WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Camelus ferus AGVR00000000.1 (AGVR01) 106 6 30 9 30 20 3 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Camelus ferus V712 trav AGVR01042120.1 2013 IVIEAEIDQPKSKDFAEGEDVNLPCNHSTVGGNDYIHWYRQRPSQSPQYIIHGFRDTVTNNMASLTIATDRKSSSLVLPRVALRDSAVYYCALTE
Camelus ferus V713 trav AGVR01042122.1 21739 VNGQQLKQIPEFVPLQEGENFTAYCNTSSPLDSLQWYKQQPGGCPVFLMLLTKGGDVKRQGRLTARFGETRKDSFLHIPAAQTADVGTYFCAG
Camelus ferus V31 trav AGVR01006489.1 14412 AHSQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Camelus ferus V42 trdv AGVR01008252.1 80702 KSVLSAKVTQTSRDQTVASGSEVTLPCTFETEYSDPDLYWYRMRPGLSLEFVLYRDNTESLNADFAQGRFSVQHNVAQKTFHLVMSSVRAEDSATYYCVLEY
Camelus ferus V155 igkv AGVR01027537.1 34990 SSGEVVLTQTPGPLSVTPGEPASISCKASQSLVHSDGKTYLYWLLQKPGQPPQRLIYQVSNRGSGVPDRFTGSGSGTDFTLKISGVKAEDAGVYYCAQA
Camelus ferus V156 igkv AGVR01027537.1 49360 CWGQIALTQFPESLAASHGSLVSITCRSSIEVGTSMAWYQQKPKEAPRLLIFGASARASGTPSRFRGSGSGSDFSLAIHGVEAEDVGVYYCQ
Camelus ferus V157 igkv AGVR01027537.1 53748 ARCATQVTQSPSSLSASLGDTVTITCQASQSISSYLAWYQQKPGQVPKLLIYDASSLYTGVPSRFSGSGSGTSFTLTISGVEAEDVGTYYCQQYNSAP
Camelus ferus V158 igkv AGVR01027539.1 5018 SSGATVLTQSPALLSKAPGDKATITCRASQSVSNYLRWYKQKPNQPPKLLIQYTSQTISGVPARFIGSGSGTDFTLTISSLEAEDAAKYYCQQSYSSS
Camelus ferus V159 igkv AGVR01027539.1 9757 ASGSAVLTQTPAILSVSLRESISITCTANESVSDYVSWYQQKPGQAPRLLIYDADDRYPGVPDRFVGLQSGTQFILTINKVEADDAASYYCQQG
Camelus ferus V160 igkv AGVR01027539.1 18262 ARCATQMTQSPSSLSASLGDTVTITCQASQSISSYLAWHQQKPGQAPKLLIYGASSLHTGFPSRFSGSGSGTSFTLTISGVEAEDVGTYYCLQHNSYP
Camelus ferus V161 igkv AGVR01027540.1 14812 TRAETVLTQSPALVSATPGDKVTLTCKASQDIDDDIMWYQQKPGQAPRLIIKYVSTLISGVPSRFSGSGYGTDFNLTIDNMKSEDAAYYFCQQDDN
Camelus ferus V176 iglv AGVR01030273.1 7101 SLSQPVLTQPSSLSVSLGASARLTCTLSSGFKVGDFWIRWHQQKPGNPPRYLLTFHSDSDKHQGSGVPSRFSGSSDASANAGLLLISGLQPEDEADYYCAT
Camelus ferus V177 iglv AGVR01030273.1 18094 SWAQSVLTQPPSMSGSLGQRGTISCTGSSSNIGGGYGVQWFQQLPGTAPKLLIYGNSNRASGVPDRFSGSKSGSSASLTITGFQADDEADYYCGRYDNSLSG
Camelus ferus V178 iglv AGVR01030273.1 29558 VNSQTVVTQEPSMSVSPGGTVTLTCGLSSGSVTTSNYPGWIQQTPGQAPSTLIYRTSNRLSGVPSRFSGSISGNKAALTITGAQPEDEADYYCAVYMGSGS
Camelus ferus V179 iglv AGVR01030273.1 36719 SWAPSVLTQPPSVSGSPGQRATISCTGSSSNIGRGNYVEWYQQLPGKAPKLLIYDVNNRASGVPNRFSGSKSGNSVSLTITGLQAEDKADYYCEDWGNSLNG
