYKTKDQTCMLVVEKLGIIDAGIYYCASWD
Ornithorhynchus anatinus V523 trgv AAPN01262497.1 3951 GQTALTLDQPLVSVTKKTGSAATFHCKFSDAKITYIHWYRQQPGKGPQRLLYYNLATSQATLDAGFSSEKITTYTTRDQGCSVVVRKLVMSDAGTYYCATWD
Ornithorhynchus anatinus V524 trgv AAPN01262497.1 1039 GQTALTLEQPTVTITRKTGSAATFICEFSDKSIKYIHWYRQQEGKAPRRLLYYNLVNSQPRLDTGFNSNKIHAYKINDQSCTLKVQKLDPSDAAIYYCAGWD
Ornithorhynchus anatinus V525 trgv AAPN01262498.1 731 GQTALTLNQPLSSITKKSGRYARLPCELSDKSITYIHWYLQQPGKAPQRLLYYNLATSASTPESGFTSDKIYAYKTKDQTCMLVVEKLGTSDAGIYYCASWD
Ornithorhynchus anatinus V535 ighv AAPN01278061.1 11973 VQGDVQLVESGGDLRQPGGSLHLSCKASGFSFSSNYYMSWVRQAPGKGLEWVAGICTSGGSTYYADSVKGRFTISKDNANSLVHLQMNSLKTEDTALYYCAR
Ornithorhynchus anatinus V536 ighv AAPN01278061.1 9596 VQGDVQLVESGGDLRQPGRSLRLSCKASGFSFSSSYGISWVRQAPGKGLEWVAGICTSGGSTYYADPVKGRFTISKDNANSLVHLQMDSLKTDDTALYYCAR
Ornithorhynchus anatinus V537 ighv AAPN01278061.1 4365 VQGDVQLVESGGDLRQPGGSLRLSCKASGFSFSSSNYGMSWVRQAPGKGLEWVAIIYTSSGNAYYADSVKGRFTISKDNANSLVNLQMNSLKTEDTALYYCAR
Ornithorhynchus anatinus V552 trav AAPN01297978.1 6886 QTDGDSVDHTKGSIALVEGKELLLNCTYVISTSLPYLFWYIQLPWEGPQLLLKHMSGKEQEVTGNDFYAKLNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V553 trav AAPN01297978.1 4470 QTDGDSVDQTKGSIALVEGKELLLNCTYVTSASLPYLFWYIQLPWEGPQLLLKTTFGNEQKVTGNGFYAKLNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V554 trav AAPN01297978.1 3147 QTDGDSVDQTEGSIALVEGKELLLNCTYVTSESLPNLFWYIQLPGEGPQPLLKHTSGKEQEVTGNDFYAKFNKTEKSFHLRKQAITVGDSAMYYCAVR
Ornithorhynchus anatinus V555 trav AAPN01297978.1 728 QTDGDSVDQTKGSITLDEGKKLLLNCTYVISTSMPSLFWYILLPGEGPQLLLKTISGNEQNVTGNDFYAKLNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V562 trdv AAPN01310494.1 1562 FSVAQSVTQTQTAASGKVGDEVTLLCTYSTSYSNYYLYWYKQPPSGELTYLIHQYSGNRNARKDRYSVNFQKEKKSISLTITDLELVDSAVYFCALRE
Ornithorhynchus anatinus V570 trmv AAPN01328395.1 9169 DESMVVSGGGVKPAGESLHLSCIGSALIFEVYGLGWYRQAPGRGPEWVAYIEPSGRNPQYSEAVRGRCSISRNNNQGQLSLQLDNLQAGDSGQYYCVR
Ornithorhynchus anatinus V575 iglv AAPN01335510.1 9349 FVRSAPTQQPSASVALGQTATLTCSGVSGSYAAWYQQKPGRAPVLVIYDNSNRPSGIPDRFSGSKSGSTATLTISRAQAEDEADYYCQDTYYY
Ornithorhynchus anatinus V578 trgv AAPN01339729.1 3816 GQTEVTTDKTMVSITKQTGTLASFFCEFSQKSNSYIHWYLQQPGKAPQHVLYCNTETSQSTLDAGFSSSKFSTFKSNDPSCTLKVRKVSISEAGIYYCASWD
