WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Callithrix jacchus JRUL000000000.1 (JRUL01) 33 3 6 1 13 8 1 1
Callithrix jacchus BBXK00000000.1 (BBXK01) 151 25 22 24 30 39 6 5
Callithrix jacchus ACFV00000000.1 (ACFV01) 210 75 27 24 31 42 6 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Callithrix jacchus V0 trbv JRUL010008966.1 2113 LTDAGVIQSPRHKVTQMGQSVTLRCEPISGHNDLLWYRQTLVQTLELLSYFRSRTLVDDSEMPQDRFSAEMPNASFSTLRIQPTEPKDSALYLCA
Callithrix jacchus V1 trbv JRUL010091362.1 281 LVEVKVTQNPRYLVKKMGEKVFLECVQDMDHGRMFWYRQDPGLGLRLIYFSYDIKNYEKGDVPDGYNVSREKKEQFSLILGSASTSQTSVYLCASSL
Callithrix jacchus V2 trav JRUL010117219.1 394 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYIIHGLKNNETNEMASLVIAEDRKSSTLILPHATMRDAAVYYCIVRV
Callithrix jacchus V3 trav JRUL010124311.1 658 VNGENVEQRPSTLSVQVGDSSVINCTYSDSASNYFPWYKQELGKGPRLIIDIRSNVDKRKDRRMTVLLNKTAKHFSLHITDTQPGDSALYFCAAG
Callithrix jacchus V4 ighv JRUL010127060.1 870 VCAEVQLVQSGAEVKRPGESLKISCRASGYSFNSYWISWVRQMPGKGLEWMGRIYPGDSDTRYSPSFQGHVTISADKSSNTAHLQWSSLKASDAAMYYCAR
Callithrix jacchus V5 iglv JRUL010246142.1 861 SEASYELTQPPSVSVSPGQTARITCSGDALPEIYAHWYQQKPGQIPVLVIYEDSKRPSGIPERFSGSSSGTTATLTISGAQAEDEADYYCQSADSSGTY
Callithrix jacchus V6 trgv JRUL010247997.1 217 SKVEQFQLSISTEIKKSIDIPCKVSSTNFETDVIHWYRQKPNQALEHLVYTALTKSSAGGSQGQRSNKLEARKNSQTSTSILTIKSIEKEDTAIYYCAAWE
Callithrix jacchus V7 trav JRUL010547187.1 452 GINGNSVVQTEGEVLLSEGDSLTVNCSYESTGYPSLFWYVQYPGKGPELLLKAMKGNDKGRSNKDFEAIYRTETTSFHLEKGSVQESDSAVYFCALS
Callithrix jacchus V8 trdv JRUL010664742.1 255 VSLDIILESDTKVLTVLAGEAASFRCSVTGGDLKNYQVSWYKKSEDNSLILVFKLSNRSNYNLGNNFMGKTDALKNQFMLDIQKATTKDVGTYYCASD
Callithrix jacchus V9 trav JRUL010906960.1 327 VNTQQLEQSPQFLSIQEGEDFTVYCNSSSVFTNLKWYRQDPGEGPVLLGTLVKSGEVKKQKRLIFQFGDARKDSSLHITAAQPGDTGLYLCAG
Callithrix jacchus V10 trbv JRUL011433934.1 74 SVTAGVTQTPKFQVLKTGQSTMLQCAQDMNHYYMYWYRQDPGMGLRLIHYSVDKGTTDKGEVPDGYNVSRSNREDFLLRLESAAPSQTSVYFCASSD
Callithrix jacchus V11 iglv JRUL011483936.1 62 SWAQSVLTQPPSASGNPGQRVTISCSGSSSNIGSNYVNWYQQLPGKAPKLLIYSNSNRPSGVPDRFSGSKSGTSATLGITGLQPEDEADYYCEAWDNSLSA
Callithrix jacchus V12 trbv JRUL010009602.1 2385 LGEAGVTQTPRHLIKMRGQQVTLRCSPVSGHSSVYWYQQAPGQGPQFLFEYYNAIERQKGNFPDRFSGHQFSNSTSEMNVNALELGDSALYLCASSL
Callithrix jacchus V13 iglv JRUL010019600.1 465 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKYVHWYQQKPGQAPVLVIYRDSNRPSGISERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSH
Callithrix jacchus V14 trav JRUL010024402.1 1903 VSGQQLNQSPQSMSIQEGEDVSMNCTSSSTFNPLLWYKQDAGEGPVLLITLYMGGELTRNGRLTAQFGITRKDSFLNISASVPDDVGTYFCAG
Callithrix jacchus V15 ighv JRUL010035530.1 1422 AAGGVWGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSQKYYADSVKGRVTISRDNSKNMLYLQMNSLRAEDTAMYYCA
Callithrix jacchus V16 trbv JRUL010047560.1 1718 SVFGAVVSQKPSRGICQRETSMTIQCHVDSQVTLMFWYCQLPGQSMTLIATANQGSEATYEKGFAKDKFPISRPNLTFSTLNVSNMSPEDSGIYFCSAG
Callithrix jacchus V17 iglv JRUL010112206.1 1291 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYEVSSRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Callithrix jacchus V18 trbv JRUL010151760.1 1015 PSDSAVSQTPKYLVTQMGKKESLKCEQNLGHDAMYWYKQDSKKLLKIMFIYNNKERILNETVPNRFSPESPDKAHLNLHIESLELGDSAVYFCASSQ
Callithrix jacchus V19 trav JRUL010180421.1 331 MRLVIGTAGQNIGQPTEVTAMEGAIVQINCTYQTTGFNGLSWYQQRDGKAPTFLSYNVLNGLEERGHFSSFLNRSKGYSYLLVKKLQMKDSASYLCAVR
Callithrix jacchus V20 iglv JRUL010249809.1 1065 CWAQSVLTQPPSVSGNPGQRITISCSGSSSNIGVYTVQWYQQLPGMAPKLLIYGNNQRPSGVSDRFSGSKSGTSASLAITGLQSADEADYYCQSYDSNLN
Callithrix jacchus V21 trav JRUL010258516.1 899 GTRAQSVTQLDGQVTVSEEAPVLLKCNYSSSVTVYLFWYVRYPNQGLQLLLKYLSGPTLVKGIKGFEAEFKKSESSFHLRKSSAHVSDAAEYFCAVS
Callithrix jacchus V22 trav JRUL010274012.1 1138 FSIAQRVTQSESEMSVQEAETVTLSCTYDSSDSDYYLFWYKQSPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISGSQLGDTAMYFCAYR
Callithrix jacchus V23 trav JRUL010363241.1 618 VSSKQEVTQIPAALNVPEGDSLVLNCSFTDRAIYSLQWFRQDPGKGLTSLLLIQSSQREQTSGRLTALLDKSSGHSTLYIAASQPGDSATYLCAV
Callithrix jacchus V24 trbv JRUL010446734.1 533 HTAAGVTQFPSHRVIEKGQAVTLRCDPISGHESLFWYRRIMGKEIKFLIYFLRDSKQDESGMPSHRFSAERTGGTSSTLTVKSAELEDSGIYFCASSL
Callithrix jacchus V25 trav JRUL010618716.1 646 GTNSNSVKQTDQVTISEGASVTMNCTYTSMGYPTLFWYVQYPNKPLQFLQEETMENSKNFGARNIKDKNSPIVKHSVWVSDSAMYYCLLRDTVLR
Callithrix jacchus V26 trav JRUL010696379.1 725 VNSQQGEEEPQTLSIQEGENATMNCSYKTSISSLQWYRQDSSRGLTQLVLIRSNEREKYSGRLRFTLDTSMKSSSLFIAAAQAADTAAYFCATE
Callithrix jacchus V27 iglv JRUL010703742.1 363 SVVSSELTQDPAVSVALGQPARITCQGESLRSYYPSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTY
Callithrix jacchus V28 trbv JRUL010731542.1 429 FKNAIVTQFPRHRIIGTGKEFILHCSQNMNHVAMFWYRQDPGFGLKLVYYSPGPGSIEKGDVSEGYHVFRNNMTHFPLTLKSASTNQTSVYLCASSS
Callithrix jacchus V29 ighv JRUL010889387.1 671 ALSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYNMHWARQAPGQGLQWKGWIYPGNGNTKYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V30 trav JRUL011089064.1 551 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVNNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVSMERYSLLHISSSHTTDSAIYFCAVVPQCSP
Callithrix jacchus V31 igkv JRUL011180998.1 544 SRGDIVMTQSPAFFSGTPGEKVIITCRASQGISKYLHWYQQKPDQPPKLLIKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQSNNWP
Callithrix jacchus V32 trav JRUL011287351.1 402 VSSEDKVIQSPPSLVVHEEDSVTVNCSYEAANFQSLLWYKQEKKAPTFLFMLTSSRIEKKSGSLSSMLDKKERFSILNITATKTRDSATYLCAVE
Callithrix jacchus V0 iglv BBXK01006579.1 2231 SLSQPVLTQPASLSATPGASARLTCTLRSDINVGSYTIYWYQQKPGSPPWYLLYYYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCMI
Callithrix jacchus V1 iglv BBXK01006579.1 12425 SWAQSVLTQPPSASGNPGQKVTISCSGRSSNIGSNYVSWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSATLGITGLRLEDEADYYCLAWDDSLKA
Callithrix jacchus V2 iglv BBXK01006579.1 26466 CWAQSVLTQPPSVSGNPGQRITISCSGSSSNIGVYTVQWYQQLPGTAPKLLIYGNNQRPSGVSDRFSGSKSGTSASLAITGLQSVDEADYYCQSYDSNLN
Callithrix jacchus V3 iglv BBXK01006579.1 40512 SLSQPVLTQPSFLSGSPGASARLTCTLRSDISVGSKTIYWYQQKSESAPRYLLYYNSDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCMI
Callithrix jacchus V4 iglv BBXK01006580.1 13888 SWAQSVLTQPPSASGNPGQRVTISCSGSSSNIGSNYVNWYQQLPGKAPKLLIYSNSNRPSGVPDRFSGSKSGTSASLTITGLQPEDEADYYCEAWDNSLSA
Callithrix jacchus V5 iglv BBXK01006593.1 7756 SATSYELTQPHSVSVAPGQTARITCGGNDIGSKSVQWYQQKPGQAPVLVIYSDSNRPSGISERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDN
Callithrix jacchus V6 iglv BBXK01006593.1 13844 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYPSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTY
Callithrix jacchus V7 iglv BBXK01006593.1 23198 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQADDEADYYCSSYAGS
Callithrix jacchus V8 iglv BBXK01006594.1 660 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYEVSSRPSGVSNHFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Callithrix jacchus V9 iglv BBXK01006596.1 3459 SEASYELTQPPSVSVSPGQTARITCSGDALPEIYAHWYQQKPGQIPVLVIYEDSKRPSGIPERFSGSSSGTTATLTISGAQAEDEADYYCQSVDSSGTY
Callithrix jacchus V10 iglv BBXK01006597.1 13509 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKYVYWYQQKPGQAPVLVIYRDSNRPSGISERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDN
Callithrix jacchus V11 iglv BBXK01006599.1 583 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNYVSWYQQHPGSAPKLMIYDVSSRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Callithrix jacchus V12 iglv BBXK01006600.1 10550 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKYVHWYQQKPGQAPVLVIYDNSNRPSGISERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSGN
Callithrix jacchus V13 iglv BBXK01006600.1 16577 SVVSSELTQDPAVSVALGQPARITCQGESLRSYYPSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTY
