WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Callorhinchus milii AAVX00000000.1 (AAVX01) 446 58 21 0 216 32 3 116
Callorhinchus milii AAVX00000000.2 (AAVX02) 398 22 18 4 201 24 9 120
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Callorhinchus milii Vs41 trdv AAVX01030854.1 1653 VTQGDSVTQKVASVSGKEGGSVTMQCHYDTSLSNYYLHWYREQQETQPQYVLQKGSGGTYKADFAEKRFAIELQTSTKFTSLTISLLELSDSAVYYCALQ
Callorhinchus milii Vs40 trav AAVX01030130.1 177 VGGQEVLSQYPPEVTDFEGKDVTLKCNISRLDTAFWYRQYPDGNLQYLFRIYGSGKVDKTPDLPERFTAEQIKENKVIKMQIYGAVMGDSAVYHCALN
Callorhinchus milii Vs211 trbv AAVX01271111.1 609 LSLGALVTQRPRTVTAREGETVTLRCSHNDKSLNMMLWYIQPHQGGLTLIGYGYLSNPTYEKGFESGYNITQSNDKNKSSLEISSMNPTQEGVYYCDARE
Callorhinchus milii Vs42 trgv AAVX01031444.1 2693 ECDAQKLTQPALSTRKHSGKIVLFACKVEEVSFSSASIHWYRQTKHEALKGILYIQSELNPIREDGFDARFSAEKVENEKSCNLIIKGIELKDAGIYYCAYWD
Callorhinchus milii Vs45 trdv AAVX01031683.1 733 LTQGDSVTQKVASVTGNDGGSVAMECHYDTSLSVYYLHWYREQQETQPQYVLQKYSSGSTYKADFASKRFSIELQTSTKFTSLTISLLELSDSAVYYCALQ
Callorhinchus milii Vs44 trav AAVX01031621.1 328 HCGADSVTQLQSTVTVKEVETVYLQCNYTATSGNNPYLFWYRQSPNKPPEYILRTDTSNKFPDHADFAKERFSTNVSKAERTVPLNISHVRVTDSAGYYCALS
Callorhinchus milii Vs47 trav AAVX01033925.1 690 HCGGDSVTQLQSTVTVKEGETVYLQCNYTATSDNNPYLFWYRHSPNKPPEYILRTDTSNKFPGHADFAKERFSTNVSKAERTVPLNISHVRVTDSAGYYCALS
Callorhinchus milii Vs214 trbv AAVX01277117.1 210 LSLGALVTQWPRTVTAREGETVTLNCHQDDSSLTVMLWYIQPHQGGLTLIGYNQYSTTYEDKFKSGYNITKTPDRMNSTLEISSVNPTQEGVYYCAARE
Callorhinchus milii Vs49 trav AAVX01035309.1 3576 VRGQDVVSQYPPEITDIEGKDVTLKCNISTLNTAFWYKQYPDGNLHYLFRIYTSGKVDKSPDLPERFTAELMKENKVIKLQILGAVVGDSAVYYCALE
Callorhinchus milii Vs48 trav AAVX01035309.1 1053 HSGGNSVTQLQSTVAVNEGEDVYMQCNYTATNTIDPYLFWYRHYPNKAPEYILRTDTSNKFPDHADFAKGRFSTNVSKGERTVPLNISQVRVADSAGYHCALS
Callorhinchus milii Vs218 trdv AAVX01289371.1 1422 KSYTFSQSPPEQTTIAGERINVHCQYSGICGQDFSVSWYRQSPSEALEYLLHRKSSGEGGNPTRNNIFAYLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs356 trav AAVX01019631.1 3241 VSGQDVITQYPREQTEIEGQDVALNCNISRLATVFWYRQNPAGDLQYALRIFTSGTVNKSPDLPERFTAELIKKNKVIKLQILGAVVGDSAVYYCALE
Callorhinchus milii Vs357 trdv AAVX01021014.1 1446 VVLGDSVREQTAGLSKQEGDTVSLSCSYTTSSPYAALYWYRHHPGLAPQYILYRDTDGASNTADFATGRFSSQLNKYQRKTTLIIRSIVITDAATYYCGLTT
Callorhinchus milii Vs354 trdv AAVX01018864.1 1763 VVLGDSVRQQTAGLSKQEGDTVSLSCSYTTSSSYAALYWYRHHPGLAHQYILYRDTDGNDNTADFAKGRFTSQLDTNQRKTTLSISSVIVTDAATYYCGLRTE
Callorhinchus milii Vs355 trav AAVX01019320.1 742 FRGQDVVSQYPPEITDIEGKDVTLKCNISTLSTAFWYKQYPDGNLHYLFRIYASGKVDKSPDLPERFTAELIKENKVIKLQILGAVVGDSAVYYCALE
Callorhinchus milii Vs210 trav AAVX01270752.1 261 YCGGDSVTQLETSLTVNEGEDVTLQCNYTTTSTSPYLFWYRHYPNRAPEYILRKDTSNKFPDHADFAKQRFSTNVSKEERTAPINIFQMRVADSARYYCALS
Callorhinchus milii Vs2 trav AAVX01005005.1 22 YCGGDSVTQLESFLTVNEGEDVSLQCNYTTTSNTPNLFWYRHYPNKAPEYILWTYGRGQPQHADFAKERFSTKLDESRRTVPLNISQVRITDAAAYYCALS
Callorhinchus milii Vs3 trav AAVX01006056.1 1743 NSLQDIGNQPIAEISVEEGKDVKLSCTLKKISDAYSLFWYRQASRNAPVYVLYSVGRIDYRSPDFPDRFSAKVNETIEDFEVSIVTVLVRDSAVYYCAKR
Callorhinchus milii Vs5 trav AAVX01007186.1 1605 VVAEVGGQDVISPNIPEITEIEGQDVTLNCNISRLETILWYRQYPDGAPQYFLSIYTSGGVDKPPGLPHRFAAYVNKRNKIMNLQIHRAVVGDSSVYYCALE
Callorhinchus milii Vs6 trdv AAVX01008810.1 1187 SSFTVSQSPPEQTAFAGERINLHCQYSGFCGQNFSVSWYRQSPGETLEYLLHRKPSGEGGNPTGGHISVSLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs7 trdv AAVX01011007.1 1273 TANGVSVQPSQVEVSVPEGQTATLSCTYSADFSNVFMYWYRQYPGEPPLYTRRHDYDGETFSAEFAKQRFSTTLDTKTKRSSVTVRSVALSDTATYYCA
Callorhinchus milii Vs9 trdv AAVX01011978.1 274 LTQGDSVTEKVASVTGKEGGSVTMECHYETSLNGYYLYWYREQQEKQPQFPLKKGSSGDIDKADFAKKRFSAELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii Vs46 iglv AAVX01031687.1 1769 GCDGFILSQPLSMIGKLGSVVRITCTKNDMGNDYVHWYRENPGKGLQWILYYHSGNKKDNSPDFPRFSAHKSGDSCTLRIKSLTSDDSGIYYCGVWD
Callorhinchus milii Vs107 trdv AAVX01097416.1 431 SNYTVSQSPPEQTAFACERINLHCQYSGYCGQDFSVSWYRQTPGEELKYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs454 trdv AAVX01105756.1 350 SSFTVSQSPPEQTAVAGERINLHCQYSGFCGQNFSVSWYRQSPGEELKCLFRRKPSGEEGNPTGDNISASLDTAKKISILTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs105 trav AAVX01095179.1 670 VSGQDVVSQYPREKTEIEGQDVILNCNISRLATVFWYWQNPGGALQYALRIFASGTVDKSHDLPERFTAELIKKNKVTKLQIIGAVVGDSAVYYCALE
Callorhinchus milii Vs104 trdv AAVX01094972.1 925 LCVGDSVSQKAARMVKKEGEIAILQCTYSTTESYYYLFWYRHYPDKQPEFIIWRYSGNDDQVKGIGFRNRFSAQLQTSNSSTSLSISEVVVSDSAVYYCALS
Callorhinchus milii Vs519 trdv AAVX01227461.1 974 SSYTVSQSPPEQTAFAGERINLHCEYSGFCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSALYHCALS
Callorhinchus milii Vs100 trav AAVX01093498.1 807 VYGQDVISQYPPEITDFEGQNVTLNCSYSTLQTAFWYRQYPDGAPQYLFRIYVSGNVDNPPDRFTAELIKESKVINLQILSAVVGDSAVYHCALE
Callorhinchus milii Vs514 trav AAVX01226358.1 464 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATGEYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADFAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii Vs515 trav AAVX01226392.1 531 ASHQDSVAMKVSSISKREGDTVTIECTYSTHNTSYIIYWYRQYGDVIPEFIVWKYSGGNEAKADWAKSRFSVALLKSNTTVRLMVSQLQVADSARYHCALR
Callorhinchus milii Vs516 trdv AAVX01226890.1 1222 LCDVDSVSQKAATMVKKEGETAILQCTYSTTESDYNLYWYRHYPDKQPEFIIWIYSGDNQGKGTGFGNRFSAQLQTSNSSTSLSISELVVSDSAVYYCAFR
Callorhinchus milii Vs517 ighv AAVX01227200.1 769 VQAEVVLTQPPFLSGKPGPPLRLTCKTSGFNLGSYYMHWVRQVPGKGLEWLLMYYSSSSKYFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARG
Callorhinchus milii Vs510 trav AAVX01210937.1 826 YCGGDSVTQLQSALTVNERKDVSLQCNDTTTSTTPYLFWYRHYPNRAPEYILWTYGRGQPQHADFAKERFSTKLDESRRTVPLNISQVRIKDSAAYYCALS
Callorhinchus milii Vs109 trdv AAVX01098987.1 326 VVLGDSVRQQTAGLTKQEGDTVSLSCSYTTSSSYAALYWYRHHPGLAPKYILYSDTDGGSNTADFAAGRFSSQLNKYQRKTTLIIRSVAITDAATYYCGL
Callorhinchus milii Vs108 trav AAVX01098345.1 537 YCGGDSVTQLQSTVTVNEGEAVYLQCNYTATSGSNPYLFWYSHYANKAPEYILNTYIRNTKQQRADFAKERFSTNVSNAERTVHLNISQVRVTDSAVYYCSLS
Callorhinchus milii Vs351 trdv AAVX01015887.1 1050 TANGVSVQPSQMEVSVPEGQTATLSCTFSADFSNVFIYWYRQYPGEPPLYTRRHDYDGETFSAEFAKQRFSTTLDTNTKSSSVTVRSVALSDTATYYCA