Ornithorhynchus anatinus V586 trgv AAPN01362632.1 384 GQTALTTVQPMVSNTKQAESLASFLCEISEQTITYIHWYRQQPGKATQRLLYCNLATSQPTLDGVFNVDKFSSYKDKDHRCTLKVRKLSTSDAGTYYCAGWE
Ornithorhynchus anatinus V587 trgv AAPN01362633.1 398 GQAALSLDQPMVSITRQAGKSVKIPCELSQKSITYIHWYRQLPEKAPQRLLYYNLATKKQTLDSGFNSEKFYAYKYDEQSCTLVVQNLGTSDAGIYYCASWD
Ornithorhynchus anatinus V595 iglv AAPN01377445.1 576 FVRSAPTQPPSASVALGQTATLTCSGLSSSYATAWYQQKSGRAPVLVIYGNSNRPSGIPDRFSGSKSGSTATLTISRAQAEDEADYYCQDASSYA
Ornithorhynchus anatinus V598 trbv AAPN01380940.1 656 SGLGVLISQWPSRGIWKTGTTGKIQCYQNDSDHIYLYWYQQLAGQGLVLMALANEGSAASYEKEFNNTKFPIQRLKRKSSSLEVKDLGPGDSGLYFCATS
Ornithorhynchus anatinus V611 trdv AAPN01394617.1 634 SSVAQSIFQAQTAASGNEGDILTLFCTYQTSSSYYYLFWYKQPPSGEMIYLIHQNSATQRNSKINRFSVTFNKEEKTISLTITPLQRGDTGVYFCAIRE
Ornithorhynchus anatinus V630 trmv AAPN01414807.1 7651 SVGAVHLVESGGGVKYSGESLRLSCQASGFDFGSYAMNWYREAPGKSREFVASISAWYYINYADSVKGRFTISRDNAKSQLYLQMDNLKVEDTARYICH
Ornithorhynchus anatinus V631 ighv AAPN01414811.1 3099 VQGDVQLVESGGHLRQLGGSLRLSCKASGFPFSSSNYMNWVRQAPGKGLEWLAAIGTRGGSTYYADPVKGRFTISKDNANSLVHLQMDSLKTDDTALYYCAR
Ornithorhynchus anatinus V640 trdv AAPN01426445.1 61846 VAGEMVLDQLESTVTVPIGGNVTFQCRMTGEAMKNYHMNWYRKNPDASLIFIYRQGDIFGPGLRGLFEGKVDSAKNLFTLKLLRATVSDVGTYYCTAD
Ornithorhynchus anatinus V642 trdv AAPN01426445.1 53052 VPAAMELKQLKPTVSVPVGGYFTFECRMTGGSMSNYYMYWYKKNTDASLTFIYNQGGYYGSGFEGAFEGKVDAWNNHLSLKLLRAELGDTGIYYCAAR
Ornithorhynchus anatinus V643 trdv AAPN01426445.1 50627 VPAEIVLEQPKSTVTVSIGGDLPIQCRMSGGRIGSYWMYWYRKSPDSSLTFIYRSGDYYGPGFQGHFIGKVDSSNNRFTLRLLQATMSDEGIYYCAAR
Ornithorhynchus anatinus V644 trdv AAPN01426445.1 48870 VSAQIVLEEPEPTVTLPTGGKFTFQCHMNGGSMSSYYMSWYRKNPDASFTFIYREGNKYGPGLEGHFEGKVEASSNRFTLDLLQAAMSDSGIYYCTAD
Ornithorhynchus anatinus V645 trdv AAPN01426445.1 46282 AAEIVLEQPKSSVVVPVGEEFTFQCHMRGDRKTNYYMYWYRVNPDASLTFIYNNWDGYGPGFQGHFVAKVDSFNNRFSLTLPRAAESDEGTYYCAVR
Ornithorhynchus anatinus V646 trdv AAPN01426445.1 44244 LSVQIVLEQPEPSVSLPIGQKFTFQCIMKGGSISSYVMYWYKKNPDASLRFICNEYMCGSEFRGHFTAKVESSENRFTLELHQAAMSDEGIYYCAAR
Ornithorhynchus anatinus V647 trdv AAPN01426445.1 41443 VAAQIVLEQPEPTMSLSTGENFTFQCSMKRGSMSSYFMSWYKKNPDASLTFICDEDNDCGSEFQGHFTVQADSSNNYFALELPQAAMSDEGIYYCAA
Ornithorhynchus anatinus V648 trdv AAPN01426445.1 37535 VATQIVLEQPEPTVSLPTGGKFTFLCIMKGGRMSSYYMYWYKKNPDDSLRFMCNAYNKCGSEYQGHFTVKVESSKNHFTLELPQAAMNDEGIYYCAAR