Camelus ferus V180 iglv AGVR01030273.1 42103 VDSQTVVIQNSSLTLSPGETVTLTCGPSSGSVTTSNYPSWYQQTPGQAPQVLPIAEAAEGPQSGVPSRLSGSISGIKATLTNTEALPKDKADYYCALYPGS
Camelus ferus V181 iglv AGVR01030274.1 7610 VDSPTVVTQEPSLSVSPGWTVTLTCGLSSGSVTTSNDPGWIQQTPGQVPRTLIYRTSSHLSGVPSRFFRSISGNKAALTIMGAQPKDEADYYCALDMGSGS
Camelus ferus V182 iglv AGVR01030276.1 4737 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQTPGQAPRALIYNTNSRPSGVPSRFSGSISGKKAALTITGAQPEDEAEYYCALYMGSGS
Camelus ferus V183 iglv AGVR01030277.1 9937 SLSQPVLSQPPSASASLGTSAKLTCTLSSGYSSYSVDWYQQVPGKSPRFLMRVGTSGVGSKGGGVSDHFSGSGSGLERYLTIQNIQEEDEAEYICGADYGSYM
Camelus ferus V195 trgv AGVR01031390.1 37840 GLALSKVEQSQVSVSTEVRKSIEINCKIESRDFESETVYWYRQKRKQALEHLIFVISTTTTARNLIDGKNNKVEARKNSQKLTSTLTVNFIEKEDTGIYYCAGWY
Camelus ferus V196 trgv AGVR01031390.1 43303 GLMLPQLEQPEVSVTGVRDKSVLLSCKVPSDSFDKDYIHWYQQKPDQGLKQLMYVLTASALGDLGGKKNKLEARKYASISTSTLKISFLKKEDEATYYCALWIS
Camelus ferus V197 trgv AGVR01031392.1 7317 YQEEVRLVQPALVMARTRGSTTLPCRTYGSVTYVHWYRQLEGRAPERLLYLALSKRDVQWDSVLRGDKVNAQVNNDGRSCFLSLMKLEKADEGTYYCAAWD
Camelus ferus V201 trbv AGVR01031489.1 7875 ALDTGVFQMPKYLITQMGNKMSLKCEQKLGYDSMYWYKQGSKQLLKIMFIYNNKELILNETVPSRFSPESTDKAHLNLHVDSLEPDDSAMYFCASS
Camelus ferus V202 trbv AGVR01031489.1 17122 PVDSGVTQTPRHLIKARGQQVTLSCSPISGHTSVSWYQQAPSEGPQFLFEFYEKMQRAKGNFPDRFSGQQFDNYSSELIVNFLEVTDSALYFCASSL
Camelus ferus V203 trbv AGVR01031489.1 20639 QVDSEVTQTPKYLIKPRKQQVTLRCSPVSGHLSVYWYQQALGQGPQFLIQYYRQKETERGNISRRFSGQQFDNSSSELNVSSLELTDSALYLCASSR
Camelus ferus V204 trbv AGVR01031489.1 24518 PVNAGVIQTPKFQVLKMGQGVTLKCAQDLKHNYMYWYRQDPGHGLRLIHYSAGSGTTDKGDIPDGYSVSRSDVENFTLILESATLNQTSVYLCASKLE
Camelus ferus V205 trbv AGVR01031489.1 30093 PTEAEITQTPRYRIVSTGHKTVLECSQHMNHFGMFWYRQDPGQGPRLIHYSNDIGSTAEGEVTEGYRVSRPEKAHFPLTLESASTNQTSLYLCASSV
Camelus ferus V206 trbv AGVR01031490.1 457 PLEAGVTQTPRHLIKTTGQMVTLRCSPISGHLGISWYQQAWSQGPQLLFEFYERRQTAKGNFPDRFLAQQFGDSRSELNVSSLQLSDSALYLCASSL
Camelus ferus V207 trbv AGVR01031490.1 7465 SVSTGHTKAGVSQSPRHRVTGRGQNVTLRCDPVSDHNRLYWYRQMLGQGLEILTYFQDDDALDKSGMPDARFSAERPQGLSSTLKIQRVEPGDSAEYLCASSL
Camelus ferus V208 trbv AGVR01031490.1 15619 QVEAGITQSPRYKIAVIGETLTLQCHQTDNHDYMYWYRQDLGHGLKLIYYTYDVNKTDKGEIPDGYSVSRSNIGDFPLTLESVVPSRTSAYLCASSN