Callorhinchus milii Vs34 trdv AAVX01026270.1 2747 VVLGAPVRQQRAGLSKQEGYTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGIENTADYAKGRFASYLGKDQLQSTLIIPSVIVNDAATYYCALTSD
Callorhinchus milii Vs35 trav AAVX01026360.1 2602 VVAEVGGQDVISPNIPEITEIEGQDVTLNCNIARLDTILWYRQYPDGAPQYFLSIYTSGRVDKPPGLPHRFAAYVNKRNRIMNLQIHRAVVGDSSVYYCALE
Callorhinchus milii Vs36 ighv AAVX01026655.1 2620 VQADLVLKQPPYLTGKTGQALRLTCESSGFNLSIAHMSWYRQLPGKQQENLLQYEGSSIKSFGSGFENRVTVIREDSQSIFDLIIKCPTVHDTSTYYCKIK
Callorhinchus milii Vs30 trav AAVX01024258.1 912 RCGGESVTQLQSVVTVTEGEDVSLQCNYTATGGISDYLFWYRHSFNKAPEYILRTDTNNRIKHEADFAKERFSTNVSKAERTVPLNILHVRVTDSAGYYCALS
Callorhinchus milii Vs31 trdv AAVX01025268.1 283 LTQGDSVTQKVASVIEKVGVSATMECHYDTSLSSYYLNWHGEQQETQPQYVLQKGSRGSTHKADFAKTRFSIELQTATKFTSLTISLLELSDSAVYYCAHQ
Callorhinchus milii Vs32 trav AAVX01025379.1 432 HSGGDSVTQLQSIVAVNEGEDVYMQCNCTATNTIDPYLFWYRHYPNKAPEYILRTDTSNKFPDHADFAKGRFSKNVSKGERTVPLNISQVRVADSAGYYCTLS
Callorhinchus milii Vs33 trav AAVX01025379.1 2951 VRGQDVVSQFHPEITDIEGKDVTLKCNISTLNTAFWYKQYPDENLHYLFRIYTSGKVDKSPDLPERFTGELIKENKVIKMQIFGAVIGDSAVYHCALN
Callorhinchus milii Vs38 trav AAVX01029453.1 929 ILAESDVSQSPQAMTGNENGNVSMECTTTVSSPNFHWYTQYGNGSIRFLVLGKRDISENDRISALANTRERNSTLTIQNLRVTDSATYFCAE
Callorhinchus milii Vs200 ighv AAVX01250674.1 1271 VQADVVLTQPPSLTGEPGHPLRLTCKTSGFNLGSYNMYWVRQVPGKGLEWIVYYYSSSDNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARD
Callorhinchus milii Vs512 trav AAVX01217918.1 535 VVAEVGGQDVVSPNIPEITAIEGQDVTLNCNISRLRTILWYRQYPDGAPRYFLSIYTSGRVDKPPGLPHRFAVYVNKRNKIMNLQIHRAVVGDSSVYYCALE
Callorhinchus milii Vs98 ighv AAVX01090460.1 970 VQSGAVMTQPPTLIGKTGQALRLTCRISGFNLANYWMHWKRQFPGKQRENFLAYFSSSNYFESEIENRVTVIKDTSKNIFDVIIKSPTVEDTATYYCGAR
Callorhinchus milii Vs608 trdv AAVX01403942.1 762 IANAISVQPSQMEVSVGEGQTANMSCTYSADFTDVLMYWYLQYPGDPPLYTRRHNYGGDTFSAEFAKQRFSTNLDTNTKKYSLTLFPVALSDMATYYCAIR
Callorhinchus milii Vs600 trdv AAVX01387429.1 697 SSYTASQSPPEQSAFVGERINLNCQYSGFCGQNFSVSWYRQSPGEELKYLLHRNRSGEGGNLTGDHISASLDTAKKISVLTIAGLRLTDSAKYHCALS
Callorhinchus milii Vs601 trav AAVX01389395.1 749 YCGGDSVTQLEPCLTVNEVEDVTLQCNYTTTSTSPYLFWYRHYPNRAPEYILRKDTSNKFPDHADFAKQRFSTNVSKEERTAPINIFQVRVADSARYYCALS
Callorhinchus milii Vs603 trav AAVX01390539.1 502 VRGQDVVSQYPPEITDIEGKDVTLKCNISTLSTAFWYKQYPDGNLHYLFRIYTSGKVDKSPDLPERFTAELIKENKVIKLQILGAVVGDSAVYYCALE
Callorhinchus milii Vs605 trav AAVX01393059.1 443 VGGQDTVSQSPLTVTVAEKEQVIISCSTTESQASQWYRQNPNQALKHLVTGQTGEQQKKRIRATMNYREKGSNLSITRTEVTDAATYLCAVETQLD
Callorhinchus milii Vs607 trav AAVX01403362.1 346 AVTQLQSTVTVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNRPPEYILSTDTNNRIKNGANFAEERFSTNVSKAERTVPLNILQVRVTDSVEYYCALS
Callorhinchus milii Vs254 ighv AAVX01400608.1 224 VQADVVLTQPPSLTGEPGHPLRLTCKTSGFNLGSYWMSWVRQVPGKGREWLLSYYSSSYKAFAPGIEDRVTVIKENSNNIFDLIIKCPRVDDTAIYYCVRG
Callorhinchus milii Vs81 trav AAVX01070640.1 269 DLAESDVSQTPQAVTVNENGNVSMECSTTVNNPFFHWYKQHGKGSIRFLVLGKSDVNMKDRIRALAERKQKNCTLTIEDVRMSDTAIYFCAE
Callorhinchus milii Vs260 ighv AAVX01426578.1 47 VQAEVVLTQPPSLTGKPGPPLRLTCKTSGFNLGSYYMSWVRQVPGKGLEWLLRYWSPSDSDNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARE
Callorhinchus milii Vs520 trav AAVX01227486.1 954 VSGQDTVSQSPLSVTVWEKEQVFISCSTTDTSQALKWYRQYPNQALTHLVTGKTGEQQKERITATMSYRDGKSNLSIRHTEVTDAATYLCAVE
Callorhinchus milii Vs91 trav AAVX01082379.1 392 YCRGDSVTQLESALTVNEGEDVSLQCNYTATSTTTPSLFWYRHYPNKAPEYILWTYSRGQPQHADFAKERFSTKVDEIRRTVPLSISQVRVADSAGYYCALS
Callorhinchus milii Vs523 trdv AAVX01232533.1 575 LTQGDSVTQKVASLIGKEGGSVTMECHYDTSLGNYYLNWYREQEEIQPHYVLQKGSGGDTYKADFAKKRFSIELQTSTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii Vs266 trdv AAVX01444581.1 205 VVLGAPVRQQRAGLSKQEGDTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGIDNTADYAKGRFASHLGKNQLQSTLIIPSVIVNDAATYYCALT
Callorhinchus milii Vs399 trbv AAVX01040298.1 2444 LSLGALVTQWPGTVTAREGETVTLNCYQNNKDYEVMLWYLQPHQGGLTLLGYVYYTTVTHEESGYNITKTSDKMNSTLEISSVNPTQEGVYYCAARE
Callorhinchus milii Vs97 trav AAVX01088246.1 1206 LSDGNSVSQKAASMVKRKGETASFECTYSTTLSDYGLSWYRHYPDKQPEYIVRRYSGNTIQYRGTGFGNRFSAQLHKSISSTSLSISELVVSDSAVYYCAFN
Callorhinchus milii Vs529 trbv AAVX01234915.1 641 LSLGALVTQWPRTVTAREGETVTLNCHQDDSSLNTMLWYLQPHQGGLTLLGYVYYTTVTHEESGYNITKTSDKMNSTLEISSMNPTQEGVYYCAARE
Callorhinchus milii Vs679 trdv AAVX01636910.1 337 LCDGDSVSQKAANMIKKEGEIAMLQCTYSTTESDCFLYWYRHYPDKQPEFIIRRYSGNDNQEKGTGFGNRFTAQLQTSNSTTSLSISELVVSDSAVYYCALS
Callorhinchus milii Vs259 ighv AAVX01423029.1 235 VQAAVVMTQPPTLTGKTGQALRLTCRSSGFSSYYYYCMFWYRQLPGKQREKLLTSDTYSSNSFESGFGNRVTVVRENSNRIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs677 trdv AAVX01634656.1 361 LCDGDSVSQKAATMVKRKGETASFECTYSTTLSRYDLSWYRHYPDKQPEYIVRRYSGNGNQYRGTGFGNRFSAQLHKSISSTSLSISEMVVSDSAVYYCAFNP
Callorhinchus milii Vs258 ighv AAVX01416270.1 456 VQAEVVLTQPPSLTGEPGHPLRLTCKTSGFNLGSYGMSWVRQVPGKGLEWLLHYYKPSHSYNGFAPGIEDRVTVIKEDSNNIFDLIIKSPRVDDTAIYYCARG
Callorhinchus milii Vs671 trbv AAVX01615282.1 321 LSLGALVTQRPRTVTAREGETVSLRCSHNDKSLDMMLWYIQPHQGGLTLIGYNQYSTTYEDKFKSGYNITKTPDKMNSTLEISSMNPTQEGVYYCAARE
Callorhinchus milii Vs670 ighv AAVX01614949.1 378 VQADLVLKQPPYLTGKTGQALRLTCESSGFILNITHMSWYRQLPGKQQENLLQYEGSSIKSFGSGFENRVTVIREDSQGIFDLIIKCPTVQDTSTYYCEIK
Callorhinchus milii Vs158 trav AAVX01195534.1 1157 YCGGDSVTQLQSAVTVNEGEAVYLQCNYTATTGSDAYLFWYRHYPNKAPEYILNTYIRNNKQQRAVFAKERFSTNVSNAERTVHLNIFQVRLTDSAGYYCALS
Callorhinchus milii Vs159 trav AAVX01196735.1 420 VYGQDAVTQYPPEITDLEGENVTMNCSYSTINAAFWYRQNPDGAPQYLFRIYSSGKVDSPPDRFTAELIKENKVINLQILSAVVGDSAVYYCALE
Callorhinchus milii Vs154 trdv AAVX01187291.1 341 IANGISVEPSMMEVSVGEGQTVNMSCTYTTDFTDVVMYWYRQYPGEPPLYTRRHDYDGDTFSAEFAKQRFSTNLDTNTKRYSLTVFPVALSDMAKYYCAIR
Callorhinchus milii Vs156 trdv AAVX01192370.1 679 SSYTVSQTPPEQTAFAGQNTTLHCKYSGLCGQDLSVSWYRPSPGEALKYLLHRKPSGEGGNPTGDHISASLDTAKGISILTIAGVRLTDSALYHCALS
Callorhinchus milii Vs150 trav AAVX01180620.1 230 FCGGDSVTQLQSIVTLTEGEDVSLQCNYSVASDGSDYLFWYRHLTNKAPEYILRTSTINRNKDHAEFAKERFSTNVSKAERTVPLNILHVRVTDSAGYYCALS