Ornithorhynchus anatinus V649 ighv AAPN01426445.1 33399 VRTQIRLEESGGGVKKVGESLSLSCKTSGFSFDSYWMYWYRQPPGKEPQLVAYIDTVPTPYYADSVQGRATISRNNAQSSLHLQMQNLKLEDSAVYYCCI
Ornithorhynchus anatinus V650 trav AAPN01426447.1 11940 AVLGDSLTPEKDRVSAAEGKSVTLRCSYNTTASGKIYLYWYRQYTGQGPEYILEKGARGSNYTNNATFAMERFSSEVSDISTDLTINNLSLSDTATYHCALSY
Ornithorhynchus anatinus V651 trav AAPN01426447.1 9058 AVLGDSITPEKDRVSAAEGKSVTLLCSYNTTASGKIYLYWYRQYPGQGPEYILERGARGSNYVNNAAFAVERFSSIASDISTDLTINHLSLRDRATYHCALSY
Ornithorhynchus anatinus V652 trav AAPN01426447.1 6731 ASGQNKVEQTPVSLRTREGQNCAMKCKYTIRNFYGLYWYRQHPGKGPEPLFYLSSDGEKENGRFTANLETKDSSSSLIIRNSQLEDSATYFCAGE
Ornithorhynchus anatinus V653 trav AAPN01426447.1 5221 VLLEDWILPAVSQQSAVEGGSVTLLCSYSTTVTGSVYLYWYRQYPSRGLEYVLLRVARGSPYENKADFAEKRFSSTATDDSTSLSIGELSLSDTATYHCALSE
Ornithorhynchus anatinus V654 trav AAPN01426448.1 2157 SVLGDSITPEKDRMPVTEGESVTLRCSYNTTASSYVYLNWYRQYPGQGPEYILYRGARGSTAKHTAAFAKERFSSTATDGSTSLSIRELILSDTATYHCALND
Ornithorhynchus anatinus V655 trav AAPN01426449.1 712 AVLGDSLTPEKDRVSAAEGKSVTLRCSYNTTASGKIYLYWYRQYTGQGPEYILEKGARGSNYTNNATFAMERFSSEVSDISTDLTINNLSLSDTATYHCALSY
Ornithorhynchus anatinus V656 trav AAPN01426450.1 61896 VSGQDKVQQNPPSLIIQEGENGTMNCSFPNIAFDNLHWYRQDPGKGPILLIFMYSNEKKKTNERVTATLEKDNKRSFLHIPAAWPRDSATYLCAVE
Ornithorhynchus anatinus V657 trdv AAPN01426450.1 60688 SILAQSVFQVEKVASGKEGDTVTLNCTYSTSYSTYYLYWYKQSPTGEMTYLIYQDFYEDSARNGRFSLNFQKEQKSIDLTIAHLELGDSSVYFCALQE
Ornithorhynchus anatinus V658 trdv AAPN01426450.1 57721 SSMAQSVTQAQTAASGKVGDKVTLLCTYRTSYSYYSLYWYKQPPTGELTYLIHQYSENRNARKDRFSVNFQKEKKSISLTITDLELVDSAVYFCALRE
Ornithorhynchus anatinus V659 trav AAPN01426450.1 55587 TRAEDKVEQTPPSLSIQEGKNGTMNCSYTSSAFRSLQWYRQDPGKGPIFIILLFSDGKEKSNGRFTAKHEKGVEHSFLHISAAQPEDSATYLCAVE
Ornithorhynchus anatinus V660 trdv AAPN01426450.1 54550 SSMAQSISQAQTAASGKVGDTVTLPCTYSTSYRDYYLYWYKQPPTGEMTYLIHQYSENRNARKGRFSVNFQKEKKSIILIISRLELGDAAVYFCALRE
Ornithorhynchus anatinus V661 trav AAPN01426450.1 52340 ARGEDKMEQTPPSLSIQEGENSTMSCSYTSSVLNYLHWYRQDPGKEPTFLMLLYSDGKEETKERFTAKLEKSKKHSFLNITAAQPEDSATYLCAED
Ornithorhynchus anatinus V662 trav AAPN01426450.1 51265 SSMAQSIFQTQKAVSRKEGETVILLCTYSTSYSSYMLYWYKQPPSGAMIYLIYQYSETQNNAKNGRFSVNFQKLRNFISLTISDLEPGDSAVYFCALRE