Callithrix jacchus V14 iglv BBXK01006600.1 26408 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Callithrix jacchus V15 iglv BBXK01006603.1 2183 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYPSWYQQKPGQAPVLVIYGDNNQPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTH
Callithrix jacchus V16 iglv BBXK01006607.1 9957 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKSVQWYQQKPSQAPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISGVEVGDEADYYCQVWDSNH
Callithrix jacchus V17 iglv BBXK01006608.1 3113 SEASYELTQPSSVSVSPGQTARITCSGDALPERYAYWYQQKPGQIPVLVIYKDSERPSGIPERFSGSSSGTTATLTINGAQAEDEADYYCQSVDSSGTY
Callithrix jacchus V18 iglv BBXK01006610.1 13696 SATSYELTQPHSVSVAPGQTARITCGGNNIGRKNVYWYQQKPSQSPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDN
Callithrix jacchus V20 iglv BBXK01006610.1 21627 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYSSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTY
Callithrix jacchus V21 iglv BBXK01006611.1 6608 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNYVSWYQQHPGSAPKLMIYSVSNRPSGVSKRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Callithrix jacchus V22 iglv BBXK01006611.1 20094 LCALPVLTQPPSASAALGASVKLTCTLSSEHSNYYIHWYQQRPGRCPQYIMRVNSDGSHSKGDGIPNRFSGSSSGADRYLTISNLQSEDEAEYHCGE
Callithrix jacchus V23 trav BBXK01010125.1 25209 MRLVIGTAGQNIGQPTEVTAMEGAIVQINCTYQTTGFNGLSWYQQRDGKAPTFLSYNVLNGLEERGHFSSFLNRSKGYSYLLVKKLQMKDSASYLCAVR
Callithrix jacchus V24 trav BBXK01010127.1 24999 GLRAQSVAQPEDRVTVAEGNPLTVKCTYSVSGTPYLFWYVQYPNQGLQFLLKHITGDNLVKGSYGFEADFNKSQTSFHLKKPSALVSDSALYFCAVR
Callithrix jacchus V25 trav BBXK01010130.1 4677 TWSLAKTTQPISMDSYEGQEVNISCSHDNIATSDYIFWYQQFPNQGPRLIIQGYKTNVANEVASLFIPAERKSSTLSLPRVALSDTAVYYCVVG
Callithrix jacchus V26 trav BBXK01010133.1 16157 DARAQSVSQPDYHVILSEGASLELRCNYSYGGTVTLFWYVQNPGQDLQLLLKYYSGDTLVKGIKGFEAEFMKSRSSFNLRKPSVQWSDTAEYFCAVK
Callithrix jacchus V27 trav BBXK01010133.1 25383 GINGNSVVQTEGEVLLSEGDSLTVNCSYESTGYPSLFWYVQYPGKGPELLLKAMKGNDKGRSNKDFEAIYRTETTSFHLEKGSVQESDSAVYFCALS
Callithrix jacchus V28 trav BBXK01010134.1 3110 GSGKNQVEQSPQSLVILEGKNCTLQCNYTVTPFNNLRWYKQDNGKGPITLMIMTFSENTKSNGRYAATLDANTKQSSLHITASQLSDSASYICVVR
Callithrix jacchus V29 trav BBXK01010134.1 21124 VLSQQKEVEQDPGPFNVPEGTTVAFNCTYSNSASQSFFWYRQDPRKGPKLLMSVYSSGNEDGRFTAQLNRASRYVSLLIRDSQLSDSATYLCAV
Callithrix jacchus V30 trav BBXK01010134.1 26835 GTRAQSVTQLDGQVTVSEEAPVLLKCNYSSSVSVYPFWYVRYPNQGLQLLLKYLSGPTLVKGIKGFEAEIKKSESSFHLRKSSAHVSDAAEYFCAVS
Callithrix jacchus V31 trav BBXK01010134.1 30153 DARAQSVTQPDIHITVSEGASLELRCNYSYGATAYLFWYVQSPGQGLQLLLRYFSGDTLVQGIKGFEAEFKRSESSFNLRKPSVHWSDAAEYFCAVS
Callithrix jacchus V32 trav BBXK01010135.1 6399 VNGENVEQRPSTLSVQVGDSSVINCTYSDSASNYFPWYKQELGKGPRLIIDIRSNVDKRKDGRMTVLLNKTAKHFSLHITDTQPGDSALYFCAAG
Callithrix jacchus V33 trav BBXK01010135.1 26105 VWSQQKLEQNSGPLNVPEGVIASLNCTYSDRGSQSFYWYRQYSGRSPELLMSIYSNGDEEDGRFTAQLNRASQYVSLFIRDSQLSDSATYLCAV
Callithrix jacchus V34 trav BBXK01010138.1 13509 VWSQQKEVEQNPGPLNVPEGAIASLSCTYSNRAFQYFMWYRQYSRKGPELLMFTYSSDKKEDGRFTAQLNKSSQYISLFIRDSQPSDSATYLCAV
Callithrix jacchus V35 trav BBXK01010141.1 7151 GTTAQRVTQPEKTLSVFEGAPVQLKCNYSYSGNPDLFWYVHYPKQRLQLLLKHISRESVKGFTADLNKGETSFHLEKPFAQEEDSATYYCALS
Callithrix jacchus V36 trav BBXK01010141.1 15285 VNSQQGEEEPQTLSIQEGENATMNCSYKTSISSLQWYRQDSSRGLTQLVLIRSNEREKYSGRLRFTLDTSMKSSSLFIAAAQAADTAAYFCATE
Callithrix jacchus V37 trav BBXK01010141.1 21630 GTCGDSVTQTEGPVTLLEGAALTLNCTYQSSYSAFLFWYVQYLNKEPQLLLKSSENQETDSRGFQASHVKSDSSFHLEKSSVQLSDSAVYYCALR
Callithrix jacchus V38 trdv BBXK01010141.1 24835 SSMAQKVIQAQTEISVMEKEDVTLDCLYKTSVTTYYLYWYKQPPTREMIFLIRQNSFNEQNEINGRYSWNFQRSTSSFNLTITASQVIDSAVYFCALSE
Callithrix jacchus V39 trav BBXK01010146.1 5678 MSGEDQVTQRHEALRLQEGDSSSINCSYTVSSFNRLLWYRQDPGKGLEFLFILYSAGEEKQKGRLKATLTKKESFLHITAPKPEDSATYLCAVQ
Callithrix jacchus V40 trav BBXK01010147.1 8809 VSSKQEVTQIPAALNVPEGDSLVLNCSFTDRAIYSLQWFRQDPGKGLTSLLLIQSSQREQTSGRLTALLDKSSGHSTLYIAASQPGDSATYLCAV
Callithrix jacchus V41 trav BBXK01010147.1 24147 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVNNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVSMERYSLLHISSSQTTDSAIYFCAVVPQCSP
Callithrix jacchus V42 trdv BBXK01010149.1 15447 SSVAQKVTQAQLPITMPVGKAVTLNCLYETRQEFYYIFWYKQLPSRKIVFLIHQYATKQNAKHDRSSVNFQKARKSIDLTISALQLEDSATYLCALWE
Callithrix jacchus V43 trav BBXK01010149.1 25225 ASSILNVEQSPQSLRVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPENLLVMTLNGDEKKKGRINVTLNTKEGYSYLYIKGSQPEDSATYLCAI
Callithrix jacchus V44 trav BBXK01010149.1 30712 VNGQQIIQIPHFQHVQEDEDFTIYCNSSTTLDNIQWYKQRPGGHPVFLIRLVKSGEVMKQKRLTFQFGEARKNSSLHITVTQTTDVGTYFCA
Callithrix jacchus V45 trav BBXK01010151.1 10714 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYIIHGLKNNETNEMASLVIAEDRKSSTLILPHATMRDAAVYYCIVRV
Callithrix jacchus V46 trav BBXK01010151.1 18147 GSRAQSVTQFDGHITVSEGAPLKLRCNYSYIGTPYLFWYVQYPSQSLQLLLKDLTAATQVKGIKGFEAEFRKSETSFHLRKPSAHVSDTAVYFCVVS
Callithrix jacchus V47 trav BBXK01010151.1 35110 VNTQQLEQSPQFLSIQEGEGFTVYCNSSSVFTNLKWYRQDPGEGPVLLGTLVKSGEVKKQKRLIFQFGDAKKDSSLHITAAQPGDTGLYLCAG
Callithrix jacchus V48 trdv BBXK01010152.1 22899 SSMSQKVIQSQPAISMQEGETMKLDCLYKTNIVYYISYWYKRPPSGEIISLIHQQTDAETNVTNGQYSVSLHKATKTIQLIISPSQPEDSARYFCCLR
Callithrix jacchus V49 trav BBXK01010157.1 4788 ISSQELEQSPQSLIIQEGENLTINCGSSKTLYALHWYKQKYGEGLIFLMMLQIGGEEKSHEKITAKLDEKKQQSSLHITASQPSHTGIYLCGAD
Callithrix jacchus V50 trav BBXK01010157.1 15460 VSGQQLNQSPQSMSIQEGEDVSMNCTSSSTFNPLLWYKQDAGEGPVLLITLYMGGELTRNGRLTAQFGITRKDSFLNISASVPDDVGTYFCAG
Callithrix jacchus V51 trav BBXK01010157.1 20210 VSSEDKVIQSPPSLVVHEEDSVTVNCSYEAANFRSLLWYKQEKKAPTFLFMLTSSRIEKKSGSLSSMLDKKERFSILNITATKTRDSATYLCAVE
Callithrix jacchus V52 trav BBXK01010158.1 18957 SGMSQVVAQSQPEMSVQEAETVTLNCTYDTSDSNYYLFWYKQSPSREMILVIRQEAFKQQNATENRFSVNFQKAAKLFSLKISNAQLGDTAMYFCAYR
Callithrix jacchus V53 trav BBXK01010158.1 27992 FSIAQRVTQSESEMSVQEAETVTLSCTYDSSDSDYYLFWYKQSPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISGSQLGDTAMYFCAYR
Callithrix jacchus V54 trav BBXK01010162.1 27895 GTNSNSVKQTDQVTISEGASVTMNCTYTSMGYPTLFWYVQYPNKPLQFLQEETMENSKNFGARNIKDKNSPIVKHSVWVSDSAMYYCLLRDTVLR
Callithrix jacchus V55 trav BBXK01010162.1 33521 VTAAKNEVQQSPQDLTVQEGEFVTINCSYSIGITTLQWLQQHPGGGIVSLFKLSSENKKHGRLTATINLQEKHSSLHITASQPRDSAIYICAV
Callithrix jacchus V56 trdv BBXK01010165.1 45493 VSLDIILESDTKVLTVLAGEAASFRCSVTGGDLKNYQVSWYKKSEDNSLILVFKLSNRSNYNLGNNFMGKTDALKNQFMLDIQKATTKDVGTYYCASD
Callithrix jacchus V57 trdv BBXK01010166.1 10449 VMSATELVPEHQTVTVSLGDPATLRCSMKGEAITNYYINWYRKTQGNTMTFIYREKDIYGPGFKDGFQGEIDTEKDQAVLKILAASETDEGSYYCASD
Callithrix jacchus V58 igkv BBXK01028588.1 26185 SSGDIVMTQTPLSLSITPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYWASNRFSGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQGIQYP
Callithrix jacchus V59 igkv BBXK01028588.1 38927 TRCDIQMTQSPSSLSASVGDRVTITCRASQDIRGYLAWYQQKPGKTPRLLIYAASSLQTGIPSRFSGSRSGTDYTLTISSLQSEDVATYYCQQHYSTP
Callithrix jacchus V60 igkv BBXK01028590.1 8720 ARCDIQMTQSPSFLSASVGDRVTITCRASQSISNELAWYQQKPGKAPVLLIYAASSLQTGVPSRFSGSGSGTDFTLTISSPQPEDVATYYCQQDYG
Callithrix jacchus V61 igkv BBXK01028590.1 19175 SSGDIVMTQTPLSLPVTLGESASISCRSSQSLFDSDYELTYLDWYLQKPGQSPQLLIYSVSNRASGVPDRFSGTGSGTDFTLKISRVEAEDVGVYYCMQSKELP
Callithrix jacchus V62 igkv BBXK01028591.1 6597 STGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLHWFLQKPGQSPQLLIYKVSSLASGVPDRFSGGGSGTDFTLKISRVEAGDVGVYYCMQSIQYP
Callithrix jacchus V63 igkv BBXK01028591.1 20341 SRCDIQMTQSPSSLFASVGDRVTITCRASQNIRSNLAWYQQKPGKTPRLLIYDASSLQTGIPSRFSGSGSGTYYTLTISSLQSDDFATYYCQHGYSTP
Callithrix jacchus V64 igkv BBXK01028591.1 30807 ARCDIQMTQSPTFLSASVGDRVTITCRASQSIGSALAWHQQKPGKATRSLIYGTSSLQPGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQYSSYP
Callithrix jacchus V65 igkv BBXK01028592.1 6276 SSGVIVMTQTPLSLTVTLGEPASISCRSSQSLLHSNGNTYLHWFLQKPGQSPQLLIYKVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCMQN
Callithrix jacchus V66 igkv BBXK01028593.1 2473 SSGDIVMTQTPLSLPITVGELASISCRSSQRLLHSNGNTYLYWYLQKPGQPPQLLIYKVSNRASGVPDGFSGSGSSTDFTLKISIVKAEDFGVYYCMNCLQ
Callithrix jacchus V67 igkv BBXK01028600.1 1532 ARCDIQMTQTPSSVSASVGDKVTITCRASQGISSWLAWYQQKPGKAPKLLIYRASNLGTGVPSRFSGSGSGTDFTLTISGLQPEDIATYYCQQYDNLP
Callithrix jacchus V68 igkv BBXK01028603.1 10491 ARCDIQMIQSPSSLSASVGDRVTITCRASQGISSCLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISGLQPEDIATYYCQQYDNLP
Callithrix jacchus V69 igkv BBXK01028603.1 32232 SSGDVVMTQTPLSLSVTPGEPASISCRSSQSLVYSNGNTYLSWFLQKPGQSPRLLIYEVSTWESGVPDRFSGNGTGTDYFTLKISRMETEDVGVYYCMQG
Callithrix jacchus V70 igkv BBXK01028603.1 42581 SSGDIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGYTYLNWYLQKPGQSPQLLIYAASNRASGVPDRFSGSGSGTDFTLKISLVEAEDVGVYYCMQAIELP
Callithrix jacchus V71 igkv BBXK01028605.1 1357 TRCDIQMTQSPSSLSASVGDRVTISCHASQSISNWLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCQKHDSAP
Callithrix jacchus V72 igkv BBXK01028609.1 3525 SSGDIVMTQTPLFLPVTPGEPASISCRSSQSLLHSNGNTYLNWFLQKPGQPPRRLIYKVSTRDPGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCLQG
Callithrix jacchus V73 igkv BBXK01028610.1 14001 SRGEIVLTQSPAFLSVTPREKVTITCRASQGINNNLHWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQSNNW
Callithrix jacchus V74 igkv BBXK01028616.1 8201 TTGEIVMTQSPATLSLSPGERATVSCRASQSVSSNLAWYQQKPGQAPRLLIYGASNRATDIPARFSGSRSGTDFTLTISSLEPEDFAVYYCQQYSSWP
Callithrix jacchus V75 igkv BBXK01028627.1 231 SSGDIVMTQTPLSLSITPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYRASNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQA
Callithrix jacchus V76 igkv BBXK01028630.1 95 SRGDIVMTQSPAFFSGTPGEKVIITCRASQGISKYLHWYQQKPDQPPKLLIKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAAMYYCQQGNNW
Callithrix jacchus V77 igkv BBXK01028633.1 5083 ARCDIQMTQSPSSLTASVGGKVTITCQASQDISKWLAWYQQKPGTVPKPLIYEASKLQSGVPSRFSSSGSGADFTLTITSLQPEDAATYYCQNYLGSS
Callithrix jacchus V78 igkv BBXK01028633.1 18127 TTGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSSWP
Callithrix jacchus V79 igkv BBXK01028637.1 26036 SNGEIVLTQSPTSMAVSQGEKVTISCTASSSVSTSYLHWYQQKPGSPPRLLVYSTSSLASGVPARFSGSGSGTSYTLTISSMEADDAASYYCQQWSSYP
Callithrix jacchus V80 ighv BBXK01054301.1 3577 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSNFMHWVRQAPVQGLEWMGWIYPGNGNTNYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCVR
Callithrix jacchus V81 ighv BBXK01094288.1 10342 SHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSHGISWLQQAPGQGLELVGWIHPNSGDTGYAQKSQGRVTMTRDTTASTAYMELSSLRSEDMARYYCAR
Callithrix jacchus V82 trbv BBXK01094966.1 52052 ARSQTIHQWPATLVQPVGSLLSLECTVKGTSNPNLYWYRQSADRGLQLLFYSVSVDQIHSEVPQNLSASRPQDEQFILSSKKLLLSDSGFYLCAWS
Callithrix jacchus V84 ighv BBXK01013293.1 4012 ALSEVQLQESGPGLVKPSQTLSLTCAISGDSVSSNTATWNWIRQSPGRGLEWLGRTYYRSKWYSEYAASLQSRITINPDTSKNQFSLQLTSVTLEDTAVYYCA
Callithrix jacchus V85 ighv BBXK01013294.1 27857 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGLEWVSTIGTAGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V86 ighv BBXK01013294.1 21730 SGAAGGVWGRLGSAWGGPLRLSCAASGFTFSDYRMYWVHQALSKWLEWVANIKYDGGEKYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V87 ighv BBXK01013294.1 5611 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSYISYDGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V88 ighv BBXK01013299.1 4150 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWIRQAPGKGLEWVSAIRYDGGSTYYADSVKGRFTISRENAKNSLYLQMNSLRAEDTSVYYCAKD
Callithrix jacchus V89 ighv BBXK01013301.1 1475 VLSQVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLAIIYWDDDKYYSPSLRSRLTISKDTSKNQVVLTMTNMDRVDTATYYCAGR
Callithrix jacchus V90 ighv BBXK01013307.1 318 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGWIYPGNGNTKYAQQFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCA
Callithrix jacchus V91 ighv BBXK01013308.1 37570 AQSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAISWVRQPPGQGLEWMGGIDPEYGSTSYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V92 ighv BBXK01013308.1 28723 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMDWVRQAPGKGLEWVSYINYNGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAMYYCAR
Callithrix jacchus V93 ighv BBXK01013308.1 21846 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSGLKTEDTAVYYCT
Callithrix jacchus V94 ighv BBXK01013311.1 1783 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMSWVRQAPGKGLEWVGLIRNKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSGLKTEDTAVYYCTR
Callithrix jacchus V95 ighv BBXK01013316.1 22291 VLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYWWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRATISADTSKNQFSLRLSSVTAADTAVYYCA
Callithrix jacchus V96 ighv BBXK01013316.1 4661 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVCQAPGKGLEWVSVISTDGRTTYYADSVKGLFTISRDNAKNSLYLQMNSLRAEDTAVYYCAG
Callithrix jacchus V97 ighv BBXK01013317.1 12755 AHSQMQLVQSGAEVKKPGASVKVSCKASGYTFTYRYIHWVRQAPGQGLEWMGWITPYNGNTNYAQKFEGRVTITRDRSMSTIYMELRSLRPEDTAVYHCAR
Callithrix jacchus V98 ighv BBXK01013318.1 7527 AHSQVQLVQSGAEVKQPGASVKVSCKASGYTFTSYGMQWVRQAPGQGLEWMGWINTNTGGTGYAQKFQGRVTMTRDASTSTAYMELSSLRPQDTAVYYCAR
Callithrix jacchus V99 ighv BBXK01013320.1 366 AHSQVQLVQSGDEVKKPGASVKVSCKASGYTFTSYCMHWVRQAHAQGLEWMGYVCPGSGSTGYAQKFQGRVTMTRDTSTSTAYMELRSLRPEDTAVYYCA
Callithrix jacchus V100 ighv BBXK01013324.1 19870 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWIRQAPGKGLEWVSAISTGGSTYYADSMKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAG
Callithrix jacchus V101 ighv BBXK01013324.1 11518 AHSQEQLVQSGAEVKKPGASVKVSCKASGYSFTSYAISWVRQAPGQGLEWMGVIIPIVGVTNYAQKFQDRVTMTADTSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V102 ighv BBXK01013324.1 1665 AHSQVQLVQSSPQVKKPGASVKVSCKASGYTFTDYYMQWVRQAPGQGLEWMGWINPSSGSTNYAQKFQGRVTMTRDTSTSTAYTELSILRSEDMAMYYCAR
Callithrix jacchus V103 ighv BBXK01013326.1 12809 VHSQVQLVQSGPELKQPGASVKVSCKASGYTFTSYAINWVRQAPGQGLEWMGWINTYNGKPTYAQGFTGRFVFSTDTSVSTAYLQVSSLRSEDTAVYYCAR
Callithrix jacchus V104 ighv BBXK01013326.1 9232 VLSQVQLQESGPGLVKPSETLSLICAVSGYSISSGYWWSWIRQPPGKGLEWIGRIYRSGSTYYNPSLKSRATISADTSKNQFSLRLSSVTAADTAVYYCA
Callithrix jacchus V105 ighv BBXK01013327.1 5108 VCAEEQLVQSGAEVKRPGESLKISCRASGFTVNWISWVRQMPGKGLEWMGRIDFRDSETKYSPSFQGHITFSADKSSNTAHLQWSSLKASDAAMYYCAR
Callithrix jacchus V106 igkv BBXK01028637.1 36085 TGAETTLTQSPALVSVTPGDKVTISCKASQDIDNDIYWYQQKPGDAPIFIIQEATTLVSGIPPRFSGSGYGTDFTLTIDNIEPEDAAYYFCQQDDNFP
Callithrix jacchus V107 igkv BBXK01028640.1 12508 TYGDIVMTQSPDSLALSLGERVTINCKSSQSLLSSSRNYLAWHQQKPGQAPKQIILWASTRVSGVPDRYSGSGSGTDFTLTISSLQAEDVAIYYCQQFHSAP
Callithrix jacchus V109 ighv BBXK01079812.1 5262 AHSQVQLVQSGAEVQQPGASVKVSCKASGYTFTSYTISWVRQAPGQGLEWMGWIYPGSGNTNYAQKFQGRVTMTADKSTSTAYIELSSLRSEDTAVYYCAR
Callithrix jacchus V110 trgv BBXK01091887.1 16152 SKVEQFQLSISTEIKKSIDIPCKVSSTNFETDVIHWYRQKPNQALEHLVYTALTKSSAGGSQGQRSNKLEARKNSQTSTSILTIKSIEKEDTAIYYCAAWE
Callithrix jacchus V111 trgv BBXK01091887.1 4817 ASGDNLITQLVTSTTKKKGNTAFLECRIKPSTFKKNVCVHWYHQKPDRPLKRILYISSNENIVHEQGVSEERYEARKWQSDLSSSLRIHRVTKEDAGTYYCACW
Callithrix jacchus V112 trgv BBXK01091888.1 6644 HLEQPQISSTKTLSKTARLECVVYGGTISETSVYWYRERPGEAIQLLVDISSDGTVRMESGITSGKFEVDRISETSTSTLTIHNVEKKDIGTYYCAFWE
Callithrix jacchus V113 trgv BBXK01091889.1 11291 SQMSSNLEGRRKTVTRTTGSSAVITCDLPVENTRYIHWYRHQEGKAPQSLVYCDTYNSRVTLDSGISPGKYTHAITRRSSKLIVQNITENDSGVYYCAAWV
Callithrix jacchus V114 trgv BBXK01091889.1 7126 PIAASQMSSNFEGRTKSVTRTTRSSAVITCGLPVENTRYIHWYLHQGEKAPQRLLYYDTYNSILDSGISPGKYTYAIMRGSLKLREQNLIENDSGVYYCAAWD
Callithrix jacchus V115 trgv BBXK01091889.1 3123 SQMSSNFEGRTKLVTGRTGSSAVITCDLPVENTRYIHWYFHHEGKAPQRLLYCDTYQSKAVLDLGISPGKKDNYLILKGSWKLVLQNLIENDSGVYYCAAWD
Callithrix jacchus V116 trbv BBXK01094973.1 9066 SVFGAVVSQKPSRGICQRETSMTIQCHVDSQVTLMFWYHQLPGQSMTLIATANQGSEATYEKGFAKDKFPISRPNLTFLTLNVSNMSPEDSGIYFCSAG