Camelus ferus V209 trbv AGVR01031490.1 20954 LTEGGVAQSPRHKITEERQAVALWCDPISGHSFLYWYRQTLEQDLELLILFEETAGINVLQSPKNRFSAERPSGANSTLKIQSAELGDSAVYLCASSL
Camelus ferus V210 trbv AGVR01031490.1 37260 PTDAGVTQTPRHQVAGMGQAVTLGCEPASGHAALFWYRQTSEQGLALLIYFNNQDPVDDTGMPKDRFLATMTNKSFSTLNIQPAEPRDSATYLCASSM
Camelus ferus V211 trbv AGVR01031490.1 40591 HLLAGVAQFPSHRVIEKKQAVSVRCDPVSGHEYLVWYQHAMGREMKFLMSFLRDTVRDASGMLKDRFSAERTEGTYSTLKVHPAEPEDSGVYFCASSL
Camelus ferus V212 trbv AGVR01031490.1 42711 PVGAMVNQTPRYWVTGTGKPVTLNCSQTLNHDTMYWYQQKPSQAPKQLLYYYNTQLNRETDTSDNFQSRQFNTSSCSLDIRSAGVGDSAVYLCASSR
Camelus ferus V213 trbv AGVR01031490.1 61671 TVDGGITQTPKYVLKEEGRDVTLECEQDFNYDTMYWYRQDPGQRPRLIYFSLSAKDVQKGDMAEGYSASREKKPLFPLTVTLTQKNQTAVYLCASSI
Camelus ferus V214 trbv AGVR01031490.1 76505 SVDTGVTQSPGHLVRGKEQRAKMHCVPIKGHTLVFWYRKKLEEAFEFLVYLRNEDIVDKIAGFEQRYSAKCPKNSPCSLEINSTQAGDSARYFCASSE
Camelus ferus V215 trbv AGVR01031490.1 91995 SMDTGVTQTPRNRITNTGNSVLLECFQTKGHNYMYWYRQDPGLGLRLIYSSYNVNDTNKGELSNGYRVSRAEKAKFFLFLETPVPNQTALYFCASSY
Camelus ferus V216 trbv AGVR01031490.1 97172 LTNADVNQTPRYAVIGTGKKITLECNQAMDHESMYWYRQDPGMEPQLIHYSHGVNTTEKGDRPSESTVSRIRKDQFPLTLEATSPSQTSRYFCASSE
Camelus ferus V217 trbv AGVR01031490.1 103378 LKEAAVTQSPRHRILKTEQKLTLQCSQRMNHYSMYWYRQDPGFGLRLIYYSTGTRTTKQGDVPEGYHVSREDQADFPLTLQSASTNQTSVYFCASSESKR
Camelus ferus V218 trbv AGVR01031490.1 108888 PVEPDVTQSPTHRITETRKKLTVTCSQNMNHEAMYWYRQDPGLGLRLIYFSRNVNFTEKGDIPDGYTVSRKEKKDFSLTLESASITQTSLYLCASSV
Camelus ferus V219 trbv AGVR01031491.1 5119 SAFGALVSQKPSRAICQHGVSMMIQCEADSQVISMYWYRQRPGQSLSLIATANQGSQATYESGFAKEKFPISRPSLNFSVLTVSSVSPEDSSSYFCSA
Camelus ferus V312 trav AGVR01043681.1 48009 TVGQGVQQPTDLMAMEGEFVQVNCTYQTSRFDGLSWYQQHDGRAPVFLSYNVLDGWERRGRFSSFLSRSDAHSYLLLKELRTEDSASYLCAVI
Camelus ferus V313 trav AGVR01043681.1 100011 TLSLAKTIQPVFIDSYEGQEVNIPCNHTNIATSEYIFWYRQFPNQGPQFVIQGYKTNAANEVASLFIPTDRKSSTLSLPWATLRDTAVYYCIVS
Camelus ferus V314 trav AGVR01043681.1 106132 GAGAQSVTQPDRHGITVPEGARLELRCNYSSSYPPSLFWYVWYPNQGLQLLLKYTSGNNLVSGIKGFVAEFRRNETSFHLKKTSAHWSDSAEYFCAVG
Camelus ferus V315 trav AGVR01043681.1 111266 GSNEDSVSQTEGQVTPSEGDSLIVNCSYETTQYPALFWYVQYPGEGPQLLLKASRDNEMASNKGFKATHHRKPNSFHLEKASVQGADSAVYYCALG
Camelus ferus V316 trav AGVR01043681.1 116467 QTVTQPDDHVLISEKASLELRCNYSYGASVYLFWYVQYPCQGLQVLLKYFSGDPLVQGIKSFEAEFKRSESSFNLRKSSVHWSDSAEYFCAVS