Ornithorhynchus anatinus V663 trav AAPN01426450.1 49433 VSSQNKVEQTPPSLSLQEGEDGIMTCNFTSSAFNNLQWYRQDPGKGPTFLILLYSNGEGKSNGRFAAKIDKGAKSSYLNITAAQPEDSATYLCAME
Ornithorhynchus anatinus V664 trdv AAPN01426450.1 48401 PSMAQSIFQAETAVSKTEWDNVTLLCDYSTSYSKYMLYWYKRPHKGEMTYLIYQYSEGKNNAREGRFSVNFQKEKNSISLTITGLELEDSAVYFCALRE
Ornithorhynchus anatinus V665 trav AAPN01426450.1 45978 AKGEKKVEQTPTSLSIRAGETGTMNCSYPSIVFNSLQWYRQDLGKGPVLLLFLYLNDKEKTNGRVTATLEKGAQLSFLHIPTAQLGDSATYLCAME
Ornithorhynchus anatinus V666 trdv AAPN01426450.1 44961 SSMAQSISQPQTAPSRKEGESVTLPCTYSTGYSSYYLYWYKQLPTGEMTYLIHQYSENRNDARKDRFSVNFQKEKKSIRLTIARLELGDSAVYFCALSE
Ornithorhynchus anatinus V667 trdv AAPN01426450.1 41747 SSVAQSISQSQTAASRKEGESVTLPCTYSTSFSIYYLYWYKQLPTGEMTYLIHQYSENINSARKDRFFVNFQKLKKSISLTIKRLQLGDSAMYFCALRE
Ornithorhynchus anatinus V668 trav AAPN01426450.1 39502 ASGQDKVEQIPPSLSVRTGATSTMNCTYTTSVFNSLQWFRQNPGKGPVSLFLLYSDGEEKSKGRFTAKLEKGAQRSFLHMRDAQPGDSATYLCAVE
Ornithorhynchus anatinus V669 trav AAPN01426450.1 35150 GTYGDSVDQTEGHVTLNEGTELSIDCTYSYGGYPNLFWYVHFPGKAPQLLLKDTSEKEQKEASNGFHAEHEKAGKSFHLRKQAIALEDSAVYYCTMS
Ornithorhynchus anatinus V670 trav AAPN01426450.1 33396 VSGQMKLEQHPPFLRAQERESPTLYCNSSSTIYTLLWYRQDPQKGPEVLVTLTSPNEVKPQGRLTARFGEKRQNSSLFIKDSQPGDSAIYFCAG
Ornithorhynchus anatinus V672 trav AAPN01426450.1 20236 ASGQVMVEQTPPSISIREGETVTMYCSFKTSYFYGLQWYRQYAGKGLESLFFLNSNGLKKVGRLTAELKTSESISSLHIEDSQAGDSATYFCACG
Ornithorhynchus anatinus V673 trav AAPN01426450.1 18696 AVLGDWIHPVVSQKSAVEGESVTLQCSYSTTATGSVYLYWFRQYLSQGPKYILQRGARGTTYEHTTDFAKERFSSTATDDSTSLSIRVLSLSDTATYHCAL
Ornithorhynchus anatinus V674 trav AAPN01426450.1 16097 AVVGDRIRPAATQVSAEEGKTVTLRCSYSTEATGSIFLYWYRQYSSQAPEYILVRGAKGSAYQNNADFAKKRFSSTTTDYQTILTIGELSLSDTATYHCALRQ
Ornithorhynchus anatinus V675 trav AAPN01426450.1 14285 PMLGDWIRPTVPEKFVAEGNMVTLHCSYSTTASGSAFLYWYRQYPNHAPEYILVRGARGLTYRNEANFAKKRFSSTATYDSTGLTIKQLSLSDTATYHCALRQ
Ornithorhynchus anatinus V676 trav AAPN01426450.1 12314 VSGQDKVEQIPLSLKIREGENGTMICNYTIRNFYSLQWYRQYAGKGLEFLLLLSSSGNKKQVGRLAADLNIEERISSLLIRDSQAEDSATYLCAGE
Ornithorhynchus anatinus V677 trav AAPN01426450.1 11269 AVLGDSIRPEKAQVSAAEGKPVTLRCSYSTTISSNVYLWWYRQYPSKSPEYILARGARGSTFTNTAAFAKERFSSTATYDSTSLSIRKLSLSDTATYHCALSD
Ornithorhynchus anatinus V678 trav AAPN01426450.1 9643 AVLGDSVTPGEDQVFVAEGKSVTLRCSYSTTASSNVYLYWYRQYPSRGPEFILYRGARGSTLQYTADFAKERFSSIASYYSTTLSISKLNLSDKATYHCALQD