Callithrix jacchus V117 trbv BBXK01094975.1 1431 LVEVKVTQNPRYLVKKMGEKVFLECVQDMDHGRMFWYRQDPGLGLRLIYFSYDIKNYEKGDVPDGYNVSREKKEQFSLILGSASTSQTSVYLCASSL
Callithrix jacchus V118 trbv BBXK01094976.1 19651 FKNAIVTQFPRHRIIGTGKEFILHCSQNMNHVAMFWYRQDPGFGLKLVYYSPGPGSIEKGDVSEGYHVFRNNMTHFPLTLKSASTNQTSVYLCASSS
Callithrix jacchus V119 trbv BBXK01094976.1 752 PLEAQVTQNPRYLITVTGKKLTVTCSQNMNHDYMSWYRQDPGLGLRQIDYSNNVDLVDKGDVPEGYSVSRKEKRNFPLIVESPGPHQTSLYLCASSL
Callithrix jacchus V120 trbv BBXK01094977.1 22368 SLDTKVTQRPRYVVTAKEQKAKMDCVPIKGHSYVYWYHKKLEEELKFLVYLQNGEIIQKSEVINERFLAQCPENSPCALEIQSTESKDEGLYFCASSE
Callithrix jacchus V121 trbv BBXK01094977.1 11880 PFHAKVTQTPGYLVKRKGQKTEMDCTPEKGHTFVYWYQQNQNKELTFLISFQNEQILEETEIHKKRFLSQCPRNSPCSLTILVSDPGDRALYLCASSQ
Callithrix jacchus V122 trbv BBXK01094977.1 988 SMDAGVTQTPRNRIAKTGKKITLECSQTRNDNQMYWYRQDPGLGLRLIYYSLGVQDINKGEISHGYSVSRQEQPKFSLSLESATSNHTALYFCATSY
Callithrix jacchus V123 trbv BBXK01094979.1 139505 LTETGVTQSPRYKITEKRQAVAFGCNPVSGHAGLYWYQQILGQGPKLLIQYQNKDVVDDSQLPKDRFSAERLKGVESTLKIQPAELGDSAVYLCASSL
Callithrix jacchus V124 trbv BBXK01094979.1 136048 CTDAGIIQSPKHEVTEMGQAVTLRCEPILGHNLLYWYRQTLVQGLELLSYFRSRSIIDDEQMPKDRFSAERPDGSFSTLKIQPAEQGDSAVYICASRL
Callithrix jacchus V125 trbv BBXK01094979.1 126180 SVTAGVTQTPKFQVLKTGQSTMLQCAQDMNHYYMYWYRQDPGMGLRLIHYSVDKGTTDKGEVPDGYNVSRSNREDFLLRLESAAPSQTSVYFCASSD
Callithrix jacchus V126 trbv BBXK01094979.1 112192 PVEAGVTQRPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQRPQFILEYDEEEERNRGNFPNRFSGYQFRDYSSELNVSTLEPGDLALYLCASSL
Callithrix jacchus V127 trbv BBXK01094979.1 100665 SVEAGVTQRPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQRPQFILEYDEEEERNRGNFPNRFSGYQFRDYSSELNVSTLEPGDSALYLCASSL
Callithrix jacchus V128 trbv BBXK01094979.1 90816 HAGAGVSQDPRHKVTKMGQNVTFRCDPISGHTRLYWYRQTLGQSLEFLTYFQNEAQSDKSGLPSDRFFAERTGGSFSTLTIKRTVQGDSAMYLCASSS
Callithrix jacchus V129 trbv BBXK01094979.1 83937 SVAAGVIQYPRHLIKEKRETATLKCYPIPGHDTVYWYQQGPGQGLQFLISYYENMQRDKGIIPDRIAARQFSDYHSELNMSSLELGDSALYLCASSL
Callithrix jacchus V130 trbv BBXK01094979.1 75308 HVDSRITQSPRLKVTETGTPVTLRCHQTENHRYMYWYRQDLGHGLRLIHYSYGVNDINKGEVPDGYSVFRSNTEDFPLTLESATSSQTSVYFCASSD
Callithrix jacchus V131 trbv BBXK01094979.1 57575 HTDAEVIQSPQHEVTEMGQEVTLRCEPISGHTQLFWYRQTMMRGLEFLIYFNNEDLIDDSGMPKDRFSAQMPNASFSTLKIQPSEPGDSAVYFCASSL
Callithrix jacchus V132 trbv BBXK01094979.1 42340 LTDARVTQTPRHKVTEMGQEVTMRCHPVFGHNTVFWYRQTVMQGLELLTYLRNRALLDDSGMPKDRFSAEMPTASLSTLKIQPSEARDSAVYLCASGL
Callithrix jacchus V133 trbv BBXK01094979.1 35380 HTAAGVTQFPSHRVIEKGQAVTLRCDPISGHESLFWYRRIMGKEIKFLIYFLRDSKQDESVMPSHRFSAERTGGTSSTLTVKSAELEDSGIYFCASSL
Callithrix jacchus V134 trbv BBXK01094979.1 30329 HGDAMVIQNPRYQLTQLGKPVTLSCFQNLNHDAMYWYQQKPSQAPKLLLYYYDKDLNNEADTPDNFQARRPNTSFCFLDIHSSVLGDAATYLCASSK
Callithrix jacchus V135 trbv BBXK01094979.1 25376 SPGEEVIQTPRHFVKGKGQKAILHCVPITGHGYVFWYQQVLKKEFKFLISFQNENVFDETGIPKKRFSAKCPQNSSCSLEIQATEPRDSVVYFCASSQ
Callithrix jacchus V136 trbv BBXK01094979.1 8709 LSNAGVTQNPRHLVRRKGQEARLTCSPVEGHSHVYWYQQLLGEGLKFMIYLQKESIIDESGMPKERFSAEFPKEGPSVLRIQQAERGDSAAYFCASSI
Callithrix jacchus V137 trbv BBXK01094979.1 5808 IMDGGITQSPKYLFRKEGQAVTLGCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVDAFQKGDITEGYSVSQEKKESFPLTVTSAQGNQTAFYLCASSI
Callithrix jacchus V138 trbv BBXK01094979.1 3250 GSGLGAVVSQHPSRVICKTGTSVKIECRALDFQATTMFWYHQSQKQGLMLMATSNEGSKATYEQGFSEDNFPISHPNLTFSSLTVASAHPEDSSFYLCSGR
Callithrix jacchus V139 trbv BBXK01094983.1 23196 PMQAKVTQSPMHLIQTRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFEYVNEFKRSEGNFPGRFSGYQFSDYHSEMNISTLELGDSALYLCASSL
Callithrix jacchus V140 trbv BBXK01094983.1 20155 PVDSGVTQTPKHLLTAIGQRVALRCSPRSGDLSVYWYRQSLDQSLQFLIQYYNGNEREKGNIPEGFSGQQFPNMSSELNLSSLELGDSALYFCASSI
Callithrix jacchus V141 trbv BBXK01094983.1 16043 HGDAEIIQSPRHKITETGRQVTLKCHQSWNHDYMYWYRQDLGQGLRLIHYSYGVEDINKGEVPDGYVVSRSDPEDFPLTLESALSSQTSVYFCASSD
Callithrix jacchus V142 trbv BBXK01094983.1 10062 LTEAGVVQVPRYKITEKRQAVAFWCDPVSGHAGLYWYRQILGQGPELLIQFLNEEVVDDSQLPKDRFSAERLEGVNSTLKIQPAELGDSAMYLCASSS
Callithrix jacchus V143 trbv BBXK01094983.1 2587 LTDAGVIQSPRHKVTQMGQSVTLRCEPISGHNDLLWYRQTLVQTLELLSYFRSRTLVDDSEMPQDRFSAEMPNASFSTLRIQPTEPKDSALYLCA
Callithrix jacchus V144 trbv BBXK01094984.1 75620 PSDSAVSQTPKYLVTQMGKKGSLKCEQNLGHDAMYWYKQDSKKLLKIMFIYNNKERILNETVPNRFSPESPDKAHLNLHIESLELGDSALYFCASS
Callithrix jacchus V145 trbv BBXK01094984.1 71576 PMDTGVTQTPKHLVMGMIDEKSLQCEQHLGHNVMYWYKQKAKKPPELMFIYNYEEISVNESVPSRFSPECPDSSHLYLHLHALQPEDSALYLCASSQ
Callithrix jacchus V146 trbv BBXK01094984.1 62406 LVEAEVTQTPRHLIKMRGQQVTLKCSPVSGHNSVYWYQQAPGQGPQFLFEYYNAIERQKGNFPDRFSGHQFSNSTSEMNVNALELGDSALYLCASSL
Callithrix jacchus V147 trbv BBXK01094984.1 44835 PSDSAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKERILNETVPNRFSPESPDKAHLNLHIESLELGDSAVYFCASSQ
Callithrix jacchus V148 trbv BBXK01094984.1 40986 PMDTGVTQTPKHLVMGMTNEKSLQCEQHLGHNVMYWYKQKAKKPPELMFIYILQERTENNSVPSRFSPECPDSSHLYLHLHALQPEDSALYLCASRQ
Callithrix jacchus V149 trbv BBXK01094984.1 35128 LGEAGVTQTPRHLIKMRGQQVTLRCSPISGHSSVYWYQQAPGQGPQFLFQYYNEIQNEKGNFPARFSGRQFSNYSSEMNVNALELGDSALYLCASSL
Callithrix jacchus V150 trbv BBXK01094984.1 25851 PVNAGVTQTPKFQVLRTGQSTTMECSQDMNHDRMYWYRQDPGMGLRLIHYSVGEGTTDKGEVHDGYNVSRSNTKDFPLRLEAASPSQTSVYFCASSD
Callithrix jacchus V151 trbv BBXK01094984.1 21510 HTGAGVSQSPSNKITEKGKDVALRCDPVSGHNALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSDRFFAERSGRSFSTLKIQRTEQKDSAVYLCASSL
Callithrix jacchus V152 trbv BBXK01094984.1 4883 HTDAGVSQSPSNKVIEKGNDVALRCDPISGHTALYWYRQSLGQGPEFLIYFQGKDIADDSGLPSDRFSAERSRGSASTLQIQRTEQADSAVYLCASSL
Callithrix jacchus V154 trbv BBXK01094985.1 3855 YTEPEVTQTPSHQVTWMGQEVILWCVPIPNHLNFFWYRQILGKKVEFLVYFYNDNISEKSEIFDDRFSVKRPDGSNFTLKIQSTKLEDSATYFCASSK
Callithrix jacchus V127 trbv ACFV01054660.1 59951 YTEPEVTQTPSHQVTWMGQEVILWCVPIPNHLNFFWYRQILGKKVEFLVYFYNDNISERSEIFDDRFSVKRPDGSNFTLKIQSTKLEDSATYFCASSE
Callithrix jacchus V128 trbv ACFV01054661.1 5254 PSDSAISQTPKYLVTQMGKKESLKCEQNLGHDTMYWYKQDSKKLLKIMFIYNNKERILNETVPNRFSPESPDKAHLNLHIESLELGDSALYFCASS
Callithrix jacchus V129 trbv ACFV01054661.1 9298 PMDTGVTQTPKHLVMGMTDEKSLQCEQHLGHNAMYWYKQKAKKPPELMFIYNYEEISVNESVPSRFSPECPDSSHLYLHLHALQPEDSALYLCASSQ
Callithrix jacchus V130 trbv ACFV01054662.1 612 LVEAEVTQTPRHLIKMRGQQVTLKCSPVSGHNSVYWYQQAPGQGPQFLFEYYNAIERQKGNFPDRFSGHQFSNSTSEMNVNALELGDSALYLCASSL
Callithrix jacchus V131 trbv ACFV01054662.1 6913 PVNAGVTQTPKFQVLKTGQSMTLQCSQDMNHDGMYWYRQDPGMGLRLIRYSVAEGTTDKGEVPDGYNVSRSNTKDFPLRMESAAPFQTSVYFCASSD
Callithrix jacchus V132 trbv ACFV01054662.1 18171 PSDSAVSQTPKYLVTQMGKKESLKCEQNLGHNAMYWYKQDSKKLLKIMFIYNNKERILNETVPNRFSPESPDKAHLNLHIESLELGDSAVYFCASSQ
Callithrix jacchus V133 trbv ACFV01054662.1 22020 PMDTGVTQTPKHLVMGMTNKKSLQCEQHLGHNAMYWYKQKAKKPPELMFIYILQERTENNSVPSRFSPECPDSSHLYLHLHALQPEDSALYLCASSQ
Callithrix jacchus V134 trbv ACFV01054662.1 27881 LGEAGVTQTPRHLIKMRGQQVILRCSPISGHSSVYWYQQAPGQGPQFLFQYYNEIQNEKGNFPARFSGRQFSNYSSEMNVNALELGDSALYLCASSL
Callithrix jacchus V135 trbv ACFV01054662.1 37158 PVNAGVTQTPKFQVLRTGQSTTMECSQDMNHDRMYWYRQDPGMGLRLIHYSVGEGTTDKGEVHDGYNVSRSNTKDFPLRLEAASPSQTSVYFCASSD
Callithrix jacchus V136 trbv ACFV01054662.1 41496 HTGAGVSQSPSNKITEKGKDVALRCDPVSGHNALYWYRQSLGKGLEFLIYFQGNDAPDKSGLPSDRFFAERSGRSFSTLKIQRTEQKDSAVYLCASSL
Callithrix jacchus V137 trbv ACFV01054663.1 11350 HTDAGVSQSPSNKVIEKGNDVALRCDPISGHTALYWYRQSLGQGPEFLIYFQGKDIADDSGLPSDRFSAERSRGSASTLQIQRTEQADSAVYLCASSL
Callithrix jacchus V138 trbv ACFV01054664.1 583 PMQAKVTRSPMHLIQTRGQQVTLRCSPISGHTSVSWYQQAPGQGPQFIFEYVNEFKRSEGNFPGRFSGYQFSDYHSEMNISTLELGDSALYLCASSL
Callithrix jacchus V139 trbv ACFV01054664.1 3624 PVDSGVTQTPKHLLTAIGQRVALRCSPRSGDLSVYWYRQSLDQSLQFLIQYYNGNEREKGNIPEGFSGQQFPNMSSELNLSSLELGDSALYFCASSI