Callorhinchus milii Vs153 trbv AAVX01184279.1 340 LSLGALVTQWPRTVTAREGETVSLNCHQDDSSLTVMLWYIQPHQGGLTLIGYNQYSTTYEDKFKSGYNITKTPDKMNSTLEIANMNPTQEGVYYCAARE
Callorhinchus milii Vs551 trav AAVX01265890.1 1123 VSGQEKVYQSPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGTTGEQQKERITAAMNYRDSSSNLSITGTEVTDAATYLCAVE
Callorhinchus milii Vs552 trbv AAVX01271621.1 817 LSLGALVTQRPRTVTAREGETVSLRCSHNDKSLDMMLWYIQPHQGGLTLIGYNEYSTVYEDKFKSGYNITKTPDNMNSTLEITNINPTQEGVYYCAARR
Callorhinchus milii Vs554 trdv AAVX01273372.1 602 LTQGDSVTQKVASVTGKEGGSVTMECHYDTSLSDYYLNWYREQQETQPHYVLQKGSDGDKDKADFAKKRFSIELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii Vs556 trav AAVX01277457.1 521 SCDAETVSQTAATMVKREGESVIFRCSYSTTETSYYLHWYRYYRDKHPEFIIWRYSANDNQQKGTGFGHRFSAQLQKSNSSTSLSISELVVSDSAVYYCAFA
Callorhinchus milii Vs557 trav AAVX01282567.1 422 ICGGDSVTRLQSIVTVTEGEDVSLQCNYTVANTGSDSLFWYRHLTSKAPEYILSTSNNNRIKDHAEFATERFSTNVFQVERTAPLNIFQVRVTDSAGYYCALS
Callorhinchus milii Vs558 trdv AAVX01282814.1 576 FCDGDSVTQKAATMVKKERETVILQCSYFTTESDYVLHWYRHYTGKQPEFIIWRYSGSEVEEKGVGFGNRFSAQLHKSNSSTSLSISELVVSDSAVYYCAFSL
Callorhinchus milii Vs418 trav AAVX01063062.1 1968 NSLQDIGNQPIAEIPVEEGKDVKLSCTLKKISDATYLYWYRQASRNAPVYILYSVAGKDYMSPDFPYRFSSKVNKTNEDFELSIITVLISDSAVYYCGKE
Callorhinchus milii Vs103 trav AAVX01094772.1 241 KSLQDIGNQPIAEIPVEEGKDVKLSCTLKKISDANYLYWYRQASRNAPVYILYSVAGKDYMSPDFQNRFSSKVNKTKEDFELSIVTVLISDSAVYYCAKE
Callorhinchus milii Vs415 trav AAVX01059445.1 2024 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNRPPEYILSTDTNNRIKNGANFAEERFSTNVSKAERTVPLNILQVRVTDSVEYYCALS
Callorhinchus milii Vs414 trdv AAVX01059155.1 1602 LCGGDTVNQKEASRLKREAETVKLKCTYSTIQSNYRLFWYRRYPVKQPEFIVVLYSSDDDEDKGEGFGNRFSAQLQKSNSTTSLTISELVLSDSAVYYCAFT
Callorhinchus milii Vs102 iglv AAVX01094688.1 319 GCDGFTLSQPKSLTGKSGSVARITCTKNNIGNDYVHWYRETPGKGLQWILYYHSENKKHKSPDFLVYSAQKNGDSCTLKIKSLTSDDSGIYYCGVWD
Callorhinchus milii Vs323 ighv AAVX01617884.1 279 VQAAVVMTQPPTLIGKTGQSLRLTCRSSGFSSYYYYCMFWYRQLPGKQREKLLTSDTYSSNSFESGFGNRVTVVRGNSNRIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs322 trbv AAVX01611727.1 230 LSLGALVTQWPRTVTAREGETVTLRCYQKNTKYETMLWYLQPHQGGLTLIGYGYASNPTMEDAYKLEYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii Vs321 trdv AAVX01608548.1 329 SNYTVSQSPPEQTAFSGERINLHCQYSGYCGQDFSVSWYRQSPGEELKYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIANLRLTDSAMYHCALS
Callorhinchus milii Vs320 trbv AAVX01605292.1 263 LSLGALVTQLPRTVTAREGETVTLNCHQKDTAYQTMLWYLQPHQGGLTLIGYGFASNPTMEDAYKLDYKVKQTDDYKNCSLEIKKATQEGVYYCSARE
Callorhinchus milii Vs327 ighv AAVX01635601.1 227 VQAGEVLTQPPTLTGKTGQSLRLTCRTSGFNYNSYYYCMFWYRQLPGKQREKLLTSDTYSSNSFESGVGNRVTVVRENSNRIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs326 trdv AAVX01631190.1 562 LCDGDPVSQKAASMVKRKGETASFECPYSTTLSSYDLSWYRHYPEKQPEYIVRRNSGNENQYRGAGFGNRFSAHLHKSNSSTSLSISELVVSDSAVYYCAFN
Callorhinchus milii Vs325 trav AAVX01625752.1 221 NSLQGTGNQPIAEIRVEEGKDVKLSCTLQKISDTSYLYWYRQVSRNAPVFILQSVAGKDNKSPDFPDRFSSKVDKSNEDFKLSIVTVLIRDSAMYYCAKE
Callorhinchus milii Vs329 trav AAVX01001141.1 320 NSMQDIVNQPIAEISVEEGKDVKLSCTLKKISDAYSLFWYRQTSRNALVYILLSVAGKDNKSPDFPDRFTSNVDKTSEDFKLSIATVLIGDSAVYYCAKE
Callorhinchus milii Vs79 trdv AAVX01070449.1 4047 SNFTVSQSPPEQTVFAGERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGVNPTGDHISASLDTAKNIRFLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs543 trav AAVX01254311.1 430 HCGGDSVTQLQSTLTVNEGDDVSLQCNYTARSGSGNNYLFWYRHYPNKAPEYILRKDTSNKLPDHADFAKERFSTDVSKAERTVPLNIIQVRVADSAGYYCALS
Callorhinchus milii Vs72 trav AAVX01059444.1 1370 VDGENFVDQYPPEITDFEGQNVTLNCSYSTMNAALWYRQYPDGALQYLFRIYSSGKVDNPPDRFTAELIKENKVIKLQILSAVVGDSAVYYCALE
Callorhinchus milii Vs73 trav AAVX01059446.1 1014 YCRGDSVTQLQSTVTVNEEEDVTLQCNYTTTSNTLYLFWYRHYPNRAPEYILWTYGRGQPQRADFAKERFSTKLDESRRTVPLNISQMRITDSAAYYCALS
Callorhinchus milii Vs257 trav AAVX01414941.1 239 YCGGDSVTQLQSAVTVNEGEAVYLQCNYTATSGSDTYLFWYRHYANKAPEYILNAYIRNNKQQHADFAKERFSTNVSQAETTVHMNILQVRVIDSAGYYCALS
Callorhinchus milii Vs256 trav AAVX01410300.1 352 YCGGDSVTQLEPSLTVNEGEDVTLQCNYTTTSTSPYLFWYRHYPNRAPEYILRKDTSNKFPDHADFAKQRFSTNVSKEERTAPINIFQVRVADSARYYCALS
Callorhinchus milii Vs87 trav AAVX01075458.1 576 HCGGDAVTQLQSTVTVTEGEDVYLMCNATATSGYNTYLFWYRHFPNKSPEYIVSTDTNNRIKDGAYFAEERFSTNVSKAERTVPLNILQVRVTDSARYYCALR
Callorhinchus milii Vs526 trbv AAVX01233529.1 564 LSLGALVTQRPRTVTAREGETVSLNCHQKDTAYQTMLWYLQPHQGGLTLIGYGYASNPTMEDAYKLEYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii Vs253 trav AAVX01385975.1 644 VYGQDVVTQYPPEITDFEGQNVTLNCSYSTINAAFWYRQYPDGAPQYLFRRYSSGKVDNPPDRSTAELIKENKVINLQILSDVVGDSAVYYCALN
Callorhinchus milii Vs80 trdv AAVX01070450.1 3104 SSYTVSQSPPEQSAFSGERINVHCQYSGFCGQNFSVSWYRQTPGEGLKYLLHRKPSGEGVNPTGDHISASLDTAKKISVLTIADLRLTDSALYHCALS
Callorhinchus milii Vs398 trbv AAVX01040298.1 3618 LSLGALVTQLPRTVTAREGETVTLNCHQKDTAYQTMLWYLQPHQGGLTLIGYGYASNPTMEDAYKLEYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii Vs82 trav AAVX01070640.1 2596 HCGGDSVTQLQSTVTVNEGEFVYLQCNYTAASTTNNYLFWYRQFPNKSPEFILSTSSNNRIKQNADFAKERFSANVDEMGRTVQLKVLHVRVTDSAGYYCALS
Callorhinchus milii Vs397 trbv AAVX01040298.1 5212 LSLGALVTQWPGTVTAREGETVSLNCYQNDTDYQVMLWYFQPHHGGLTLIAYAVVTTPTYEKGFESGYNMTKTTDDKESSLKISNLNPTQEGVYYCAARE
Callorhinchus milii Vs392 trav AAVX01035391.1 302 VYGQDVVSLYPPEITDFEGQTVTLNCSYSSLQAAFWYRQYPDGALQYLFRMYSSGKVDNLPDRFTAELIKENKVIELQILGAVVGDGAVYYCALN
Callorhinchus milii Vs88 trav AAVX01077123.1 1448 ICDGDSVSQKAATTVKIEGQSEVIECTYSTTVGYYYLFWYRHYPDQQPEFIFRSYSNRDNPVKGPGFGNRFTAVLHKSISFTGLTISDLVLSDSAVYYCAFS
Callorhinchus milii Vs390 trav AAVX01034871.1 360 VRLQDTGKQPIAEISVEEGKDVKLSCTLRKISDANYLYWYRQASRNSPVYILYSISDKDYKSTDFPHRFSSTVNESNEDFELSIVTVLIGDSAVYYCAKR
Callorhinchus milii Vs391 trav AAVX01034932.1 1095 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQALQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSNLSITGTELTDAATYLCAVG
Callorhinchus milii Vs631 ighv AAVX01484956.1 476 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYGMSWVRQVPGKGLEWLLYYYKPSHSYNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARE
Callorhinchus milii Vs635 trav AAVX01490232.1 439 VSGQDTVSQSPLSVTVWENEQVFISCSTTDTSQALQWYRQYPNQALTHLVTGKTGEQQKERITATMNYREKGSNLSITGTEVTDAATYLCAVE
Callorhinchus milii Vs634 ighv AAVX01489811.1 517 VQAAVVMTQPPTLTGKTGQSLRLTCRTSGFYSNWYYCMFWYRQLPGKQREKLLTSDTYSSNSFESGFGNRVTVVRENSNRIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs637 ighv AAVX01497968.1 344 VQAAVVMTQPPTLIGKTGQSLRLTCRSSGFSSYYYYCMFWYRQLPGKQREKLLTSDTYSSNSFESGFGNRVTVVRGNSNRIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs636 trav AAVX01496727.1 323 ISLQDPGKQSTDEILAQVGEDVKIYCSLKKVSDASYLYWYRKASRNVLVYILRSFGGKDKNNPDFPNRFYSTVDKTSEEFELSIDTVLMTDSAVYYCAKE
Callorhinchus milii Vs639 iglv AAVX01508953.1 574 GCDAFTLSQPLSMIVKSGKVATITCKKNNIDNDNVHWYRESPGKGLQWILYYHSRNKKDNSPDFLSRFSSDKSGDSCTLTIIRLTSDDSGIYYCGVWD
Callorhinchus milii Vs119 trav AAVX01115816.1 734 VVVGDSIRQQTAGLSKQEGDTVSLSCSYTTSSAYAALYWYRHHPGLAPQYILYRDTDGNDHAADFAKGRFTSQLDKNQRQTTLNILSIIVTDAATYYCGLRTD
Callorhinchus milii Vs594 iglv AAVX01373536.1 786 VSGELVMTQTPSMLPVTVGQTATITCKASSSISNYLGWYQQKAGERPKLLIYSATTLYTGTPARFSGHQSSTTFTMTITGVQPEDFADYYCMGYQSSS
Callorhinchus milii Vs596 ighv AAVX01380397.1 351 VQADVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYWMSWVRQVPGKGLEWLLWYYSSSNKYFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDNAIYYCARE
Callorhinchus milii Vs597 ighv AAVX01381415.1 522 VQAEVVLTQPPSLSGKPGHPLRLTCKTSGFNLGSYYMSWVRQVPGKGLEWLLWYYSSSYKYFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARE
Callorhinchus milii Vs590 trav AAVX01361524.1 405 RCGGDGVTQLQTIVTVTEGEDVSLQCNYTGANTGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHAEFAKQRFSASVSQAERTVPLNILQVRITDSAGYYCALS
Callorhinchus milii Vs592 trav AAVX01366350.1 399 VVVGDPVRQQTAELSKQEGDTVSLSCSYTTSSNYAALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNKEQTTLIILSVIVTDSATYYCGLRSD
Callorhinchus milii Vs593 trav AAVX01371974.1 374 LCGEDSVSQKAATLLKKEGDAVTFDCIYFTNESAFILFWFRQYPVKQPEFMVWRFSYNNKETKGAGIGNRFSSQLDSSQSVTRLSISELQLSDSSMYICA
Callorhinchus milii Vs598 trdv AAVX01382252.1 451 SRFTVSQSPPEQTAFAGERIHLHCQYSGFWGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs599 trbv AAVX01383045.1 351 LSLGALVTQWPRTVTAREGETVTLNCHQDDSSLTVMLWYIQPHQGGLTLIGYGVYSVITHERPDYNITKTPDNMNSTLEISSMNPTQEGVYYCAARE
Callorhinchus milii Vs189 trdv AAVX01231663.1 908 LTHGDSVREKVASVTEKEGGSVTMECHYSTSLIDHYLQWYREQKETPPRYVIEKHSGGATYKADFAEKRFAVELQTLTKSSSLTITQLELSDSAVYYCALK
Callorhinchus milii Vs187 iglv AAVX01226903.1 514 GCDGFTLSQPRSMIKNQGRTAMITCTMQGKSMGEDYVHWYLGNPGKGLQWILYNKGTKIETSPDFPRRFSAVKSGDSSILTITKVNPNDSGIYYCGVWD
Callorhinchus milii Vs186 ighv AAVX01225191.1 811 VQADVVLTQPSSLTGKPGQALLLTCKTSGFDLSSYYISWVRQVPGKGLEWLLMYHSSAYQYYAPGIQNRVTVIKENSNNICDLIIKSPTVEDTAIYYCARN
Callorhinchus milii Vs185 trav AAVX01223555.1 12 DSVTQLQSTVTVNEGEAVYLQCNYTATSAGDPYLFWYRHYANKTPEYILNTYIRNNKQQRADFGKERFSTNVSNAERTVHLNISQVRLTDSAGYYCALSPTE
Callorhinchus milii Vs184 trdv AAVX01223298.1 356 SNYTVSQSPPEQTAVADERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIADLRLTDSAMYHCALR
Callorhinchus milii Vs183 trav AAVX01221219.1 226 NSLQDIGNQPIAEISVEEGKDVKLSCTLKKISDANYLYWYRQASRNAPVYILYSISDKDYKSTDFPHRFSSTVNESNEDFELSIVTVLIGDSAVYYCANE
Callorhinchus milii Vs182 trdv AAVX01221102.1 427 LTQGDAVTQKVASEIGKEGGSVTMECHYDTSLSSYYLNWYREQQETQLQYVLQKYSGGYTDKADFAKKRFSIELQTSTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii Vs181 trdv AAVX01220711.1 1189 VVVGDSVREQTAALRKQEGDTVSLSCSYTTSSSFAALYWYRHHPGLAPQYILYRDTDGNDNTADFAKGRFTSQLHTNQRKTTLSISSVIVTDAATYYCGLSRG
Callorhinchus milii Vs166 trav AAVX01206491.1 686 VVLGDPVRQQTAGLSKQEGGTVSLSCSYTTSSNYVALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNQEQTTLIILSVIVTDSAAYYCGLRSD
Callorhinchus milii Vs161 trav AAVX01198465.1 412 VDGENVVNEYPPEITGIEGQNVTLNCSYSTMNAALWYRQYPDGALQYLFRIYSSGKVDNPPDRFTAELIKEKKVINLQILSAVVGDSAVYYCALE
Callorhinchus milii Vs209 ighv AAVX01269599.1 200 GCDGLSLTQPGSMVKKTGRTVEMTCTLAGASMQNVYVHWYRGNPGKEFQWILYYRSESQMKTSPAFSERFSAVKSGQLCILTIIKPVQEDTATYYCGLWH
Callorhinchus milii Vs204 trav AAVX01257364.1 179 NSLQDIRNQPIAEITVEEGKVVKLSCALQKISDTSYLYWYRQVSRNAPVYILLSVAGKDNKSPDFQQRFSSKVDKTNEDFKLSIATVLIGDSAVYYCANE
Callorhinchus milii Vs206 trav AAVX01259579.1 173 HCGGDAVTQLQSTVPVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADSAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii Vs207 trav AAVX01262346.1 338 VFAESAVSQRPQAVTENENGNASVECTVTESTNAFHWYKQYGNGSIRFLVLGTSDISVKGRIRALANTRQRNCTLTIQNLRVSDTATYFCAA
Callorhinchus milii Vs169 ighv AAVX01210366.1 399 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFDLSSYTMSWVRQVPGKGLEWLLYYYSSSNNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARE
Callorhinchus milii Vs201 trdv AAVX01252367.1 1091 HCNGDSVSQKAATIVKKEGDIAILQCTYSTTESDYILYWYRHYPDKTPEFMIRRYSGNDIQNKGTGFGIRFSAQLQTSNSFASLSIAALVVSDSAVYYCAFK
Callorhinchus milii Vs202 ighv AAVX01253359.1 661 VQAGEVLTQPPTLTGKTGQSLRLTCRTSGFNYNSYYYCMYWYRQLPGKQREKLLTSDKHSSNSFESGVGNRFTVVRENSNNIFDLIIKSPRVEDTATYYCAAE
Callorhinchus milii Vs203 ighv AAVX01253642.1 680 VQTTVVMTQPPTLTGKTGQALRLTCRSSGFNYNRYYCMFWYRQLPGKQREKLLTSNGISSNSFESGVGNRVTVVRENSNNIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs110 trav AAVX01099527.1 1251 VVLGDSVRQQTAGLSKQEGGTVSLSCSYTTSSNYAALYWYRHHPGLAAQYILYRHTNGLDNTADYAKGRFTSHLDKNQEETTLFILSVIVTDSAAYYCGLRSD
Callorhinchus milii Vs447 trdv AAVX01101493.1 323 SSFTVSQSPSEQTAVAGERINLHCQYSGFCGQNFSVSWYRQSPGETLEYLLHRNPSGEGGKPTGGHISVSLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs444 trav AAVX01098699.1 479 HCGGYAVTQLQSTVTVTKGEDVYLQCNYTATSEYNTYLFWYRHFPNKSPEYILSTDTNNRIKNGADFAEERFSTNLSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii Vs298 trdv AAVX01548230.1 70 SSNAVCQTQPQQAAFAGETVSLHCKYILFSEEYFIIYWYRQSSGEEMQYLLQKKSSVEGGNPTGERISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs293 trdv AAVX01534112.1 245 SSYTVSQSPLEQTAFAGERINLHCEYSGFCGQDFSVSWYRQTPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSAPYHCALS
Callorhinchus milii Vs292 trav AAVX01531058.1 512 YCGGDSVTQLEPCLTVNEVEDVTLQCNYTTTSTSPYLFWYRHYPNRAPEYILRKDTSNKFPDHADFAKQRFSTNVSKEERTAPINIFQVRVADSARYYCALS
Callorhinchus milii Vs563 ighv AAVX01289040.1 2099 VQADLVLTQPPTLTGKTGQALRLTCETNGIDLSRNYTGWFRQLPGKQREKLLVHDGSSIESFGSGIENRVTVIREDSQSIFDLIIKCPTVHDTATYYCARG
Callorhinchus milii Vs290 trav AAVX01526195.1 143 RCGGDAVTQLQSTVTVNEEEDVSLQCNYTDTSGSGNLCLFWYRHYPNKSTEYILSTDTNNRIKKGADFAEERFSTNVSKAERTVPLNILQVRVTDSAGYHCALS
Callorhinchus milii Vs565 trdv AAVX01291071.1 949 LTQGDSVTQKVASVTGKEGGSVTMECHYDTSLSDYYLNWYREQQETQPHYVLQKGSDGDKDKADFAKKRFSIELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii Vs564 trav AAVX01289713.1 798 VSGQDVITQYPREKTEIEGQDVALNCNISRLDTVFWYRQNPGGALQHVLRIFTSGTVNKSPDLPERFTAELINKNKVIKLQILGAVVGDSDVYYCFLE
Callorhinchus milii Vs567 trav AAVX01292527.1 994 YCGGDSVTQLESALTVNEGEDVSLQCNYTTTSNTPYLFWYRHYPNRAPEYILWTYSRGQPQHADFAKERFSTKLDESRRTVRLSIVQVRVADSAAYYCALS
Callorhinchus milii Vs566 trdv AAVX01291276.1 1841 SSFTASQSPPEQTAFAGERINLHCKYSGICRQDFSVSWYRQSPGEGLKYLLHRNPSGEGGNPTGGHISASLDTAKNISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs54 trdv AAVX01036739.1 188 SSKAVSQSPPEHMSFAGENITLLCKVTACSGEDFSVSWYRQSPGEELRYLLHGKPSGEGGNPTGGHISASLDTAKNISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs26 trdv AAVX01022826.1 1436 LTQGDSVTQKVASVIGKEGGRVTMECHYDTSLSNYYLNWYREQKETQPHYVLQKYSGGHTDKADFAKKRFSIELQTSTKFTSLTTSLLELSDSAVYYCALE
Callorhinchus milii Vs23 trav AAVX01020024.1 2118 NSLQDIGNQTIAEIPVEEGKDVKLSCTLKKISDATDLHWYRQASRNAPVYILYSVAGKDYKSPDFQDRFSSNVDKTSEDFKLSIANVLITDSAVYYCAKR
Callorhinchus milii Vs22 trav AAVX01019955.1 326 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYLNQALKHLVTGKTGEQQKERITATMNYRVKGSHLSITGTEVTDAATYLCAVE
Callorhinchus milii Vs21 ighv AAVX01019803.1 366 VQADLVLKQPPYLTGKTGQALRLTCESSGFNLSIAHMSWYRQLPGKQQENLLQYEGSSIKSFGSGFENRVTVIREDSQSIFDLIIKCPTVHDTSTYYCKIK
Callorhinchus milii Vs20 trav AAVX01019121.1 390 IGGQVVVTQYPPEITEFEGQNVTLNCSYSTKVTAFWYMQNPDGALQYLFRIYASGKAENPPDRFVAELIEENKVIKLQIHWAVVGDSAVYYCALEP
Callorhinchus milii Vs222 trdv AAVX01292606.1 1330 LCVGDSVSQKAARMVKKEGEIAILQCTYSTTESYYYLYWYRHYPDKQPEFIIWRYSGNDDQVKGIGFGNRFSAQLQTSNSSTSLSISELVVSDSAVYYCALS
Callorhinchus milii Vs29 trdv AAVX01024211.1 1837 SNYTVSQSPPEQTAFAGERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRNPSGEGGKPTGDHISVSLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs51 trav AAVX01036215.1 1330 NSLQDIGNQTIAEISVEEGKDVKLSCTLKKISDANYLYWYRQASRNTPVYILYSIAGKDYMSPDFPDRFSSIVNKINEDFELSIVTVLIGDSAVYYCGKE
Callorhinchus milii Vs362 trdv AAVX01022842.1 1616 SSYTVSQSPPEQSAFAGERINLHYQYSGFCGQDFSVSWYRQSPGEELKYLLHRKSSGERRNPTGDHISASHDTAKKISVLTIADLRLTDSAMYHCA
Callorhinchus milii Vs361 trav AAVX01022745.1 1462 HCGGDSVSQLQSTVTVNEGGTVYLHCNYTTTSNIPNLFWYSHYPNKAPEYILNTYIRNNKQQRADFAKESFSTNVSQAETIVHMNILQVRVTDPAVYYCALS
Callorhinchus milii Vs360 trdv AAVX01022355.1 1729 SRFTVSQSPPEQTAFAGERINVHCQYSGFCGQNFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs368 trav AAVX01023771.1 953 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGNTGEQQKERITATMNYKEKGSNLSITGTEVADAATYLCAVE
Callorhinchus milii Vs346 trdv AAVX01010607.1 668 LCDGDSVSQKAAKMVKKEGEIEILQCTYSTTESYYYLYWYRHYPDKQPEFIIWRYSGDNQGKGTGFGNRFSAQLQTSNSSTSLSISELVVSDSAVYYCAFS
Callorhinchus milii Vs279 ighv AAVX01497492.1 264 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFSLSSYYMYWVRQVPGKGLEWLLRYYSPTDSYNAFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDSAIYYCARG
Callorhinchus milii Vs177 ighv AAVX01217395.1 505 VQAAVVMTQPPTLTRKTGQSLRLTCRSSGFYSSYYYCMFWYRQLPGKQREKLLTSIGYSSSSFESGFGNRVTVVRENSNRIFDLIIKSPRVEDTATYYCAAE
Callorhinchus milii Vs491 trav AAVX01178675.1 1870 VSGQDTVSQSPLSVTAEEKEEVLLSCSTTVSNQVLQWYTQYPKQALKHLVSGMTGEQQKERITATMNFRDGSSNLTITRTGVTDAATYLCAVE
Callorhinchus milii Vs490 trav AAVX01175452.1 613 LCDGDSVSQKAATMVKRKGETASFECTYSTTVSRYDLSWYRHYPDKQPEYIVRRYSGNTIQYRGTGFGNRFSAQLRKSISSTSLSISEMVVSDGAVYYCAFN
Callorhinchus milii Vs493 trdv AAVX01181822.1 1437 LTQGDSVTQKVTSVIGKEGGSVTMECHYDTSLSGYYLHWCREQQETQPQYVLQKGSRGSTYKADFAKKRFSAELQTSTKFTSLTISMLELSDSAVYYCALQ
Callorhinchus milii Vs492 trdv AAVX01178888.1 461 LTQGDSVTQKVASVTGKEGGSVTMECHYDTSLSSYYLKWYREQQETEPQYVLQKGSRGSTHIADFAKKRFSAELQTSTTFTRLTISLLELSGSAVYYCALQ
Callorhinchus milii Vs495 trdv AAVX01184232.1 1290 VVLGAPVRQQRAGLSKQEGDTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGINNTADYAKGRFASHLGKNQFQSTLIIPSVIVNDAATYYCALTSV
Callorhinchus milii Vs494 trdv AAVX01183608.1 1606 VCGGDSVSQKHSMMVMKEGETVTFQCTFSTTENSYSLFWYRHYPDKHPEFIVRRDSDDYEAKGDGIGNRFTSQLDTSKSVTKLSVSMLLLSDSAVYLCAVSPDI
Callorhinchus milii Vs499 trav AAVX01190701.1 1204 VVLGDSVREQTAGLSKQEGDTVSLSCSYITSSSYAALYWYRHHSGLAPQYILYRATNGNDNTADFAKGRFTSQVDKNQRQPTLSLSSVIVTDAATYYCGLRTE
Callorhinchus milii Vs669 trav AAVX01612996.1 438 VSGQDTVSQSPLSVTVGEKEEVLLSCSTTVSNQVLQWYRQYPKQDLKHLVAGKTGEQLKKRITATMNFREKGSNLSITGTEVTDAAIYLCAVE
Callorhinchus milii Vs666 trdv AAVX01602377.1 451 LCGGDSVSQKTTPMVRREGESVTFECSYSTTESYFYLFWYRHYKEKQPEFIISRYSHSDNPDKGKGFENRFSAELQKSNSFTSLSISELVLSDSAVYYCA
Callorhinchus milii Vs667 trdv AAVX01610111.1 699 SRFTVSQSPPEQTAFAGERINLHCQYSGFCGQDFSVSWYRQSPGETLEYLLHRKRSGEGGNPTGDHISASLDTAKKISILTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs660 trav AAVX01591234.1 805 HCGGVSVTQLQSTVTVNEGETVYLQCNYTATNNDNPYLFWYRHYPNKAPEYILNTYIRNNKQQPADFAKERFSTNVSQAETTVHMNILQVRVTDSAVYYCARS
Callorhinchus milii Vs661 trav AAVX01593512.1 628 IGNQPIAEISVEEDKDVKLCCALKKISDATYLYWYRQASRNGPVYILYCIAGKDYLSSDFPDRFSSNVDKTNEDFELSIVTVLISDSAVYYCAKE
Callorhinchus milii Vs129 trav AAVX01135751.1 309 VSGQDTVSQSPLSVTVGEKEQVIISCSTTESRALQWYRQYPNKTLKHLVTGPTGDQQKKRITATMNSREKGSNLSITGAEVTDAATYLCAVETQ
Callorhinchus milii Vs128 trbv AAVX01133869.1 436 LSLGALVTQRPRTVTAREGETVTLNCHQNNTAYQTMLWYLQPDQGGLTLIGYAVLSNPTYEKGFESGYNITQSNDKKKSSLEISSMNPTQEGVYYCAARE
Callorhinchus milii Vs121 trav AAVX01123633.1 523 KSLQDIGNQPIAEISVEEGKDVKLSCTLQKISDTSYLYWYRQVSRNAPVFILQSVAGKENKSPDFPDRFSSKVDKINEDFKLSIVTVLIMDSAVYYCAKE