Camelus ferus V317 trav AGVR01043681.1 126546 GVRGMNVEQSPSALSIQEGTSSTLQCNFSNPVNYVQWFRQNPGGGLINLFYITLGMKQNGRLNSTLNSKERYSTLHITASQLEDSATYLCAAE
Camelus ferus V318 trav AGVR01043681.1 133391 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSASSYFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus ferus V319 trav AGVR01043681.1 139817 CSIAQKVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAITFLISQDSYNQQNATEGRYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus ferus V320 trav AGVR01043681.1 146273 RTHGDSVMQTEGPVTLSETAALTINCSYSTTTYPTLFWYVQYSGEGPQLLLKASRDKEKVLKKGFEATHHREQTSFHLEKASVRGADSAVYYCALT
Camelus ferus V321 trav AGVR01043681.1 153539 VSRGENVEQSPPSLSVQEGNSSVITCTYTDSRSDFFPWYKQEPGKGLRFLISIRSNKVKEEDQGLTVLLNKTAKHLSLHITATQAGDAAVYFCAAS
Camelus ferus V327 ighv AGVR01045310.1 3821 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVCQAPGKGLEWVSSIYSYGSNTYYADSVKGRFTISRDNAKNMLYLQMNSLKSEDTAVYYCAA
Camelus ferus V328 ighv AGVR01045310.1 9406 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMYWVCQAPGKGLEWVSSIYSYGSNTYYADSVKGRFTISRDNAKNMLYLQMNSLKSEDTAVYYCAA
Camelus ferus V329 ighv AGVR01045310.1 14151 VHAQVQLEQPVAELKMPGEALRISCKTSGYSFTSYWIGWVRQMPGKGLEWMGAIYPGDSDTRYSPSFQGHITISADKSTSTAYLQWSSLKSTDSAVYYCAK
Camelus ferus V403 iglv AGVR01054889.1 2857 TVAQARLTQPQSVTASPGQTATLTCMGDSHSVGNEGAAWLQQHPGQAPRLLTLRNNQRPSGVSERFSGSRSGSMASLSISGLQAEDEADYYCSAWDSSLSA
Camelus ferus V404 trav AGVR01054975.1 1637 RTRGDSVTQTEGPVTLPESAALTMNCNYSAAGYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALG
Camelus ferus V405 trav AGVR01054975.1 18984 SSIAQTVTQEQPPMLVQEKEAVTLDCTYDTSDPTYSLSWYKQPSSGAITFLIRQDSYNQQNATEGHYSLNFQKASKSIKLVISASQLEDSAVYFCALSE
Camelus ferus V406 trav AGVR01054975.1 25322 RTRGDSVTQTEGPVTLPESAALTMNCNYSTTTYPTLFWYVQYPGEGPQLLLKASRDKEKVLKKGFEATYHREQTSFHLEKASVRGADSAVYYCALG
Camelus ferus V407 trav AGVR01054975.1 35444 MRSRQKGAAQSLNVPEGATASLTCSYSVSDSQNFMWYRQYSGRGPEWLMTFYPNNDKQEGRYTAQVNKSSRYVSLLIRDSQPSDSAAYLCAES
Camelus ferus V408 trav AGVR01054975.1 53851 GTSGDTVTQTEDPVILPEGAFLTLNCTYETSYSAFLFWYVQYLNKEPELLLKSSSENQKVVRGGFQATLVKSSRTFHLQKPSVQTSDSAVYYCALR
Camelus ferus V409 trav AGVR01054975.1 59461 GTSGDSVTQTEVPVTLSERELLMLNCTYQTTDSDPYLFWYVQYVNKAPQLLLKGSTANPRPEHQGFQATLVKSNRTFHLQKPSVQMSDSAVYYCALR