Callithrix jacchus V140 trbv ACFV01054664.1 7737 HGDAEIIQSPRHKITETGRQVTLKCHQSWNHDYMYWYRQDLGQGLRLIHYSYGVEDINKGEVPDGYVVSRSNPEDFPLTLESALSSQTSVYFCASSD
Callithrix jacchus V141 trbv ACFV01054664.1 13723 LTEAGVVQVPRYKITEKRQAVAFWCDPVSGHAGLYWYRQILGQGPELLIQFLNEEVVDDSQLPKDRFSAERLEGVNSTLKIQPAELGDSAMYLCASSS
Callithrix jacchus V142 trbv ACFV01054664.1 21197 LTDAGVIQSPRHKVTQMGQSVTLRCEPISGHNDLLWYRQTLVQTLELLSYFRSRTLVDDSEMPQDRFSAEMPNASFSTLRIQPTEPKDSALYLCA
Callithrix jacchus V143 trbv ACFV01054667.1 939 HGDAEITQNPRHKITETGRQVTLKCHQTWNHNYMYWYRQDLGHGLRLIHYSVAADDTEKGEVFDGYVVSRSNLEDFSLTLESATHSQTSVYFCASSD
Callithrix jacchus V144 trbv ACFV01054668.1 1984 LTETGVTQSPRYKITEKRQAVAFGCNPVSGHAGLYWYQQILGQGPKLLIQYQNKDVVDDSQLPKDQFSAERLKGVESTLKIQPAELGDSAVYLCASSL
Callithrix jacchus V145 trbv ACFV01054668.1 5440 CTDAGIIQSPKHEVTEMGQAVTLRCEPILGHNLLYWYRQTLVQGLELLSYFRSRSIIDDEQMPKDRFSAERPDGSFSTLKIQPAEQGDSAVYICASRL
Callithrix jacchus V146 trbv ACFV01054668.1 15318 SVTAGVTQTPKFQVLKTGQSTMLQCAQDMNHYYMYWYRQDPGMGLRLIHYSVDKGTTDKGEVPDGYNVSRSNREDFLLRLESAAPSQTSVYFCASSD
Callithrix jacchus V147 trbv ACFV01054668.1 29308 PVEAGVTQRPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQRPQFILEYDEEEERNRGNFPNRFSGYQFRDYSSELNVSTLEPGDLALYLCASSL
Callithrix jacchus V148 trbv ACFV01054668.1 32751 HTGAGVSQSPRYKVTKRGQDIAFSCDPISGHETLYWYRQILEQSPEFLTYFRYEAQLDKSGLPSDRFSAERAGGSLSTLKIQRTEQQDSAVYLCASSS
Callithrix jacchus V149 trbv ACFV01054668.1 40836 SVEAGVTQRPTHLIKTRGQQVTLRCSPISGHTSVSWYQQALGQRPQFILEYDEEEERNRGNFPNRFSGYQFRDYSSELNVSTLEPGDSALYLCASSL
Callithrix jacchus V150 trbv ACFV01054668.1 50684 HAGAGVSQDPRHKVTKMGQNVTFRCDPISGHTRLYWYRQTLGQSLEFLTYFQNEAQSDKSGLPSDRFFAERTGGSFSTLTIKRTVQGDSAMYLCASSS
Callithrix jacchus V151 trbv ACFV01054668.1 57571 SVAAGVIQYPRHLIKEKRETATLKCYPIPGHDTVYWYQQGPGQGLQFLISYYEKMQRDKGIIPDRIAARQFSDYHSELNMSSLELGDSALYLCASSL
Callithrix jacchus V152 trbv ACFV01054668.1 83983 HTDAEVIQSPQHEVTEMGQEVTLRCEPISGHTQLFWYRQTMMRGLEFLIYFNNEDLIDDSGMPKDRFSAQMPNASFSTLKIQPSEPGDSAVYFCASSL
Callithrix jacchus V153 trbv ACFV01054669.1 9767 LTDARVTQTPRHKVTEMGQEVTMRCHPVFGHNTVFWYRQTVMQGLELLTYLRNRALLDDSGMPKDRFSAEMPTASLSTLKIQPSEARDSAVYLCASGL
Callithrix jacchus V154 trbv ACFV01054669.1 16728 HTAAGVTQFPSHRVIEKGQAVTLRCDPISGHESLFWYRRIMGKEIKFLIYFLRDSKQDESGMPSHRFSAERTGGTSSTLTVKSAELEDSGIYFCASSL
Callithrix jacchus V155 trbv ACFV01054669.1 21779 HGDAMVIQNPRYQLTQLGKPVTLSCFQNLNHDAMYWYQQKPSQAPKLLLYYYDKDLNNEADTPDNFQARRPNTSFCFLDIHSSVLGDAATYLCASSK
Callithrix jacchus V156 trbv ACFV01054669.1 26732 SPGEEVIQTPRHFVKGKGQKAILHCVPITGHGYVFWYQQVLKKEFKFLISFQNENVFDETGIPKKRFSAKCPQNSSCSLEIQATEPRDSVVYFCASSQ
Callithrix jacchus V157 trbv ACFV01054669.1 43410 LSNAGVTQNPRHLVRRKGQEARLTCSPVEGHNHVYWYQQLLGEGLKFMIYLQKESIIDESGMPKERFSAEFPKEGPSVLRIQQAERGDSAAYFCASSI
Callithrix jacchus V158 trbv ACFV01054669.1 46310 IMDGGITQSPKYLFRKEGQAVTLGCEQNVNHDAMYWYRQDPGQGLRLIYYSQIVDAFQKGDITEGYSVSQEKKESFPLTVTSAQGNQTAFYLCASSI
Callithrix jacchus V159 trbv ACFV01054669.1 48868 GSGLGAVVSQHPSRVICKTGTSVKIECRALDFQATTMFWYHQSQKQGLMLMATSNEGSKATYEQGFSEDNFPISHPNLTFSSLTVASAHPEDSSFYLCSGR
Callithrix jacchus V160 trbv ACFV01054671.1 1572 SLDTKVTQRPRYVVTAKEQKAKMDCVPIKGHSYVYWYHKKLEEELKFLVYLQNGEIIQKSEVINERFLAQCPKNSPCALEIQSTESKDEGLYFCASSE
Callithrix jacchus V161 trbv ACFV01054671.1 12066 PFHAKVTQTPGYLVKRKGQKTEMDCTPEKGHTFVYWYQQNQNKELTFLISFQNEQILEETEIHKKRFLSQCPRNSPCSLTILVSDPGDRALYLCASSQ
Callithrix jacchus V162 trbv ACFV01054671.1 22959 SMDAGVTQTPRNRIAKTGKKITLECSQTRNDNQMYWYRQDPGLGLRLIYYSLGVQDIKKGEISHGYSVSRQEQPKFSLSLESATSNHTALYFCATSY
Callithrix jacchus V163 trbv ACFV01054672.1 32551 FKNAIVTQFPRHRIIGTGKEFILHCSQNMNHVAMFWYRQDPGFGLKLVYYSPGPGSIEKGDVSEGYHVFRNNMTHFPLTLKSASTNQTSVYLCASSS
Callithrix jacchus V164 trbv ACFV01054672.1 51473 PFEAQVTQNPRYLITVTRKKLTVTCSQNMNHDYMSWYRQDPGLGLRQINYSNNVDLVDKGDVPEGYSVSRKEKRNFPLIVESPGPHQTSLYLCASSL
Callithrix jacchus V165 trbv ACFV01054674.1 895 LVEVKVTQNPRYLVKKMGEKVFLECVQDMDHERMFWYRQDPGLGLRLIYFSYDIKNYEKGDVPDGYNVSREKKEQFSLILGSASTSQTSVYLCASSL
Callithrix jacchus V166 trbv ACFV01054676.1 4074 SVFGAVVSQKPSRGICQRETSMTIQCHVDSQVTLMFWYCQLPGQSMTLIATANQGSEATYEKGFAKDKFPISRPNLTFSTLNVSNMSPEDSGIYFCSAG
Callithrix jacchus V383 ighv ACFV01145913.1 2262 AHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSHGISWLQQAPGQGLELIGWIHPNSGDTGYAQKSQGRVTMTRDTTTSIAYMELSSLRSEDTARYYCAR
Callithrix jacchus V424 igkv ACFV01157559.1 8936 TYGDIVMTQSPDSLALSLGERVTINCKSSQSLLSSSRNYLAWHQQKPGQAPKQIILWASTRVSGVPDRYSGSGSGTDFTLTISSLQAEDVAIYYCQQFHSAP
Callithrix jacchus V425 igkv ACFV01157562.1 10709 TGAETTLTQSPALVSVTPGDKVTISCKASQDIDNDIYWYQQKPGDAPIFIIQEATTLVSGIPPRFSGSGYGTDFTLTIDNIEPEDAAYYFCQQDDNFP
Callithrix jacchus V459 ighv ACFV01170040.1 4439 VHSQVQLVQSGPELKQPGASVKVSCKASGYTFTSYAINWVRQAPGQGLEWMGWINTYNGKPTYAQGFTGRFVFSTDTSVSTAYLQVSSLRSEDTAVYYCAR
Callithrix jacchus V460 ighv ACFV01170040.1 8018 VLSQVQLQESGPGLVKPSETLSLICAVSGYSISSGYWWSWIRQPPGKGLEWIGRIYRSGSTYYNPSLKSRATISADTSKNQFSLRLSSVTAADTAVYYCA
Callithrix jacchus V461 ighv ACFV01170042.1 5092 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWIRQAPGKGLEWVSAISTGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAG
Callithrix jacchus V462 ighv ACFV01170042.1 13470 AHSQEQLVQSGAEAKKPGASVKVSCKASGYSFTSYAISWVRQAPGQGLEWMGVIIPLVGVTNYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V463 ighv ACFV01170042.1 23318 AHSQVQLVQSSPQVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGRIYPSSSSTNYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V464 ighv ACFV01170048.1 5535 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMDWVRQAPGQGLEWMGDIDPEDGETSYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCA
Callithrix jacchus V465 ighv ACFV01170048.1 24308 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGMQWVRQAPEQGLEWMGWINTNTGGTSYAQKFQGRVTMTRDASTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V466 ighv ACFV01170050.1 16847 VLSQVQLQESGPGLVRPSETLSLTCAVSGYSISSGYWWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRATISADTSKNQFSLRLSSVTAADTAMYYCA
Callithrix jacchus V467 ighv ACFV01170052.1 6499 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVSVISTDGRTTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAG
Callithrix jacchus V468 ighv ACFV01170057.1 8888 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWVGLIRNKANGGTAEYAASVKGRFTISRDDSKNSRYLQMSGLKTEDTAVYYCTR
Callithrix jacchus V469 ighv ACFV01170061.1 8488 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMDWVRQAPGKGLEWVSYINYNGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V470 ighv ACFV01170061.1 15357 VQCEVRLVESGGGLVQPGGSLRLSCAASGFTFSDYYMEWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSGLKTEDTAVYYCT
Callithrix jacchus V483 trbv ACFV01174578.1 49198 ARSQTIHQWPATLVQPVGSLLSLECTVKGTSNPNLYWYRQSADRGLQLLFYSVSVDQIHSEVPQNLSASRPQDGQFILSSKKLLLSDSGFYLCAWS
Callithrix jacchus V487 ighv ACFV01177308.1 8647 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGNGLEWVSAISSGGGNIYYADSMKGRFTISGDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V488 ighv ACFV01177308.1 14716 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSIISYNGRNTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V489 ighv ACFV01177309.1 703 VCAEEQLVQSGAEVKRPGESLKISCRASGFTGNWISWVRQMPGKGLEWMGRIDIRDSETKYSPSFQGHITFSADKSSNTAHLQWSSLKASDAAMYYCAR
Callithrix jacchus V492 iglv ACFV01177967.1 583 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNYVSWYQQHPGSAPKLMIYDVSSRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Callithrix jacchus V493 iglv ACFV01177968.1 10553 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKYVHWYQQKPGQAPVLVIYDNSNRPSGISERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSGN
Callithrix jacchus V494 iglv ACFV01177968.1 16580 SVVSSELTQDPAVSVALGQPARITCQGESLRSYYPSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTY
Callithrix jacchus V495 iglv ACFV01177968.1 26417 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYDVSSRPSGVSNRFSGSKSGNTASLTISGLQAEDEVDYYCSSYAGS
Callithrix jacchus V501 ighv ACFV01180556.1 7032 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGLEWVSTISTGGSTYYADSVKGQFTISRDNAKNSLYLQMNSLRAEDTAVYYCGR
Callithrix jacchus V502 ighv ACFV01180556.1 15290 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYGMSWVRQAPGKGLEWVSYINSDDTAYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V503 iglv ACFV01181242.1 4850 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQADDEADYYCSSYSYTSS
Callithrix jacchus V504 iglv ACFV01181259.1 2075 CWAQSVLTQPPSVSGNPGQRITISCSGSSSNIGGYTVQWYQQLPGMAPKLLIYGNNQRPSGVSDRFSGSKSGTSASLAITGLQSADEADYYCQSYDSNLN
Callithrix jacchus V506 ighv ACFV01182453.1 5374 VQREVQLVESGGGLVQPGGSLRLSCAASGFTFSYYWMNWVRQAPGKGLEWVSYINYNGGSTYYADSVKGRFTISRDNVKNSLYLQMNSLRAEDTAVYYCTR
Callithrix jacchus V507 ighv ACFV01182453.1 11506 LVQPGGSLRLSCAASGFTFSSYAMSCVRQAPGKGLEWVSYIRYDGRTTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHSEGKSV
Callithrix jacchus V509 ighv ACFV01182565.1 9684 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSYISSGGGTIYYADSVKGRFTISRDNAKNSLYLQMNSLIAEDTAVYYCAR
Callithrix jacchus V511 ighv ACFV01183769.1 3072 AAGGVWGRLGPARGVPETLLCSLWIPFSDYGMDWVRQAPGKGLEWVAVIWYDGSQKYYADSVKGRVTISRDNSKNMLYLQMNSLRAEDTAMYYCA
Callithrix jacchus V512 ighv ACFV01184401.1 218 VQCELQLVESGGGLVQPGGCLKLSCAASGFTFSNYRMSWVRQAPGKGLEWVSYINSDGTAYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V513 ighv ACFV01185473.1 4603 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVSAINNDGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V515 iglv ACFV01185568.1 604 SNSQAVVTQEPSLTVSPGGTVTLTCASSTGAVTSSNYPYWFQQKPGQAPRTLIYNTNNKHSWTPARFSGSLLGGKAALTLSGAQPEDEAEYHCLLYYSNA
Callithrix jacchus V516 ighv ACFV01186205.1 1553 VQCEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYWMYWIRQAPGKGLEWVSAIRYDGGSTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKD
Callithrix jacchus V517 ighv ACFV01186495.1 476 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWIRQAPGKGLEWVSAIRYDGGSIYYADSVKGRFTISRDNAKNSLYLQMNSLRAENTSVYYCAKD
Callithrix jacchus V518 ighv ACFV01186496.1 1468 VQCEVQLVESGGGLVQPGGCLKLSCAASGFTFSNYLMSWVRQAPGKGLEWVSYINSDGTAYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V519 ighv ACFV01186774.1 1216 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSYIRYDGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V520 ighv ACFV01186774.1 7230 AHSQVQLVQSGPELKQPGASVKVSCKASGYTFTSYAIHWVRQAPGQGLEWMGWINTDTGKPTYAQGFTGRFVFSMDTSVSTAYIQVSSLKAEDTAVYYCAR
Callithrix jacchus V521 ighv ACFV01186876.1 428 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSVISTDGRTTYYADSVKGLFTISRDNAKNSLYLQMNSLKTEDTAVYYCAR
Callithrix jacchus V522 ighv ACFV01186876.1 6439 ALSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYNMHWARQAPGQGLQWKGWIYPGNGNTKYAQKFQGRVTITADKSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V523 iglv ACFV01186939.1 497 SEASYELTQPSSVSVSPGQTARITCSGDALPERYAYWYQQKPGQIPVLVIYKDSERPSGIPERFSGSSSGTTATLTISGAQEEDEADYYCQSVDSSGTY
Callithrix jacchus V525 ighv ACFV01187215.1 7008 VCAEEQLVQSGAEVKRPGESLKISCRASGFTGNWISWVRQMPGKGLEWMGRIDIRDSDTRYSPSFQGHITISADKSSNTAHLQWSSLKASDAGMYYCAR
Callithrix jacchus V526 ighv ACFV01187641.1 6539 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGLEWVSTISTGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V527 ighv ACFV01188494.1 2550 VCAEEQLVQSGAEVKRPGESLKISCRASGFTGNWISWVRQMPGKGLEWMGRIDIRDSETKYSPSFQGHITFSADKSSNTAHLQWSSLKASDAAMYYCAR
Callithrix jacchus V528 ighv ACFV01189995.1 2200 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMEWVRQAPGKGLEWVGFIRNKANGGTAEYAASVKGRFTISRDDSKNSLYLQMSGLKTEDTAVYYCT
Callithrix jacchus V529 ighv ACFV01191316.1 1434 VQCDVQLVESGGGLVQPGGFLRLSCAASGFTFSNYRMSWVRQAPGKGLEWVSYINSDSTAYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCT
Callithrix jacchus V530 ighv ACFV01192571.1 212 SHSQVQLVQSGAEVRKPGASVKVSCKASGYTFTSHGISWLQQAPGQGLELVGWIHPNSGDTGYAQKFQGRVTMTRDTSASTAYMELSSLRPEDMARYYCAR
Callithrix jacchus V531 ighv ACFV01195674.1 80 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSYIRYDGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V532 ighv ACFV01197083.1 1286 ALSEVQLQESGPGLVKPSQTLSLTCAISGDSVSSNTATWNWIRQSPGRGLEWLGRTYYRSKWYSEYAASLQSRITINPDTSKNQFSLQLTSVTLEDTAVYYCA
Callithrix jacchus V533 ighv ACFV01198906.1 1421 VQGEVQLVESGGGLVKPGGSMRLSCAASGFTFSNYGMHWVRQAPGKGLEWVSAIGTSGDTYYTDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V534 ighv ACFV01199853.1 1650 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMSWVRQAPGQGLEWMGGIIPIVGVTNYAQKFQDRVTMTADTSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V535 ighv ACFV01200365.1 1874 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSHNMHWVRQAPGKGLEWVSYIRYDGGSTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V536 ighv ACFV01201038.1 1793 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMQWVRQAPGQGLEWMGEINPSSGSTNYAQKFQGRVTMTRDTSTSTAYMELSSMRPEDTAVYYCA
Callithrix jacchus V620 trdv ACFV01031202.1 88103 VMSATELVPEHQTVTVSLGDPATLRCSMKGEAITNYYINWYRKTQGNTMTFIYREKDIYGPGFKDGFQGEIDTEKDQAVLKILAASETDEGSYYCASD
Callithrix jacchus V621 trdv ACFV01031203.1 13791 VSLDIILESDTKVLTVLAGEAASFRCSVTGGDLKNYQVSWYKKSEDNSLILVFKLSNRSNYNLGNNFMGKTDALKNQFMLDIQKATTKDVGTYYCASD
Callithrix jacchus V622 trav ACFV01031209.1 17371 GTNSNSVKQTDQVTISEGASVTMNCTYTSMGYPTLFWYVQYPNKPLQFLQEETMENSKNFGARNIKDKNSPIVKHSVWVSDSAMYYCLLRDTVLR
Callithrix jacchus V623 trav ACFV01031209.1 11745 VTAAKNEVQQSPQDLTVQEGEFVTINCSYSIGITTLQWLQQHPGGGIVSLFKLSSENKKHGRLTATINLQEKHSSLHITASQPRDSAIYICAV
Callithrix jacchus V624 trav ACFV01031213.1 19069 SGMSQVVAQSQPEMSVQEAETVTLNCTYDTSDSNYYLFWYKQSPSRQMILVIRQEAFKQQNATENRFSVNFQKAAKLFSLKISNAQLGDTAMYFCAYR
Callithrix jacchus V625 trav ACFV01031213.1 10026 FSIAQRVTQSESEMSVQEAETVTLSCTYDSSDSDYYLFWYKQSPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISGSQLGDTAMYFCAYR
Callithrix jacchus V626 trav ACFV01031215.1 22775 ISSQELEQSPQSLIIQEGENLTINCGSSKTLYALHWYKQKYGEGLIFLMMLQIGGEEKSHEKITAKLDEKKQQSSLHITASQPSHTGIYLCGAD
Callithrix jacchus V627 trav ACFV01031215.1 12102 VSGQQLNQSPQSMSIQEGEDVSMNCTSSSTFNPLLWYKQDAGEGPVLLITLYMGGELTRNGRLTAQFGITRKDSFLNISASVPDDVGTYFCAG
Callithrix jacchus V628 trav ACFV01031215.1 7360 VSSEDKVIQSPPSLVVHEEDSVTVNCSYEAANFQSLLWYKQEKKALTFLFMLTSSRIEKKSGSLSSMLDKKERFSILNITATKTRDSATYLCAVE
Callithrix jacchus V629 trdv ACFV01031220.1 1753 SSMSQKVIQSQPAISMQEGETMKLDCLYKTNIVYYISYWYKRPPSGEIISLIHQQTDAETNVTNGQYSVSLHKATKTIQLIISPSQPEDSATYFCCLR
Callithrix jacchus V630 trav ACFV01031222.1 19136 GSRAQSVTQFDGHITVSEGAPLKLRCNYSYIGTPYLFWYVQYPSQSLQLLLKDLTAATQVKGIKGFEAEFRKSETSFHLRKPSAHVSDTAVYFCVVS
Callithrix jacchus V631 trav ACFV01031222.1 2173 VNTQQLEQSPQFLSIQEGEDFTVYCNSSSVFTNLKWYRQDPGEGPVLLGTLVKSGEVKKQKRLIFQFGDARKDSSLHITAAQPGDTGLYLCAG
Callithrix jacchus V632 trav ACFV01031223.1 5167 TIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYIHWYRQIHSQGPQYIIHGLKNNETNEMASLVIAEDRKSSTLILPHATMRDAAVYYCIVRV
Callithrix jacchus V633 trav ACFV01031225.1 7817 ASSILNVEQSPQSLRVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPENLLVMTLNGDEKKKGRINVTLNTKEGYSYLYIKGSQPEDSATYLCAI
Callithrix jacchus V634 trdv ACFV01031226.1 5920 SSVAQKVTQAQLPITMPVGKAVTLNCLYETRQEFYYIFWYKQLPSRKIVFLIHQYATKQNAKHDRYSVNFQKARKSIDLTISALQLEDSATYLCALWE
Callithrix jacchus V635 trav ACFV01031228.1 17326 VSSKQEVTQIPAALNVPEGDSLVLNCSFTDRAIYSLQWFRQDPGKGLTSLLLIQSSQREQTSGRLTALLDKSSGHSTLYIAASQPGDSATYLCAV
Callithrix jacchus V636 trav ACFV01031228.1 1987 VRGIQVEQSPPDLILQEGANYTLRCNFSTSVNNVQWFRQNPWGQLINLFYIPSGTKQNGRLSATTVSMERYSLLHISSSHTTDSAIYFCAVVPQCSP
Callithrix jacchus V637 trav ACFV01031229.1 3908 MSGEDQVTQRHEALRLQEGDSSSINCSYTVSSFNGLLWYRQDPGKGLEFLFILYSAGEEKQKGRLKATLTKKESFLHITAPKPEDSATYLCAV