Ornithorhynchus anatinus V679 trav AAPN01426450.1 8959 AVLEDSIRPEKDQVSAAEGESVTLRCSYSPTDSSYVYLYWYRQYPSQGPEYILSRGASSSFYDNTAAFAEERFSSIATSDSTSLTISKLSLSDTATYHCALDY
Ornithorhynchus anatinus V680 trav AAPN01426450.1 5926 PCWGTGSNLQRASSLQKKGNQSLRCSYSTTATGSVSLYWYRQYPSRRPEFILLKEARGSTYEYNADFAKKRFSSKATYKSTSLTISELLLSDTAMYHCALRK
Ornithorhynchus anatinus V681 trav AAPN01426450.1 616 SVLGDSITPEKDRMPVTEGESVTLRCSYNTTASSYVYLNWYRQYPGQGPEYILYRGARGSTAKHTAAFAKERFSSTATDGSTSLSIRELILSDTATYHCALND
Ornithorhynchus anatinus V682 trav AAPN01426451.1 2495 ARGEGKVEQTPPFLSIQEGENRTINCSFTSSGFGSLQWYRQDPGKGPDFLMSLYLDGEENTKGKFTAKLEKGAKRSFLRIPDAQPGDSATYLCAVETQ
Ornithorhynchus anatinus V683 trdv AAPN01426452.1 1738 SSMAQSISQTKTAASGLVGQTLTLPCTYSTSGSYYYLFWYKQPPTGELISVITQYSGSPKNTIAGRFSVNFQKVKKSISLTIRDLQPGDSAVYFCAIEE
Ornithorhynchus anatinus V684 trdv AAPN01426453.1 12523 SSMAQSVSQTKAAVSGVVGQTVTLPCSYSTSDSSYYLYWYKKPPSGGLIYLIRQYSDSQNARTGRFSVSLWKAEKSINLRINALELGDSAVYFCAYSK
Ornithorhynchus anatinus V685 trav AAPN01426453.1 8888 ANRQKEVEQIPPSLSVQEGEDCMMNCSYTDKRTDYLTWYKKDLGKGPVPFISLVSNRDKKEGRFRASLNTTHLFSFLLITGSQLGDSATYFCAV
Ornithorhynchus anatinus V686 trdv AAPN01426453.1 6761 SSLAQTVSQAQKAVSGLMGQTVILSCSYSTSDSYYSLYWYKQPPTGEMIYLIEQYSGSPNARTGRYSVTFQKSVKSIKLTIAALELGDSAVYFCAYSR
Ornithorhynchus anatinus V687 trav AAPN01426453.1 3365 GTDGDSVNQTQGHVTLTQGAALTINCTYVISGYPTLFWYVQYPKEALRLLLSDVSQNKDKNGDSFHAENDRNKKSFHLNKPRVTLGDSAVYYCAGS
Ornithorhynchus anatinus V688 trav AAPN01426453.1 1753 ASGEDKVEQAPPSLNIQEGENSTMNCSYKISGFNSLQWYRQDHGKGPISLFVVRLNKEVKSEGRFTVLLNTDMKRSFLTITFSQPGDSAIYFCAGE
Ornithorhynchus anatinus V689 trav AAPN01426454.1 6654 TNESKKVEQNPPSLSVQEGKDCMMNCSYTDRNTDYVFWYRQDLGKSLVLVIKLFSGNPNQEGRFSGTLNTAALFSSLFIRQTQLRDSATYFCGT
Ornithorhynchus anatinus V690 trdv AAPN01426454.1 4695 STMAQSIFQAQTAVSGLVGQNLTLSCNYSTSDNYYNLYWYKKTPMGVMIYLIRQYSEYQNSRTGRFSVTFLKAKNSINLTITALELGDSSVYFCAYSD
Ornithorhynchus anatinus V691 trav AAPN01426454.1 2422 SSVAQSVFQAQTAASGIVGQTLTLTCTYSTSKSSYNLFWYRQPPTGEMIYLLGQYSEDQNARTGRFSVSFLKAENSINLTITALEPGDSAVYFCAYSR
Ornithorhynchus anatinus V692 trav AAPN01426455.1 41843 SSVAQSVSQNETVVTGQEGDTLTLPCTYETSFSSYDLFWYKQLPTGELIDVIYQYSASQKNASEGRFSVNFRKKIMSINLTITALQLGDSAVYFCALSE