Callorhinchus milii Vs120 trav AAVX01116144.1 347 YCGGDSVTQLQSTVTVNEGETVYLQCNYTATSDNNPYLFWYRHYANKAPEYILNTYIRNNKQQLADFAKERFSTNVSQAETTVHMNILQMRVTDSAVYYCALS
Callorhinchus milii Vs123 trav AAVX01127622.1 726 VSGQDVVSQYPREKTEIEGQDVILNCNISRLDTVFWYRQNPGGAPQYALRIFTSGKVSKSPDLPERFTAELIKENKVIKLQILGAVVGDSAVYYCAL
Callorhinchus milii Vs125 trav AAVX01131432.1 505 MSGQDTVSQSPLSVTVWQKEHVFISCSTTDTSQALQWYRQYPNQALSHLVTGKTGEQQKERITATMSYRDGKSNLSIRHTEVTDAATYLCAVE
Callorhinchus milii Vs276 trav AAVX01486852.1 305 VLAASDVSQTRQAMTVNENANVSMECSTTVTTPAFQWYKQYGNGSIRFLVLGKTDVNTKDRIRAFTERKQKNCTLAIEKVRMSDTATYFCAE
Callorhinchus milii Vs400 trav AAVX01041488.1 3170 VNGQDAVSQSPLSVTVAEKEEVLLSCSTTVSNQVLQWYRQYEKQALNHLVSGKTGEQLKERITATMNYRDESSNLSITDTEVTDAATYLCAVE
Callorhinchus milii Vs406 trav AAVX01052365.1 4316 YCGGDSVTQLQSTVTVHEGEAVYLQCNYTATSGSDTYLFWYRHYVNKAPEYILNTYIRNNKQQHADFAKERFSTNVSQAETTVHMNILQVRVIDSAGYYCALS
Callorhinchus milii Vs407 trav AAVX01052365.1 1598 VYGQDVVSQYPPEITDFEGQNVTLNCSYSSLQAAFWYRQYPDGTPQYLFRIYSSGNVDNPPDRFTADLTKENKVIELHILGAVVGDSTVYYCALE
Callorhinchus milii Vs43 iglv AAVX01031554.1 1821 GCDGFTLSQPRSIIAKSGKAAMISCTKSDMENDYVHWYRETPGKGLQWILYYHSGNKKENSPDFPRFSAHKSGDSCTLRIKSLTSDDSGIYYCGVWD
Callorhinchus milii Vs236 trbv AAVX01316438.1 438 LSLGALVTQWPETVTAREGETVTLRCHQDDSALDTMLWYIQPHQGGLTLIGYGFMSTPTIEDDKPDYKITQTDDYKNCSLEIKNVAQEGVYYCAARE
Callorhinchus milii Vs231 trav AAVX01308041.1 279 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSNLSIKGTEVTDAATYLCAVE
Callorhinchus milii Vs230 trdv AAVX01303611.1 821 SSSAVCQTQPQQAAFAGETVSLNCKYILFSEEDFIIYWYRQSHGETLKYLLQRKSSVEGGNPTRDCISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs334 trdv AAVX01004837.1 1478 LCDGNSVSQKAATMVKRKGETASFECTYSTTLSDYDLSWYRHYPDKQPEYIVRRYSGNENQYRGTGFGNRFSAQLHKSISSTSLSISVLVVSDSAVYYCAFS
Callorhinchus milii Vs337 trav AAVX01006017.1 2239 NSLQDIGNQPIAEISVEEGKDVKLSCTLQKISDTSYLYWYRQVSRNAPVFILQPVAGKDNKSPDVPDRFSSKVDKSNKDFKLSIVTVLIMDSAMYYCAKE
Callorhinchus milii Vs330 trav AAVX01002109.1 925 DLAESDFSQTPQAVTVNENGNVSIECSTTVNNPFFQWYKQHGKGSIRILVLGKSDVNMKERIRALAERKQKTCTLTIEDVQISDTAIYFCAE
Callorhinchus milii Vs331 trav AAVX01002699.1 3311 YCGGDSVTQLESALTVNEGQDVALQCNYTATSTTPYLFWYRHYPKKAPEYILWTYSRGQPQHEDFAKERFSTKVDESRTTVPLNIAQVRVADSAGYYCALS
Callorhinchus milii Vs332 trav AAVX01002699.1 997 VSGQDVVSQYPREITEIEGQDVALNCNISRLDTVFWYRQNAGRALQYALRIFTSGAVDKSPDLPERFTAELIKKNKVIKLQTLGAVVGDSAVYYCALE
Callorhinchus milii Vs333 trav AAVX01003426.1 849 HCGGDSVKQLESTLTVNEGEAVHMHCNYTTADNNPNLFWYRHYPNKAPEYILWASTYSKPKYADFAKERFSTNVSKAERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii Vs69 trav AAVX01052364.1 1702 VSGQDKVSQSPLSVSVGENEQVLISCSTTEQGRGLQWYRQYPNQALKHLVTGQTGEQQKERITASINYREKRSNLSITGTEVTDAATYLCAVE
Callorhinchus milii Vs63 trav AAVX01045670.1 3058 RCDGDTVSQKLPQIVRNERETATFECTFSTTGSHYHLLWYRYNREKHPEFIVVRFSWKNNQDRGKGFGDRFSAQLYKSSSFTSLSISELVVSDSAVYYCAFN
Callorhinchus milii Vs60 trav AAVX01042423.1 497 VSGQEKVYQSPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSNLSITGTEVTDAATYLCAVE
Callorhinchus milii Vs64 trav AAVX01045880.1 552 TTAAVTLTQPPSISTTPGHTVTIACTMSGGSLGSYYVSWYQRKPGSAPLFVWYQSGTTGQGIPDRFTGSKGSSNMHLTISGVQPEDAAEYFCGAEL
Callorhinchus milii Vs240 trav AAVX01326744.1 259 LSLGALVTQRPRTVTAREGETVSLNCHQNNKDYFIMLWYIQPHQGGLTLIGYNQYSTVYEDKFKSGYNMTKTPDNMNSTLEIANINPTQEGVYYCAARE
Callorhinchus milii Vs241 trav AAVX01326845.1 325 YCGGDSVTQLESFLTVNEGEDVSLQCNYTTTSNTPNLFWYRHYPNKAPEYILWTYGRGQPQHADFAKERFSTKLDESRRTVPLNISQVRITDAAAYYCALS
Callorhinchus milii Vs534 ighv AAVX01240989.1 649 VQADVQHLTQPPSLTGKPGHPLRLTCKTSGFDLSSYTMHWVRQVPGKGLEWLLYYYSSSSKGFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARG
Callorhinchus milii Vs535 trav AAVX01243239.1 1011 YCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSGYNTDLFWYRHFPNKSPEYILSTDNNNRIKKGADFAEERFSTNVSIAERTVPLNILQVRVRDSAGYYCALS
Callorhinchus milii Vs244 trav AAVX01332044.1 354 VLAASDVSQTPQAVTVNENGNVSMECSTTVNNPLFQWVKHYGNGSIRFLVLGKTDVNMKGRIRALAERKQKNCSLTIEDVRISDTAIYFCAE
Callorhinchus milii Vs533 iglv AAVX01238722.1 1168 GCDGFTLSQPRSVIVKSGSIARITCTKNNIDNDYVHWYRENPGKGLQWILYYHSENKKDNSPDFLVYSAHKSGDSCTLRIKSLTSDDSGIYYCGVWD
Callorhinchus milii Vs530 trdv AAVX01235307.1 913 VVVGDSFREQTAGLSKQEGDTVSLSCSYTTSSPYAALYWYRHHPGLAPQYILYRDTDGNDKTADFAKGRFTSQVDKNQKHTTLSISSVIGTDAATYYCGLTT
Callorhinchus milii Vs247 trdv AAVX01346414.1 192 LTQGDSVTQNVASVIGKEGGSVTMECHYDTSLSNYYLNWYREKQETQPQYVLQQHSGGSTYKADFAKKRFSIELQISTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii Vs248 iglv AAVX01349297.1 54 VSGEIIMTQTPSMLPVTVGQTATITCKASSSISKYLSWYQQKAGDRPKLLIYYGTTLYTGTPARFSGHQSSTTFTMTITGVQPEDFADYYCMQSYSN
Callorhinchus milii Vs538 trav AAVX01248444.1 544 VHAEINVSQRPQAVTENENGNVSVECTNTESTNAIQWYTQYGNRSIRFLVLGTRDINVIDRISALAIPGQRNCTLTIQNLRVTDTATYFCAA
Callorhinchus milii Vs622 ighv AAVX01449662.1 714 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYGMSWVRQVPGKGLEWLLYYYKPSHSYNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARE
Callorhinchus milii Vs623 trdv AAVX01450667.1 596 SSYTVSQSPPEQTAFAGERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTRDHISASLDTAKKISVLTIAELRLTDSAMYHCALS
Callorhinchus milii Vs621 trav AAVX01443696.1 398 PSHQDSVAMKVSSISKREGDTVIVECTYSTHNTSYIIYWYRQYGDGIPEFIIWKYSGGNEAKADWAKSRFSVALLKSNTTVQLMVSQLQVADSVRYHCALR
Callorhinchus milii Vs626 trdv AAVX01461277.1 333 VVVGDSVREQTAGLSKQEGDTVNLSCSYTTSSTYAALYWHRHHPGLAPQYILYRATNGNDNTADFAKGRFTSQLDTNQRKTTLSISSVIVTDAATYYCGLTT
Callorhinchus milii Vs625 iglv AAVX01458651.1 495 GCDGFTLSQPRSMIGKSGKAARITCTKNNIGNDDVHWYRETPGKGLQWILYYHSGNKKENSPDFSSRFSADKGGDSCTLTIIGLTSDDSGIYYCGVWD
Callorhinchus milii Vs628 trdv AAVX01471613.1 467 LCDGASVSQKAVPMVRKEGETVTFECTYSTSYSSYNLCWFRRYPGNQPEFIVRRYSRDDNQYKGTGFGNRFSAQLQKSKSFTSLSISELVVSDSAVYYCAF
Callorhinchus milii Vs629 ighv AAVX01474776.1 818 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYYMHWVRQVPGKGLEWLLRYYSSSSNAFAPGIEDRVTVIKDNSNNIFDLIIKSPRVDDTAIYYCARE