Callithrix jacchus V638 trav ACFV01031235.1 28654 GTTAQRVTQPEKTLSVFEGAPVQLKCNYSYSGNPDLFWYVHYPKQRLQLLLKHISRESVKGFTADLNKGETSFHLEKPFAQEEDSATYYCALS
Callithrix jacchus V639 trav ACFV01031235.1 20516 VNSQQGEEEPQTLSIQEGENATMNCSYKTSISSLQWYRQDSSRGLTQLVLIRSNEREKYSGRLRFTLDTSMKSSSLFIAAAQAADTAAYFCATE
Callithrix jacchus V640 trav ACFV01031235.1 14173 GTCGDSVTQTEGPVTLLEGAALTLNCTYQSSYSAFLFWYVQYLNKEPQLLLKSSENQETDSRGFQASHVKSDSSFHLEKSSVQLSDSAVYYCALR
Callithrix jacchus V641 trdv ACFV01031235.1 10960 SSMAQKVIQAQTEIYVVEKEDVTLDCLYKTSDTTYYLYWYKQPPTREMIFLIRQNSFNEQNEINGRYSWNFQRSTSSFNLTITASQVIDSAVYFCALSE
Callithrix jacchus V642 trav ACFV01031238.1 8691 VWSQQKEVEQNPGPLNVPEGAIASLSCTYSNRAFQYFMWYRQYSRKGPELLMFTYSSDKKEDGRFTAQLNKSSQYISLFIRDSQPSDSATYLCAV
Callithrix jacchus V643 trav ACFV01031241.1 3641 VWSQQKLEQNSGPLNVPEGVIASLNCTYSDRGSQSFYWYRQYSGKSPELLMSIYSNGDEEDGRFTAQLNRASQYVSLFIRDSQLSDSATYLCAV
Callithrix jacchus V644 trav ACFV01031242.1 9347 VNGENVEQRPSTLSVQVGDSSVINCTYSDSASNYFPWYKQELGKGPRLIIDIRSNVDKRKDRRMTVLLNKTAKHFSLHITDTQPGDSALYFCAAG
Callithrix jacchus V645 trav ACFV01031243.1 18579 VLSQQKEVEQDPGPFNVPEGTTVAFNCTYSNSASQSFFWYRQDPRKGPKLLMSVYSSGNEDGRFTAQLNRASRYVSLLIRDSQLSDSATYLCAV
Callithrix jacchus V646 trav ACFV01031243.1 12874 GTRAQSVTQLDGQVTVSEEAPVLLKCNYSSSVTVYLFWYVQYPNQGLQLLLKYVSGPTLVKGIKGFEAEIKKSESSFHLRKSSAHVSDAAEYFCAVS
Callithrix jacchus V647 trav ACFV01031243.1 9554 DARAQSVTQPDIHITVSEGASLELRCNYSYGATAYLFWYVQSPGQGLQLLLRYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVS
Callithrix jacchus V648 trav ACFV01031244.1 2183 GSGKNQVEQSPQSLVILEGKNCTLQCNYTVTPFNNLRWYKQDNGKGPITLMIMTFSENTKSNGRYAATLDANTKQSSLHITASQLSDSASYICVVR
Callithrix jacchus V649 trav ACFV01031245.1 19021 DARAQSVSQPDYHVILSEGASLELRCNYSYGGTVTLFWYVQNPGQDLQLLLKYYSGDTLVKGIKGFEAEFMKSRSSFNLRKPSVQWSDTAEYFCAVK
Callithrix jacchus V650 trav ACFV01031245.1 9796 GINGNSVVQTEGEVLLSEGDSLTVNCSYESTGYPSLFWYVQYPGKGPELLLKAMKGNDKGRSNKDFEAIYRTETTSFHLEKGSVQESDSAVYFCALS
Callithrix jacchus V651 trav ACFV01031248.1 2682 TWSLAKTTQPISMDSYEGQEVNISCSHDNIATSDYIFWYQQFPNQGPRLIIQGYKTNVANEVASLFIPAERKSSTLSLPRVALSDTAVYYCVVG
Callithrix jacchus V652 trav ACFV01031251.1 1571 GLRAQSVAQPEDRVTVAEGNPLTVKCTYSVSGTPYLFWYVQYPNQGLQFLLKHITGDNLVKGSYGFEADFNKSQTSFHLKKPSALVSDSALYFCAVR
Callithrix jacchus V653 trav ACFV01031254.1 60613 MRLVIGTAGQNIGQPTEVTAMEGAIVQINCTYQTTGFNGLSWYQQRDGKAPTFLSYNVLNGLEERGHFSSFLNRSKGYSYLLVKKLQMKDSASYLCAVR
Callithrix jacchus V773 trav ACFV01080449.1 1633 AHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Callithrix jacchus V793 trgv ACFV01091879.1 16156 SKVEQFQLSISTEIKKSIDIPCKVSSTNFETDVIHWYRQKPNQALEHLVYTALTKSSAGGSQGQRSNKLEARKNSQTSTSILTIKSIEKEDTAIYYCAAWE
Callithrix jacchus V794 trgv ACFV01091879.1 4817 ASGDNLITQLVTSITKKKGNTAFLECRIKPSTFKKNVCVHWYHQKPDRPLKRILYISSNENIVHEQGVSEERYEARKWQSDLSSSLRIHRVTKEDAGMYYCACW
Callithrix jacchus V795 trgv ACFV01091880.1 6665 HLEQPQISSTKTLSKTARLECVVYGGTISETSVYWYRERPGEAIQLLVDISSDGTVRMESGITSGKFEVDRISETSTSTLTIHNVEKKDIATYYCAFWE
Callithrix jacchus V796 trgv ACFV01091881.1 11295 SQMSSNLEGRRKTVTRTTGSSAVITCDLPVENTRYIHWYRHQEGKAPQSLVYCDTYNSRVTLDSGISPGKYTHAITRRSSKLIVQNITENDSGVYYCAAWV
Callithrix jacchus V797 trgv ACFV01091881.1 7130 PIAASQMSSNFEGRTKSVTRTTRSSAVITCGLPVENTRYIHWYLHQGEKAPQRLLYYDTYNSILDSGISPGKYTYAIMRGSLKLREQNLIENDSGVYYCAAWD
Callithrix jacchus V798 trgv ACFV01091881.1 3123 SQMSSNFEGRTKLVTGRTGSSAVITCDLPVENTRYIHWYFHHEGKAPQRLLYCDTYQSKAVLDLGISPGKKDNYLILKGSWKLVLQNLIENDSGVYYCAAWD
Callithrix jacchus V893 iglv ACFV01125718.1 22972 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNYVSWYQQHPGSAPKLMIYSVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSS
Callithrix jacchus V894 iglv ACFV01125718.1 9491 LCALPVLTQPPSASAALGASVKLTCTLSSEHSNYYIHWYQQRPGRCPQYIMRVNSDGSHSKGDGIPNRFSGSSSGADRYLTISNLQSEDEAEYHCGE
Callithrix jacchus V895 iglv ACFV01125719.1 20088 SATSYELTQPHSVSVAPGQTARITCGGNNIGRKNVYWYQQKPSQSPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDN
Callithrix jacchus V897 iglv ACFV01125719.1 12155 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYSSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSGNTASLTITGAQVEDEADYYCNSWDSSGTY
Callithrix jacchus V898 iglv ACFV01125721.1 14042 SEASYELTQPPSVSVSPGQTARITCSGDALPEKYAYWYQQKPGQIPVLVIYKDSERPSGIPERFSGSSSGTTATLTISGAQEEDEADYYCQSADSSGTY
Callithrix jacchus V899 iglv ACFV01125722.1 3566 SATSYELTQPHSVSVAPGQTARITCGGNNIGSKSVQWYQQKPSQAPVLVIYSDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSNH
Callithrix jacchus V900 iglv ACFV01125726.1 1422 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYPSWYQQKPGQAPVLVIYGDNNQPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTH
Callithrix jacchus V992 igkv ACFV01155152.1 2474 SSGDIVMTQTPLSLPITVGELASISCRSSQRLLHSNGNTYLYWYLQKPGQPPQLLIYKVSNRASGVPDGFSGSGSSTDFTLKISIVEAEDFGVYYCMNCLQ
Callithrix jacchus V993 igkv ACFV01155153.1 7815 SSGVIVMTQTPLSLTVTLGEPASISCRSSQSLLHSNGNTYLHWFLQKPGQSPQLLIYKVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDIGVYYCMQN
Callithrix jacchus V994 igkv ACFV01155154.1 24824 SRCDIQMTQSPSSLFASVGDRVTITCRASQDIRSNLAWYQQKPGKTPRLLIYAASSLQTGIPSRFSGSGSGTDYTLTISSLQSDDFATYYCQHGYSTP
Callithrix jacchus V995 igkv ACFV01155154.1 14346 ARCDIQMTQSPTFLSASVGDRVTITCRASQSIGSALAWHQQKPGKATRSLIYGTSSLQPGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQYSSYP
Callithrix jacchus V996 igkv ACFV01155155.1 7019 STGDIVMTQTPLSLPVTPGEPASISCRSSQSLLHSDGNTYLHWFLQKPGQSPQLLIYKVSSLASGVPDRFSGGGSGTDFTLKISRVEAGDVGVYYCMQSIQYP
Callithrix jacchus V997 igkv ACFV01155156.1 25558 ARCDIQMTQSPSFLSASVGDRVTITCRASQSISNELAWYQQKPGKAPVLLIYAASSLQTGVPSRFSGSGSGTDFTLTISSPQPEDVATYYCQQDYG
Callithrix jacchus V998 igkv ACFV01155156.1 15103 SSGDIVMTQTPLSLPVTLGESASISCRSSQSLFDSDYELTYLDWYLQKPGQSPQLLIYSVSNRASGVPDRFSGTGSGTDFTLKISRVEAEDVGVYYCMQSKELP
Callithrix jacchus V999 igkv ACFV01155159.1 47436 SSGDIVMTQTPLSLSITPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYWASNRFSGVPDRFSGSGSGTDFTLKISKVEAEDVGVYYCMQGIQYP
Callithrix jacchus V1000 igkv ACFV01155159.1 34694 TRCDIQMTQSPSSLSASVGDRVTITCRASQDIRGYLAWYQQKPGKTPRLLIYAASSLQTGIPSRFSGSRSGTDYTLTISSLQSEDVATYYCQQHYSTP
Callithrix jacchus V1012 igkv ACFV01157562.1 20766 SNGEIVLTQSPTSMAVSQGEKVTISCTASSSVSTSYLHWYQQKPGSPPRLLVYSTSSLASGVPARFSGSGSGTSYTLTISSMEADDAASYYCQQSSSYP
Callithrix jacchus V1013 igkv ACFV01157566.1 20920 ARCDIQMTQSPSSLTASVGGKVTITCQASQDISKWLAWYQQKPGTVLKPLIYEASKLQSGVPSRFSSSGSGADFTLTITSLQPEDAAIYYCQNYLGSS
Callithrix jacchus V1014 igkv ACFV01157566.1 7869 TTGQIVMTQSPATLSLSPKETATLSCRASQSVSSYLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYSSWP
Callithrix jacchus V1015 igkv ACFV01157569.1 1441 SRGDIVMTQSPAFFSGTPGEKVIITCRASQGISKYLHWYQQKPDQPPKLLIKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAAMYYCQQGNNW
Callithrix jacchus V1016 igkv ACFV01157572.1 5113 SSGDIVMTQTPLSLSITPGEPASISCRSSQSLLHSDGNTYLYWYLQKPGQSPQLLIYRASNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQA
Callithrix jacchus V1017 igkv ACFV01157583.1 2073 TTGEIVMTQSPATLSLSPGERATVSCRASQSVSSNLAWYQQKPGQAPRLLIYGASNRATDIPARFSGSRSGTDFTLTISSLEPEDFAVYYCQQYSSWP
Callithrix jacchus V1018 igkv ACFV01157590.1 4145 SRGEIVLTQSPAFLSVTPREKVTITCRASQGINNNLHWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTLTISSLEAEDAATYYCQQGNNW
Callithrix jacchus V1019 igkv ACFV01157591.1 12778 SSGDIVMTQTPLFLPVTPGEPASISCRSSQSLLHSNGNTYLNWFLQKPGQPPRRLIYKVSTRDPGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCLQGTQY
Callithrix jacchus V1020 igkv ACFV01157596.1 450 TRCDIQMTQSPSSLSASVGDRVTISCHASQSISNWLAWYQQKPGKVPKLLIYKASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDAATYYCQKHDSAP
Callithrix jacchus V1021 igkv ACFV01157598.1 22396 SSGDVVMTQTPLSLSVTPGEPASISCRSSQSLVYSNGNTYLSWFLQKPGQSPRLLIYEVSTWESGVPDRFSGSGTGTDYFTLKISRMETEDVGVYYCMQG
Callithrix jacchus V1022 igkv ACFV01157598.1 12040 SSGDIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGYTYLNWYLQKPGQSPQLLIYAASNRASGVPDRFSGSGSGTDFTLKISLVEAEDVGVYYCMQAIELP