Ornithorhynchus anatinus V693 trav AAPN01426455.1 39713 VSGQDKMEQTPPSLSIQVGQTGTMNCSHSMVGSGFLQWFSEKPRQGLVSLFSVNSKVMEKGRFTATFNFKNRHGFLYIRDAHPGDSATYFCAVDVL
Ornithorhynchus anatinus V694 trdv AAPN01426455.1 31765 SSLAQSVSQTEATVSGKEGDTLNLNCTYTMTDPTYYLFWYKQLPTGELIYLIRQDSWSERNKDGRLSVTLKKANNFIHLTIATLQLRDSGVYFCALSE
Ornithorhynchus anatinus V695 trav AAPN01426455.1 30911 TVLGDWIGPAVSQVSEVEGGTVNLSCSYNTTLSGSVTLFWYRQHPSQSPEYILYRGAKGFSGSNNAGFAIKRFSSETTTTSTTLSIRELVQEDTAVYYCALSE
Ornithorhynchus anatinus V696 trav AAPN01426455.1 28187 PVWAYQDTKLSSMEAFEGHDVNLTCDHGTLSSPYIFWYQQILNQALELVLSGYTTIQSARATLTIQDDKKSNILTLHSVRWTDSAVYYCALS
Ornithorhynchus anatinus V697 trav AAPN01426455.1 24935 SSRAQSVSQAEAEASRQEGDTLNLTCNYSTSESAYYLFWYKQLPTGELIYLIRQDSWSEGKKATRLSLTFKKTENLILLTIATLQLGDSAVYFCALSE
Ornithorhynchus anatinus V698 trav AAPN01426455.1 24052 AVLGDWIRPTESEVSKVEGGMVTLNCTYSTTLLRISLFWYRQHLSQGPEYILYRGAKGFSGRNNAGFAIKRFSSETTSTSTTLSIRDLVLEDTAVYYCALL
Ornithorhynchus anatinus V699 trav AAPN01426455.1 21835 PVWANQVIQLPSVEAFEGQNVNIICNHSDATTETIFWYQQFFNQGLKLVVSGYSNATNGKAMLTILKGRKSNILTLHNIQVTDLAVYYCALS
Ornithorhynchus anatinus V700 trav AAPN01426455.1 19738 VMLGDWIGPAESQVSEVEGGTVNLNCSFNTTTTGYIVVYWYRQHLSQAPEYILYRGAKGYSGSDTAGFASKRFSSETTSTSTTLIIRELILGDTAVYHCALRP
Ornithorhynchus anatinus V701 trav AAPN01426455.1 17825 VSGLDKVEQTPPSLSIREGENVTMNCNYTSSNFNSLQWYRQDPGKGPISLILLYSDGEQKFNERFTAQLNRGNKHSFLSITAAQLGDSTTYLCAME
Ornithorhynchus anatinus V702 trav AAPN01426455.1 14980 RTDGESVKQTPGHVTLMEGATLALDCTYETTGYPSLFWYVQYPREGPQLLLKDSTEQKQKQGNKGFNAEHQNSNKSFPLSKRGVTLGDSAMYYCVLN
Ornithorhynchus anatinus V703 trav AAPN01426455.1 11806 TCGQNEVKQTPPFLSIWEGEDATMNCTYSVVGFNSLQWFSQKPGQGLVSLFLIILETKKKGRFTATANSLHIRDSQLGDSATYFCAVGTQ
Ornithorhynchus anatinus V704 trdv AAPN01426455.1 9690 SSEALSVSQNETAVIGQEGQTLTLPCTYDNSASHFDVFWFRQLLTGEMKFLIHQYSWSMENSRHERFSVNFQDGEKSISLTIAALRLGDSAVYFCGLSE
Ornithorhynchus anatinus V705 trdv AAPN01426455.1 6765 SSVAQSIFQAQTAASGNEGDILTLFCTYQTSSSYYYLFWYKQPPSGEMIYLIHQNSATQRNSKINRFSVTFNKEEKTISLTITPLQRGDTGVYFCAIRE
Ornithorhynchus anatinus V706 trav AAPN01426455.1 5166 ASGEDKVEQTPPSLIIQDGENGTMNCSYTTSYFNGLQWYRQDAGKGPVVLFILMMNKDVKKEGRFRATLDTEKGISLLTVRASQLRDSATYFCAM
Ornithorhynchus anatinus V707 trav AAPN01426455.1 2831 RTDGDSVIQTQGQVTLEKGAPLILKCTYDTTFTTYPFWYVRFPKKNLRLLLKDTNEEEQKESSDGFHAKHDKDSKSFDLKKDAVTLEDSAVYYCAAG