Camelus ferus V410 trav AGVR01054975.1 65133 GTSGDSVTQTEVPVTLPEEALLILNCTYQSTGSDPYLLWYVQYVNRAPQLLLKGSAANPRPEHQGFQATLVKSNRTFHLQKPSVQTSDSAVYYCALR
Camelus ferus V411 trav AGVR01054975.1 70787 SVKAQKVTQDQPAISRPEEEAATLDCVYEAKGYSYYLLWYKQAASGEMLFLIHQESYNERNTTEGRYFLNFQKSASSISLTITALELGDSAVYFCALN
Camelus ferus V412 trav AGVR01054975.1 77375 GAAAQSVTQPDRHGITVPEGARLELRCNYSSSYQPTLFWYVQYPNQGLQLLLKYTSGNGLVSGIKGFEAEFRRNETSFHLKKTSAHWSDSAEYFCALS
Camelus ferus V419 trdv AGVR01058958.1 1084 SAVAQTVTQDQPAVSSHVGETATLNCQYETSYSTYYIFWYKQPPSGEMTFLIRQEYNRGNAKSGRYSVNFRKAEKSLSLTISNLQLEDSAKYFCALDE
Camelus ferus V420 iglv AGVR01059116.1 472 VNSQTVVTQEPSLSVSPGGTVTLTCGLSTGSVTSSNYPSWYQQTPGQSPQLLIYKTNSRHSGVPNRFSGSISGNKAALTITGAQPEDEDDYYCALYMGSGS
Camelus ferus V438 iglv AGVR01000328.1 48031 SWAQSALTQPPSVSETLGKMVTISCVGTSSDTGGYNYISWYQQLPGTAPKLLIYEVNKRASGIPDRFSGSRSGNTASLTISGLQSEDEADYFCASYTTS
Camelus ferus V439 iglv AGVR01000328.1 34453 YVAPSALTQPSTVSVSLGQTAKITCQGGSLRSYYAHWYQQKPGLAPVLVIYKDSNRPSGIPERFSGSRSGGTATLTISRTQAEDEADYYCLSADSSDYN
Camelus ferus V440 iglv AGVR01000328.1 29796 SVASYELTQSPSVSVALRQTAKITCGGDNIGSKSVHWYQQKPGQAPVLVIYADNSRPSGIPERFSGSNSGNTATLTISGAQAEDEADYYCQVWDSSSAN
Camelus ferus V441 iglv AGVR01000328.1 25898 SVASSALTQPSTVSVSLGQTARITCQGGNFGSSYAFWYQQKPGQAPVMVIYRDSNRPSGIPERFSGSSSGDTATLNISGAQAEDEANYYCHSADSSGN
Camelus ferus V442 iglv AGVR01000328.1 13503 SWAQSALTQPPSVSRTPGQTVTISCAATSNDVGRYNYVSWYQQLPGTAPKLLIYEDTSRASGIPDRFSGSKSGNTASLTISGLQSEDEADYFCASYTTS
Camelus ferus V443 iglv AGVR01000328.1 7529 SWAQSALTQPSSVSGTPGQTVTISCAGTSSDVGYGNYVSWYQQLPGTAPKLLIYQVNKRASGIADRFSGSKSGNTASMTISGLQSANKADYYCASYRSSNN
Camelus ferus V444 iglv AGVR01000328.1 2756 SVASSSALTQPSTVSVSLGQTARITCKVDSLGSYAAQWYQQKPGQAPVLVIYGNSNRPSGIPERFSGSKSGGTATLTISGAQAEDEADYYCQSGSSNAN
Camelus ferus V478 trdv AGVR01008253.1 50410 IMSADVLVPQDAAVTVSVGGSVTLRCSMKGGPISDYYNYWYRKIPGSTMTFVFREGGTYGPGFQENFRGEVDQVNNQVLLEILKASEGDKGSYYCAAT
Camelus ferus V479 trdv AGVR01008254.1 162796 SGVAQTVTQDQPAVSSHVGETATLNCRYETSWSYYYIVWYKQPPSGEMTFLIHQDSSSGNAKSGRYSINFRKAEKSLSLTISNLQLEDSAKYFCALWE
Camelus ferus V480 trav AGVR01008254.1 143378 LRVQMKVEQSPGVLTLQEGENSSLTCNFSVSLTSLQWFQQKPDGRLISLFYIASGMKQNGRLTATVNIRESYSHLHIRDSQPGDSATYFCAVE