Callorhinchus milii Vs578 ighv AAVX01308270.1 509 VQADVVLTQPPSLTGKPGHPLRLTCKTSGFDLSSYRMHWVRQVAGKGLEWLLHYYSPTSSYNAFAPGIEDRVTVIKENSKNIFDLIIKSPRVDDTAIYYCARG
Callorhinchus milii Vs198 trdv AAVX01249503.1 2809 SSYTVSQSPPQQTAFAGERINLNCQYSGFCGQDFSVSWYRQSPGDGLKYLLDRKTSGEEGNPNDNNISASLDTAKKISILTIAGLRLTDSAIYHCALS
Callorhinchus milii Vs478 ighv AAVX01154576.1 1153 VQTAVVMTQPPTLTGKTGQSLRLTCRSSGFNYNRYYCMYWYRQLPGKQREKLLTSDCYSSNSFESGVGNRVTVVREDNNKIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs190 trav AAVX01233466.1 593 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNRPPEYILSTDTNNRIKKGADFAEERFSTNVSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii Vs191 ighv AAVX01233836.1 395 VQAAVVMTQPPTLTGKTGQALRLTCRSSGFSSYYYYCMFWYRQLPGKQREKLLTSDTYSSNSFESGFGNRVTVVRENSNRIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs193 ighv AAVX01235728.1 1452 VQADLVLKQPPYLTGKTGQALRLTCESSGFILNITHMSWYRQLPGKQQENLLKYEGSSIKSFGSGFENRVIVIREDSESIFDLIIKCPTVHDTSTYYCEIK
Callorhinchus milii Vs194 trbv AAVX01239819.1 517 LSLGALVTQGPRTVTAREGETVSLNCHQDDSSLYTMLWYIQPHQGGLTLIGYNQYSTTYEDKFKSGYNITKTPDNMNSTLEIANMNPTQEGVYYCAARE
Callorhinchus milii Vs195 trdv AAVX01242365.1 816 LCDGDPVSQKAASMVKRKGETASFKCPYSTTLSSYDLSWYRHYPEKQPGVIVRRNSGNENQYRGAGFGNRFSAQLHRSNSSTSLSISELVVSDSAVYYCAFN
Callorhinchus milii Vs196 trav AAVX01243408.1 3733 ICGGDSVTQLQSIVTVTEGEDVALQCNYTVANTGSDYLFWYRHFTNKAPEYILRTSTKNRNKDHADFAKERFSTNVSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii Vs197 iglv AAVX01247550.1 1865 GCDGFTLSQPRSMIVKSGKAAMITCRKSDMENDYVHWYRETPGKGLQWILYYHSEDKKDNSPDFPRISAHKSGDSCTLRIIRLTSDDSGIYYCGVWD
Callorhinchus milii Vs176 trdv AAVX01216954.1 86 LCDGNSVSQKAVTMVKKEGEIVILQCTYSTTGSYYYLYWFRHYSDKQPEFIIWKYSGSDNQDKGIGFGNRFTAHLQKSNSFISLSISELVVSDSAVYYCAFI
Callorhinchus milii Vs278 trav AAVX01496328.1 555 VSGQDVVSQYPREQTEIEGQDVALNCNISRLATVFWYRQNPGGALQYALRIFASGTVDKSHDLPERFTAELIKENKVIKLHILGAVVGDSAVYYCALT
Callorhinchus milii Vs174 ighv AAVX01215682.1 1415 VQAAVVMTQPPTLTGKTGQSLRLTCRTSGFYSNWYYCMFWYRQLPGKQREKLLTSDTYSSNSFESGFGNRVTVVRENSNRIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs175 trdv AAVX01216742.1 526 VVLGDSVRQQTAGLTKQEGDTVSLSCSYTTSSSCAALNWFRHQPGLAPQYVLYRDTAGGSNTADFAARRFSSQLNKNQRQTTLIIRSVVITDAATYYCGLTS
Callorhinchus milii Vs170 trav AAVX01210605.1 118 LCGADTVSQQAATMVWKKGDTVTFNCTFSTNESAFFLFWYRQYPVKKPEFMVWRFSYNNKETKGAAIGNRFSSQLDILQSVTRLSISELQMSDSAMYLCA
Callorhinchus milii Vs171 trdv AAVX01211395.1 272 LCDGDPVSQKAASMVKRKGETASFECPYSTTLSSYDLAWYRHYPEKQPGVIVRRNSGNENQYRGAGFGNRFSAQLHKSNSSTSLSISELVVSDSAVYYCAFN
Callorhinchus milii Vs271 trav AAVX01473283.1 185 FSGQDVVSQYPREKTEIEGQDVILNCNISRLNTVFWYRQNSGGALQYALRILTTGTVNKSPDLPERFTAKLINKNKVTKLQILGAVVGDSAVYYCALD
Callorhinchus milii Vs270 trdv AAVX01472629.1 221 TVNGVSVQPSQMEVSVPEGQTATLSCNYSADFSNVFMYWYRQYPGEPPLYTRRHDYDGETFSAEFAKQRFSTTLDTNTKRSSVTVLSVALSDTATYYCA
Callorhinchus milii Vs274 trav AAVX01484122.1 118 VGGQNIVSQYPPEITDFEGKDVTLKCNISRLDTAFWYRQCPDGNLHYLFKIYTSGKVDKSPDLPERFTAELIKENKVIKVQILRAVVGDSAVYYCAQE
Callorhinchus milii Vs277 trav AAVX01491417.1 211 HCGGDSVTQLQSTMIVNEGEFVYLQCNYTAASTTNNYLFWYRHFPNKSPEFILSTSSNNRIKQDADFAKERFSVNVDEMGRTVQLKVLQVRVTDSAGYYCALS
Callorhinchus milii Vs179 trav AAVX01218422.1 584 FSGQDVVSQYPREKTEIEGQDVILNCNISRLNTVFWYRQNSGGALQYALRILTTGTVNKSPDLPERFTAELINKNKVTKLQILGAVVGDSAVYYCALD
Callorhinchus milii Vs284 trbv AAVX01510869.1 117 LSLGALLTQWPRTVTAREGETVTLRCSHNDKSLDTMLWYLQPHQGGLTLIGYNRFSTAYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE
Callorhinchus milii Vs287 trdv AAVX01511899.1 68 LTLGDSVTQKVASVIGKEGGSVTMECHYDTSLSNYYLKWYREKQETQPQYVLQQHSGGSTYKADFAKKRFSIELQISTKFSSLTISLLQLSDSAVYYCALQ
Callorhinchus milii Vs280 trbv AAVX01500143.1 152 LSLGALVTQGPRTVTAREGETVSLRCSHNDKSLDTMLWYIQPHQGGLTLIGYNRYSTEYEDKFKSGYNITKTPDNMNSTLEISSMNPTQEGVYYCAARE
Callorhinchus milii Vs281 trbv AAVX01500144.1 52 LSLGALVTQRPRTVIAREGETVSLRCRQDDSSVYTMLWYIQPHQGGLTLIAYVSASTPNYEKGFESDYKVNQTSNRKESFLEISRLTPTQEGVYYCAARE
Callorhinchus milii Vs288 trdv AAVX01514685.1 555 VVVGDTVREQTAGLSKQEGDTVSLSCSYTTSSSYAALYWYRHHPGLAPQYILYRTTNGNIYRADFAKGRFTSQLDTNQRKTTLSISSVIVTDAATYYCGLTT
Callorhinchus milii Vs289 trdv AAVX01517456.1 451 LTEGDSVTQKVGSVTGKEVGSVTMECHYDTSLSSYYVNWYREKQEAQLQYVLQKGSRGSTDIADFAKKRFSAELQTSTNFTSLTISLLELSDSAVYYCALQ
Callorhinchus milii Vs473 trav AAVX01138040.1 506 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSHLSITGTEVTEAATYLCAVE
Callorhinchus milii Vs471 trdv AAVX01128822.1 843 LTHGDSVTQKVASVTGKEGGSVTMECHYDTSLSSYFLHWCREQQEKQPQYVLKKGSGGDTYKADFAKKRFSAELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii Vs470 trdv AAVX01128421.1 993 SSYTVSQSPPEQSAFSGERINVHCQYSGFCGQDFSVSWYRQSPGEGLKYLLHRNPSGEGGNPTGGHISASLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs476 trav AAVX01151010.1 510 YSGGDSVTQLQSTAAVNEEEDVYLQCNYTATSTIDPYLFWYRHYPDKSPEYILITDSSNKFPDHADFAKGRFSTNVSKGERLVPLNISQVRVTDSAEYYCALS
Callorhinchus milii Vs474 trav AAVX01144896.1 652 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATGEYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADFAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii Vs573 trdv AAVX01301234.1 1515 SRYTVSQSPPEQTAFAGETINVHCQYSGFCGQDFSVSWYRQSPGETLKYLLHRNPSGEGGNPTGDHISASLDTAKKISDLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs570 trdv AAVX01297307.1 932 SSSAVCQTQPQQAAFAGETFPLHCKYILFSEEYFIIYWYRQSSGEEMKYLLQKKSSVEGGNPTGERISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs571 trdv AAVX01298009.1 938 LTHGDSVTQRVASVIEKEGRSVTMECHYDTSLSGYYLHWYRDQKETQPEYVLQKGSGGFTDIAEFAKKRFISQLQTSTKFTILTISLLELSDSAVYFCALQ
Callorhinchus milii Vs576 trdv AAVX01305949.1 1584 LCDGDSVSQKAANMIKKEGEIAMLQCTYSTTESDCFLYWYRHYPDKQPEFIIRRYSGNDNQEKGTGFGNRFTAQLQKSNSTTSLSISELVVSDSAVYYCVFS
Callorhinchus milii Vs577 trdv AAVX01306339.1 1271 SKYTVSQSPPEQTAFAGERIHLHCQYSGFCGQDFSVSWYRQSLGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSAVYHCALS
Callorhinchus milii Vs574 trav AAVX01302019.1 1747 YCGGDSVTQLESFLTVNEGEDVSLQCNYTTTSNTPYLFWYRHYPNRAPEYILWTYSRGQPQHADFAKERFSTKVDESRRTVPLSIAQVRVADSEVYYCALS