Ornithorhynchus anatinus V708 trav AAPN01426456.1 391 GTDGDSVNQTEGHVTLVEEAKLTLTCTYESSSYTPYPFWYVQFSGEAPKLLLKDTSEKEQKESSNGFHAKHNKDVKSFDLKKHAVTLGDSAVYYCAVS
Ornithorhynchus anatinus V709 trdv AAPN01426458.1 1732 LSVAQSISQAKPTASGKEGDTLTLPCTYSTSYSNYYLFWYKQPPTGEIIYLIHQGSNIQENARTGRYSVTFRKAFKSFSLTISKLQPRDSGVYFCALRE
Ornithorhynchus anatinus V710 trdv AAPN01426460.1 2565 SSMAHSISQAQAAASGKVGATLTLSCSYSTSYHNYYLYWYKQPPTGEMTYLICQGSNMKENTRNGRYSVSFQKTLRSFSLTNTMLQVGDLGLYFCALSA
Ornithorhynchus anatinus V711 trdv AAPN01426460.1 356 SSMSQSIYQDQTEASGLVGDILTLPCTYSTSYTYYYLFWYKQPPTGEMIYLIVQGSSVQENSRTGRYSVSFQKAKKSFSLTITVLQPEDSGVYFCALSE
Ornithorhynchus anatinus V712 trav AAPN01426461.1 29596 QTDGDSVDQTEGSLALVEEKELLLNCTYVTSDSSPTLFWYIQLPGEGPQLLLKTTFGNEQKVTGNDFYAKLNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V713 trav AAPN01426461.1 27382 QTDGDSVDQTKGSIALVEGKELLLNCTYVISTSLPYLFWYIQLPWEGPQLLLKHTSGKEQEVTGNDFYAKLNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V714 trav AAPN01426461.1 24974 QTDGDSVDQTKGSIALVEGKELLLNCTYVTSASLPYLFWYIQLPWEGPQLLLKTTFGNEQKVTGNDFYAKLNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V715 trav AAPN01426461.1 22586 QTDGDSVDQTKGSITLDEGKKLLLNCTYVISTSMPSLFWYILLPGEGPQLLLKTISGNEQNVTGNDFYAKLNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V716 trav AAPN01426461.1 19881 QTDGDSVDQTEGSIALVEGKELLLNCTYVTSASLPNLFWYNQLPGEGPQPLLKHTSGKEQEVTGNDFYAKFNKTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V717 trav AAPN01426461.1 16641 RTDGDSVDQTKGGVTLVEGTMLNLTCNYKTSDPSSYLYWYVQFPGEGPQFLLRAMPGKEQGESENGFHAKLNKTVTSFHLTKQAVTLEDSAVYYCALS
Ornithorhynchus anatinus V718 trav AAPN01426461.1 14192 RTDGDSVNQTEGHVALVEGTALSLNCTYKIGGSTPYVFWYVQFPGEGLQFLLNAMSGREEGKSENGFHAKLNKTETSFHLRKQAITMGDSAVYYCAVS
Ornithorhynchus anatinus V719 trav AAPN01426461.1 12316 RTNGDSVDQTKGHIALAEEKTLTLNCTYETTYSSPYLFWYVQYPGDGPQLLLKAISEEEQGEGGNGFHAKINKSATSFHLRKQAVALEDSAVYYCAVS
Ornithorhynchus anatinus V720 trav AAPN01426461.1 9882 VSGLDEVEQTPPSLTIQEGEDGIMNCSYKASNFQGLQWYRQYAGKGPEFLFILWLNGDNKKEGRLTANLRTEGSVSSLLIRDSHLEDSASYLCAVE
Ornithorhynchus anatinus V721 trav AAPN01426461.1 7695 GTNGDSVNQTEDQLTLVEEATLTINCTYKISVPPTLFWYVQFPREAPRVLLRDTSEEEQKKASNGFHAKHDRTTTSFHLRKQAVNRRDSAVYYCAMK