Camelus ferus V481 trdv AGVR01008254.1 134706 SGMAAKVTQTQTTETAQEGQAVTMHCTYETTAQRYTLYWYKQGPSGRMAFLIYQDDNKANAKRDRYSVNFQKAKQSISLTISSSQLADSGKYFCALWR
Camelus ferus V482 trav AGVR01008254.1 126934 VSSDDKVIQSPPSLVVHEGTSATLNCSYKVTNFQSLYWYKQEEKGLAFLFVLISTGIEKKSGRLRGTLDKKELLRTLHITATEPEDSATYLCAVE
Camelus ferus V483 trav AGVR01008254.1 122003 PGRADWIRPQETEVSGTEGKTVSLLCNYDTSSMGPVDLYWFRQYPNQAPEYILHRGWRHSGKGYASFATERFYSENTANTTSLYIRRVVLADAALYHCALNSE
Camelus ferus V484 trdv AGVR01008254.1 103415 ASVAQMVTQPQPEVSVREAQTATLDCTYNTVQSDYYLFWYKQPPSGEMIFIIHQEAYKQQNATANRYSVNFQKAAKSFSLRISDSQLEDAAMYFCA
Camelus ferus V485 trav AGVR01008254.1 76324 GTSGNSVQQTSQVTVSEGTSVTMNCTYTSAGYPTLFWYVQYPNKALRFLQEETMKNSKNFGARNIKDKSSPITIYPAQIADSAVYYCLLRLTVPR
Camelus ferus V486 trav AGVR01008254.1 72365 ISGENEVEQSPPYLSAQEGDFVTVNCSYSVVMTTLQWLQQKPGGGIESLFILSLEMKKEGRVSATINRKERHGSLHITATQPRDSAVYICAV
Camelus ferus V487 trdv AGVR01008254.1 11557 VSLGIILEPETKTLTVPLGGPATFRCNVTGGDLGSYQMSWYKKNEDQSLTSVYRQGNNATEGARSKFKGKVDALKSQYILDIQNATAEDVGTYYCGSD
Camelus ferus V529 ighv AGVR01015716.1 6418 VQAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAINSRGSTHYADSMKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAR
Camelus ferus V594 iglv AGVR01027164.1 5157 VNSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVTTSNYPGWYQQKPGQSLRTLIYSTNSRHSGVPNRFSGSISGKKAALTITGAQPEDEADYYCAL
Camelus ferus V595 iglv AGVR01027167.1 34615 SWAQSVLTQPPSMSGSLRQSVTISCTGSSSNIWGNYVNWHQQLPGTAPKLLIYDNSKRASGVPERFSGSKSGSSASLTITGLQAEDEGDYYCASWDDSLS
Camelus ferus V596 iglv AGVR01027167.1 29503 VVSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSSSNYPGWIQQTPGQVPRTLIYSTSSRPSGIPSRFAGTISGNKATLTITGAQPEDEADYYCALYPGSYL
Camelus ferus V597 iglv AGVR01027167.1 6696 SLSQPVLTQPPSLSASLGASARLNCTLSSGTVVGGYHINWFQKKAGSPPRYLLRFYSDSNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCGT
Camelus ferus V598 iglv AGVR01027167.1 3247 SWAQSVLTQPPFVSGSLGQRATISCTGSSSNIGHGNYVNWYQQLPGTCPRLLIYHVKNRASGVPDPFSGSKSGNSASLSITGLQAEDEADYYCADWDNSLS
Camelus ferus V603 igkv AGVR01027539.1 14932 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVFSSSSQKSLLAWHQQRNGQSPRRLIYYASTRASGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSS
Camelus ferus V604 igkv AGVR01027540.1 7256 VCGDIVMTQSPSSVTASVGEKVTINCKSSQSVLSSSNQKSYLAWYQQRPGQSPRLLIYYASTRESGVPDRFSGSGSTTDFTLTISSVQPEDAAVYYCQQAYSA