Callithrix jacchus V1023 igkv ACFV01157599.1 13266 ARCDIQMIQSPSSLSASVGDRVTITCRASQGISSCLAWYQQKPGKAPKLLIYRASNLETGVPSRFSGSGSGTDFTLTISGLQPEDIATYYCQQYDNLP
Callithrix jacchus V1024 igkv ACFV01157603.1 847 ARCDIQMTQTPSSVSASVGDKVTITCRASQGISSWLAWYQQKPGKAPKLLIYRASNLGTGVPSRFSGSGSGTDFTLTISGLQPEDIATYYCQQYDNLP
Callithrix jacchus V1036 iglv ACFV01163649.1 31655 SEASYELTQPPSVSVSPGQTARITCSGDALPEIYAHWYQQKPGQIPVLVIYEDSKRPSGIPERFSGSSSGTTATLTISGAQAEDEADYYCQSADSSGTY
Callithrix jacchus V1037 iglv ACFV01163649.1 14192 SATSYELTQPHSVSVAPGQPARITCGGNNIGSKYVYWYQQKPGQAPVLVIYRDSNRPSGISERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDN
Callithrix jacchus V1038 iglv ACFV01163651.1 2349 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYEVSSRPSGVSNHFSGSKSGNTASLTISGLQAEDEADYYCSSYAGS
Callithrix jacchus V1039 iglv ACFV01163652.1 17890 SATSYELTQPHSVSVAPGQTARITCGGNDIGSKSVHWYQQKPGQAPVLVIYSDSNRPSGISERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDN
Callithrix jacchus V1040 iglv ACFV01163652.1 11808 SVVSSELTQDPAVSVALGQTARITCQGESLRSYYPSWYQQKPGQAPVLVIYGNNNRPSGIPDRFSGSSSENTASLTITGAQVEDEADYYCNSWDSSGTY
Callithrix jacchus V1041 iglv ACFV01163652.1 2464 SWAQSALTQPHSVSGTPGQSVTISCTGTSSDVGGYNAVSWYQQHPGSAPKLMIYEVSNRPSGVSNRFSGSKSGNMASLTISGLQADDEADYYCSSYAGS
Callithrix jacchus V1042 iglv ACFV01163666.1 6690 SWAQSVLTQPPSASGNPGQRVTISCSGSSSNIGSNYVNWYQQLPGKAPKLLIYSNSNRPSGVPDRFSGSKSGTSASLTITGLQPEDEADYYCEAWDNSLSA
Callithrix jacchus V1043 iglv ACFV01163667.1 30253 SWAQSVLTQPPSASGNPGQKVTISCSGRSSNIGSNYVSWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSATLGITGLRLEDEADYYCLAWDDSLKA
Callithrix jacchus V1044 iglv ACFV01163667.1 16213 CWAQSVLTQPPSVSGNPGQRITISCSGSSSNIGVYTVQWYQQLPGMPPKLLIYGNNQRPSGVSDRFSGSKSGTSASLAITGLQSVDEADYYCQSYDSNLN
Callithrix jacchus V1045 iglv ACFV01163667.1 2166 SLSQPVLTQPSFLSGSPGASARLTCTLRSDISVGSKTIFWYQQKSESAPRYLLYYNSDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCMI
Callithrix jacchus V1046 iglv ACFV01163668.1 1042 SLSQPVLTQPASLSATPGASARLTCTLRSDINVGSYTIYWYQQKPGSPPWYLLYYYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYYCMI
Callithrix jacchus V1086 ighv ACFV01176330.1 27849 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGLEWVSTIGTAGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1087 ighv ACFV01176330.1 21725 AAGRVWGRLGSARGGPLRLSCAASGFTFSDYRMYWVRQAPSKGLEWVANIKYDGGEKYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V1088 ighv ACFV01176330.1 5610 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMDWVRQAPGKGLEWVSYINYNGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1089 ighv ACFV01176335.1 4147 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFNDYWMYWVRQAPGKGLEWVSAIRYDGGSIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKD
Callithrix jacchus V1090 ighv ACFV01176337.1 1475 VLSQVTLKESGPALVKPTQTLRLTCTFSGFSLSTSGMGVIWIRQPPGKALEWLASIYWDDGKYYSPSLKSRLTISKDTSKNQVVLTMTNMDRVDTATYYCAGR
Callithrix jacchus V1096 ighv ACFV01178639.1 5611 VQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVSLISSGSGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1098 ighv ACFV01179742.1 7278 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWVSYISYDGGSTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1101 ighv ACFV01181665.1 4008 ALSEVQLQESGPGLVKPSQTLSLTCAISGDSVSSNTATWNWIRQSPGRGLEWLGRTYYRSKWYSEYAASLRSRVTINPDTSKNQFSLQLTSVTLEDTAVYYCA
Callithrix jacchus V1103 ighv ACFV01182247.1 11684 AHSQVQLVQSGPEVKKPGASVKVSCKASGYTFTSYIISWVRQAPGQGLQWMGWIYPGNGNTKYTQKFQGRVTMTADKSTSTAYMELSSLRHEDTAVYYCAR
Callithrix jacchus V1104 ighv ACFV01182247.1 1929 VQCEVQLVESGGGLAKPGGSLRLTCAASGFTFSDYWMSWVCQAPGKGLEWVGEINPDGGRTNYKDSVKGRFTISRDNAKNTLYLQMNSLKTEDTAIYYCTR
Callithrix jacchus V1105 ighv ACFV01182360.1 13985 VQCEVQLVESGGGLAKPGGSLRLTCAASGFTFSDYWMSWVRQAPGKGLEWVGEINPDGGRTNYKDFVKGRFTISRDNAKNTLYLQMNSLKTEDTAIYYCTR
Callithrix jacchus V1106 ighv ACFV01182360.1 5258 AHSQVQLVQSGAEVQKPGASVKVSCKASGYTFTSYTISWVRQAPGQGLEWMGWIYPGSGNTNYAQKFQGRVTMTADKSTSTAYIELSSLRSEDTAVYYCAR
Callithrix jacchus V1107 ighv ACFV01184680.1 8076 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSNFMHWVRQAPGQGLEWMGGIYLGNGNTNYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCVR
Callithrix jacchus V1108 ighv ACFV01184725.1 7832 VCAEVQLVQSGAEVKRPGESLKISCRASGYSFNSYWISWVRQMPGKGLEWMGRIYPGDSDTRYSPSFQGHVTISADKSSNTAHLQWSSLKASDAAMYYCAR
Callithrix jacchus V1109 ighv ACFV01184845.1 8409 AHSQVQLVQSGPEVKKPGASVNVSCKASGYTFTSYIISWVRQAPGQGLQWMGWIYPGNGNTKYTQKFQGRVTMTADKSTSTAYMELSSLRHEDTAVYYCAR
Callithrix jacchus V1111 ighv ACFV01184984.1 9291 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWIRQAPGKGLEWVSVISTGGSTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1112 ighv ACFV01184985.1 837 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWVSYISYDGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1116 ighv ACFV01186385.1 5735 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSYIRYDGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V1118 ighv ACFV01187225.1 1284 VCAEVQLVQSGAEVKRPGESVKISCRASGYSFNNHWMSWVRQMPGKGLEWMGMIYPGDSDTRYSPSFQGHVTISADKSSNTAYLQWSSLKASDAAMYYCAR
Callithrix jacchus V1119 ighv ACFV01187236.1 2201 VQCEVQLVESGGRLVQPGGSLRLSCAASGFTFSSYAMAWVRQAPGKGLEWVSAISSGGTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1120 ighv ACFV01187593.1 1724 VCAEVQLVQSGAEVKRPGESLKISCRASGYSFNSYWISWVRQMPRKGLEWMGMIDPGDSDTRYCPSFQGHVTISADKSSNTAHLQWSSLKASDTAMYYCAR
Callithrix jacchus V1121 ighv ACFV01188003.1 3841 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWVRQAPGKGLEWVSTIGTAGSTYYADSVKGRFTISRDNAKNLLYLQMNSLRAEDTAMYYCAR
Callithrix jacchus V1122 ighv ACFV01188385.1 2709 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQAPGKGLEWASYISYNGGSTNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCA
Callithrix jacchus V1124 ighv ACFV01189815.1 818 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMNWIRQAPGKGLEWVSAISTGGSTYYADSMKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAG
Callithrix jacchus V1126 iglv ACFV01191362.1 4381 SATSYELTQPHSVSVAPGQTARITCGGNNIGRKNVYWYQQKPSQSPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQVWDSSSDN
Callithrix jacchus V1127 ighv ACFV01191593.1 1094 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVPQAPGKGLEWVSYIRYDGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
Callithrix jacchus V1129 ighv ACFV01193748.1 1599 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGWIYPGNGNTKYAQQFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCA
Callithrix jacchus V1130 ighv ACFV01193886.1 5641 VQCEVQLVESGGGLVQPGGCLKLSCAASGFTFSNYLMSWVRQAPGKGLEWVSYINSDGTAYYADSVKGRFTISRDNAKNSLYLHMNNLRAEDTAVYYCT
Callithrix jacchus V1131 ighv ACFV01195169.1 3097 VCAEVQLVQSGAEVKRPGESLKISCRASGYSFNSYWISWVRQMPGKGLECMGRIYPGDSDTRYSPSFQGHVTISADKSSNTAHLQWSSLKASDAGMYYCAR
Callithrix jacchus V1132 ighv ACFV01195401.1 1277 AHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMQWVRQAPGQGLEWMAEINPSSGSTNYAQKFQGRVTMTRDTSTSTAYMELSILRPEDTAVYYCAR
Callithrix jacchus V1133 trbv ACFV01195459.1 635 PMDTGVTQTPKHLVMGMTDEKSLQCEQHLGHNVMYWYKQKAKKPPELMFIYNYKEISVNESVPSRFSPECPDSSHLYLHLHALQPEDSALYLCASRQ
Callithrix jacchus V1134 ighv ACFV01197231.1 2815 AHSQEQLVQSGAEVKKPGASVKVSCKASGYSFTSYAISWVRQAPGQGLEWMGVIIPIVGVTNYAQKFQDRVTMTADTSTSTAYMELSSLRPEDTAVYYCAR
Callithrix jacchus V1135 trav ACFV01197305.1 429 GTRAQSVTQLDGQVTVSEEAPVLLKCSYSSSVSVVYLFWYVRYPNQGLQLLLKYLSGPTLVKGIKGFEAEFKKSESSFHLRKSSAHVSDAAEYFCAVS
Callithrix jacchus V1136 ighv ACFV01200385.1 1192 AHSQVQLVQSGAEVQKPGASVKVSCKASGYTFTSYIISWVRQAPGQGLEWMGWIYPGSGNTIYAQKFQGRVTMTADKSTSTAYIELSSLRSEDTAVYYCAR
Callithrix jacchus V1137 ighv ACFV01201075.1 1829 AHSQVQLVQFGAEVKKPGASVKVSCKASGYTFTSYTMHWVRQTPGQGLEWMGGIYPGNGNTNYAQKFQGRVTMTADTSTSTAYMELSSLRPEDTAVYYCA