Ornithorhynchus anatinus V722 trav AAPN01426461.1 4654 ASGQSEVKQTPSSLSIRAGVNSTLNCNYSTKNFNSLQWFRQYAGKGPESLFILSLHGFDKKEGRLTATLNTQKGTSSLHIRSSHLEDSATYLCAVN
Ornithorhynchus anatinus V723 trav AAPN01426461.1 2962 ETDGESVNQREGHVTLVEGETLILNCIYESSYSPNFFWYVQFPQKAPRFLLRDMSKGEQNGFYAKLNQTEKSFHLRKRSVALEDSAVYHCAMS
Ornithorhynchus anatinus V724 trdv AAPN01426461.1 1676 SIMAHSISQAQAAASGKVGATLTLSCSYSTSYHNYYLYWYKQPPTGEMTYLICQGSNMKENTRNGRYSVSFQKTLRSFSLTNTMLQVGDLGLYFCALSA
Ornithorhynchus anatinus V725 trav AAPN01426462.1 938 QTDGDSVDQTEGSLALVEEKELLLNCTYVTSDSSPTLFWYIQLPGEGPQLLLKTTFGKEQKVTGNDFYAKLNTTEKSFHLRKQAITVGDSAMYYCAVS
Ornithorhynchus anatinus V726 trav AAPN01426463.1 6870 ASGQDKVEQTPSSLSIREGEKGTMNCSYKTSNFYGLQWYRQVAGKGLEFLFLFSSKDQKESGRLLAELKTERTISFLHIKDAQVGDSATYFCALD
Ornithorhynchus anatinus V727 trav AAPN01426463.1 3791 ASGLDKVEQTPLSLNIQEGEHGTMNCSYTNSAFDPIHWYRQDPGKGPALLTLIRSNEKLKTIGRFTITLDKGDKRSSLGIRDAQHRDAATYFCAGE
Ornithorhynchus anatinus V728 trav AAPN01426463.1 1779 GMDGESVNQMEGPVVFVEETALTLNCTYESSSYSPILFWYIQYPKEGLQLFLKDMSEEAQKEATNGFYAKLVKAEKSFHLRKHAVTLGDSAMYYCAVS
Ornithorhynchus anatinus V729 trav AAPN01426464.1 921 VSGLDKVEQTPPFLSILKGQKGTMNCSFPNIAFNYLHWYRQDPGKGPIFLILMYSNDNEKTNGRVTVTLEKGEKRSFLNIRDAQPGDSATYLCAVE
Ornithorhynchus anatinus V730 trav AAPN01426465.1 3363 VSGQVELEQSPPSLRIQEGESLTLHCKSSRTLSILLWYRQDPQKGPQALVTLTKPNEVKPQGRLTARFGEKRQNGSLLIRDSQLGDSAIYLCAGE
Ornithorhynchus anatinus V731 trav AAPN01426467.1 3550 ASGQITVEQTPPSLSIHEGENGTLTCNYTATTSITLYWYRQIPGRGPDFLMLIYSHEKEKPSGRLTATLEKVPQRSFLHIPAAQLGDSATYLCAVE
Ornithorhynchus anatinus V732 trav AAPN01426467.1 997 SSVAQSVSQAETAASGKEGDTLTLPCTYDTSDSNYYLFWYRQLPKGNMIYLLSQSSWASENARTGRFSVTFQKESKSISLTIADLQPGDSAVYFCAYSG
Ornithorhynchus anatinus V733 trav AAPN01426468.1 1987 ARGEDKVEQNPPALRVQKGQNGIMICNFTSSAFNSLQWYRQDPGKGPVFLMLIYSSEMEKTQGRFTAKLNKVNQGSSLFIRDIQPGDSTTYLCAVE
Ornithorhynchus anatinus V734 trav AAPN01426469.1 3785 VSGQTKPKQTPPTLRVREGESPALLCSNFDKTIVSLQWYQQQDFGKHPVFLFQMVLNKDEQQNGRLTATINKENQTSWLHIRDTQPGDSATYLCAVE
Ornithorhynchus anatinus V735 trav AAPN01426469.1 1940 VSGQTKPKQTPPSLNIREGESPTLYCNDFEKTIRSLQWYRQDYGKSPVFLFLLALKNDVKRDRRLTATIDKGNQTSSLHIRDAKPGDSATYLCAVE
Ornithorhynchus anatinus V745 iglv AAPN01442073.1 2735 FVSSLPTQPPSASVALGQTATITCSGVSSSYGASWYQQKPGQAPVLVMYYNNNRPSGIPDRFSGSKSGSTATLTIARAQAEDEADYYCQDASSSN