Camelus ferus V626 iglv AGVR01030129.1 35455 SWAQSALTQPPLVSGTPEQMVTISCAVTSSDVGYGNYVSWYQQLPGTAPRLLIYDVSSLSSGIPNHFSGSKSGNTASLTISRLQSEDEADYYCASYGSSYS
Camelus ferus V627 iglv AGVR01030129.1 30507 ASSALTQPSAVSVSLGQTARITCQGGNLGSSYVHWYQQKPGQAPVLVIYGDDSRPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSYDSSSY
Camelus ferus V628 iglv AGVR01030129.1 26882 SVASSAVTQPSTVSVSLGQTASITCQFGSLGSYYSHWLQQKPGQAPVLVIYNDNSRPSGIPERFSGSRSGDTATLTISGAQAEDEADYYCQVWDSSGYN
Camelus ferus V629 iglv AGVR01030129.1 18547 SVTSYELTQQASVSVDLQQMARITCSGDLLDKKYTQWYQQKPGQAPVLVIYKDSERPSGIPERFSGSSSGKTATLTISGAQGDDEADYYCQSYDSSDN
Camelus ferus V630 iglv AGVR01030129.1 10683 YVASSALTQPSAVSVSLGETARITCQGGNVGSNYASWYQQKPGQAPVLVIYGDDSRPSGIPERFSGSSSGGTATLTISGAQAEDEADYYCQSYDSSGYN
Camelus ferus V631 iglv AGVR01030131.1 27712 SWAQSVLTQLSSMSGSPGQTVTITCTGSSSNIGGGYYLSWYQQLPGTVPKLLIYNAHNRASGVPNRFSGSKSGSSASLTITGLQAEDEADYYCGCYDSSLSA
Camelus ferus V641 trbv AGVR01031494.1 12516 VRAQTIHQRPPTMVQPMGSSLSLECTVKGTSNPSLYWYRQAAGGALQLLFYSFSADQVDSEEPQNFEASVSQDGSFILSSKKLLLNNSGFYLCAWS
Camelus ferus V711 trav AGVR01042120.1 6331 VNGQHLKQIPEFVPLQEGENFTTYCNTSSTIDSLQWYKQQPGGRPVFLMLLTKGGVVKRPERLTARFGETRKDSFLHIPATQTADVGTYFCAG
Camelus ferus V714 trav AGVR01042122.1 16309 TVIEAAIEQPKSKDFTEGEDVTLPCNHSTIGLNDYIHWYWQNPNQSPQYIIHGLQDTVTNNMASLTTATDRKSSTLVLPWVALRDSAVYYCALTE
Camelus ferus V715 trdv AGVR01042122.1 2040 SGVAQTVTQDQPAVSSHVGETVTLNCRYETSDSIYYIFWYKQPPSGEMTFLIHQGSSSGNTNRGRYSVNFRKAEKALSITISNLLLKDSAKYFCALRE
Camelus ferus V777 trav AGVR01053735.1 21584 VTGEDVEQSPPVLSLQEGATSTLWCKFSTTVSSLHWYRQNPGDRLIHLFSVASGTKHDGRFSATTVAKERRSSLNISSSQTTDSATYFCAVSTVLP
Camelus ferus V779 iglv AGVR01054259.1 5158 SLAQPVLTQPPSLSGSLGSSARLTCTLSSGNNVGGYTVYWYQQNAGSPPRYLVYYYSDSSKHQGSGVPSCFSGSKDASANTGLLLISGLQPEDEADYYCGTLHG
Camelus ferus V783 ighv AGVR01055555.1 1045 VLSQVQLQESGPGLVKPSQTLSLTCTVSGGSITTSYYGWSWICQPPGKGLEWMGAIAYSGSTYYSPSLKSRTSISRDTSKNQFSLQLSSVTPEDTAVYYCAR
Camelus ferus V792 ighv AGVR01059280.1 837 VQAEVQLVESGGGSVQAGETLRLSCTASGFTFDDSDMGWYRQAPGNECELVSTISSDGSTYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAA
Camelus ferus V799 iglv AGVR01063111.1 1878 VDSPTVVTQEPSLSVSPGWTVTLTCGLSSGSVTTSNDPGWIQQTPGQVPRTLIYRTSSHLSGVPSRFFRSISGNKAALTIMGAQPKDEADYYCALDMGSGS