Callorhinchus milii Vs575 trdv AAVX01305908.1 425 SSQTVSQSPPEQAAFTGERINLHCQYSGFCGQDFSVSWYRQSPGEELKYLLHRKPSGEGGNPTGGHISASLDTAKKISVLTIADLRLSDSAMYHCALS
Callorhinchus milii Vs305 ighv AAVX01562861.1 357 VQADVVLTQPPSLTGKPGHPLRLTCKTSGFDLGSDRMHWVRQVPGKGLEWLLHYYSSSNSGFAPGIEDRVTVIKEDSKNVFDLIIKSPRVDDTAIYYCARD
Callorhinchus milii Vs304 trav AAVX01558910.1 547 YCGGDSVTQLESALTVNEGQDVALQCNYTATSTTTPNLFWYRQYPNKAPEYILWTYSRGQPQHTDFAKERFSTKVDESRRTDPLNIAQVRVADSAGYYCALS
Callorhinchus milii Vs307 trdv AAVX01575197.1 422 VVLGDSVRQQMAELSKQEGDRVSLSCSYTTSSSYATLYWYRHHPGLAPQYILYRDTAGGSNTADFATGRFSSQLNKNQRQTTLIIRSVVITDAAAYYCGLTS
Callorhinchus milii Vs301 trdv AAVX01556254.1 660 SSCTVSQSPPEQTAFAGERINLHCQYSGSCGQNFSVSWYRRSPGEGLKYLLHRNPSEEGGNSNGDHISASLDTAKKICVLTITGLGLTDSAMYHCALS
Callorhinchus milii Vs303 trav AAVX01558785.1 134 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATGEYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADFAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii Vs309 trav AAVX01580079.1 374 VLGQDVVSQYPPEITDIEGKDVTLKCNISTLSTAFWYKQYPDGNLHYLFRIYTSGKVDKSPDLPERFTAELIKENKVIKLQILGAVVGDSAVYYCALE
Callorhinchus milii Vs308 trbv AAVX01576959.1 376 LSLGALVTQLPRTVTAREGETVTLRCYQKDSALNTMLWYLQPHQGGLTLIGYGYASNPTMEDAYKLDYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii Vs12 trdv AAVX01013919.1 1617 ICDGDSISQKAATTVKIEGQSEVIECTYSTTVGYYYLFWYRHYPDQQPEFIFRSYSNRDNPVKGPGFGNRFTAVLHKSISFTGLTISELVLSDSAVYYCAFSL
Callorhinchus milii Vs17 trav AAVX01017784.1 1187 VSGQDTVSQSPLPVTAGEKEQVIISCSTTESQVLQWYRQYPNQTLKHLVTGQTGEQQKERITATMNYREKGSNLSITGTEVTDAATYLCALETQ
Callorhinchus milii Vs15 trdv AAVX01017112.1 283 TANGVSVQPSQMEVSVAEGQTATLSCTYSADFSNVFIYWYGQYPGEPPLYTRRHDYDGETFSAEFAKQRFSTTLDTNTKRSSVTVLSVALSDTATYYCA
Callorhinchus milii Vs18 trav AAVX01018255.1 612 NSLQDIGNQTIAEIPVEEGKDVKLSCTLKKISDANYLYWYRQASRIAPVYILYSISGKDYMSTVFPHRFSSTVNESHEDFELSIVTVLIGDSAVYYCAKE
Callorhinchus milii Vs371 trav AAVX01025369.1 3509 DSATQLQSAVTVNEGEVVYLQCNYTAASTSDPYLFWYRHYPNKAPEYILRTDTSNKFPDHADFAKGRFSTNVSKVERTVPLNISQVRVTDSAGYYCALS
Callorhinchus milii Vs372 trav AAVX01025369.1 1127 VSGQDVLSQYPREKTEIEGQDVRLHCSISRLDTVFWYKHNPDGALKYVLRIFTSGKVYKSSDLPERFTAELIKKNKVIKLQILGAVVGDIAVYYCALE
Callorhinchus milii Vs375 trav AAVX01026766.1 598 VSGQDVVSQYPRGKTEIEGQDVAVNCNISRLDTVFWYRQNPGGALQYALKIFTSGKVSKSPDLPERFTAELIKENKVIKMQILSAVVGDSAVYYCALD
Callorhinchus milii Vs376 trav AAVX01027382.1 2783 IFAESAVSQRPQTVTENENRNLSVECTNTESTTAFHWYKQFGNGSIRLFVLGTKDINVKDRIRALANTRQRNCTLTIQNLRVSDTATYFCAA
Callorhinchus milii Vs378 trav AAVX01029114.1 509 VKLGDSVRQQTAGLSKQEGDTVSLSCSYTTSSSYAALNWFRHHPGLAPQYVLYRDTAGGSNTADFAARRFSSQLDEIQRQTTLIIRSVVITDAAAYYCGLTS
Callorhinchus milii Vs379 trdv AAVX01029308.1 1925 FCDGDSVTQKAATMVKKERETVILQCTYFTTENDYVLHWYRHYRGKQREFIIWRYSGSELEEKGVGFGNRFSAQLHKSNSSTSLSISELAVSDSAVYYCAFSL
Callorhinchus milii Vs338 trdv AAVX01006305.1 1814 SSYTVSQSPPEQTAFAGERINLHCQYSGICGQDFSVSWYRQSPGEALKYLLHRKPSGEGGNPTGDHISVSLDTTKKISVLTIADFRLTDSAMYHCALS
Callorhinchus milii Vs239 trav AAVX01325901.1 318 VLAASDVAQTPQAVTVNENRNVSMECSTTVNNPVFQWYRQYGNGSIHFLVLGKSDVNMKDRIRALAERKQKNCSLAIKDVRISDTATYFCAE
Callorhinchus milii Vs238 trav AAVX01322699.1 521 LSLGALVTQEPRTVTAREGETVSLRCSQHDSPLNTMLWYIQPHQGGLTFIGYNQYSTIYEDKFKSGFNITKTPDRMNSTLEISNMNPTQEGVYYCAARE
Callorhinchus milii Vs482 ighv AAVX01163047.1 518 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYWMHWVRQVPGKGLEWLLMYYSSSNKYFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARD
Callorhinchus milii Vs480 trav AAVX01156348.1 642 HCGGVSVTQLQSTVTVNEGETVYLQCNYTATNNDNPYLFWYRHYPNKAPEYILNTYIRNNKQQPADFAKERFSTNVSQAETTVHMNILQVRVTDSAVYYCARS
Callorhinchus milii Vs487 trbv AAVX01169633.1 1942 LSLGALVTQWPRTVTAREGETVSLNCHQDDSSLYTMLWYIQPHQGGLTLIGYNEHSTIYEDKFKSGYNITKTTNRMNSTLEISSMNPTQEGVYYCAARE
Callorhinchus milii Vs484 trav AAVX01163628.1 2127 NSLQDIVNQPIAEISVEEGKDVKLSCTLKKISDAYSLFWYRQTSRNALVYILLSVVGKDNKSPDFPDRFTSNVDKTSEDFKLSIATVLIGDSAVYYCAKE
Callorhinchus milii Vs485 trav AAVX01167751.1 674 VHAEIIVSQRPQAVTENENGNVSVECTNTESTNAIQWYTQYGNRSTRFLVLGTRDINVIDRISALAIPGQRNCTLTIQNLRVTDTATYFCAA
Callorhinchus milii Vs488 trbv AAVX01172356.1 878 LSLGALVTQRPRTVTAREGETVTLRCYQNNTKYETMLWYLQPHQGGLTLIGYGYYSTPTMEDAYKLDYEVKQTDDYKNCSLEIKNPTQEGVYYCAARE
Callorhinchus milii Vs561 trav AAVX01286360.1 1107 VVLGDSVTQQTAGLSKQEGGTVSLSCSYTTSSNYAALYWYRHHPGLGPQYILYRHTNGVDNTADYAKGRFTSHLDKNQEQTTLIILSVIVTDSAAYYCGLRPD
Callorhinchus milii Vs659 trgv AAVX01588996.1 743 ECDAQKLTQPALSTRKYSGKIVLFACKVEEVSFSSASIHWYRQTKHEALKRILYIQSELNPIREDGFDARFSAEKVENEKSCNLIIKGIELKDAGIYYCAYWD
Callorhinchus milii Vs658 ighv AAVX01587302.1 647 VQAEVVLTQPPSLSGKPGHPLRLTCKTSGFNLGSYYMSWVRQVPGKGLEWLLWYYSSSSNAFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARG
Callorhinchus milii Vs653 ighv AAVX01560961.1 874 VQTAVVMTQPPTLTGKTGQSLRLTCRSSGFNYNRYYCMYWYRQLPRKQREKLLTSDCYSSNSFESGVGNRVTVVREDNNKIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs652 ighv AAVX01556179.1 440 VQAEVVLTQPPSLSGKPGHPLRLTCKTSGFNLGSYYMSWVRQVPGKGLEWLLWYYSSSYKYFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARE
Callorhinchus milii Vs651 ighv AAVX01550794.1 689 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYGMSWVRQVPGKGLEWLLGYYTSSSNAFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARG
Callorhinchus milii Vs657 ighv AAVX01584715.1 353 VQAEVVLTQPPSLTGKPGHNVRLTCKTSGFNLGSYWMSWVRQVPGKGLEWLLRYYSSSNKYFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARE
Callorhinchus milii Vs655 trav AAVX01572129.1 622 LCDGDSVSQKAATMVKRKGETASFECTYSTTLSDYRLSWYRHYPDKQPEYILRRYSGNENQYRGTGFGNRFSAQLHKSISSTSLSISVLVVSDSAVYYCAFRP
Callorhinchus milii Vs654 trav AAVX01564258.1 736 VSGQDAVSQSPLPVTVGEKDEVLLSCSTTVSNQVLQWYRQYPKQALKHLVSGKTGEQQNKRITATMNYREKGSNLSITGTEVTDAATYLCAVE
Callorhinchus milii Vs139 trav AAVX01151794.1 1351 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNKSPEYILSTDTNNRIKNGADFAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii Vs132 trdv AAVX01137613.1 185 TANGASVQPSQMEVSVPEGQTATMSCTYFADFSNVFMYWYRQYPGEPHLYTRRHDYDGETFSAEFAKQRFSTTLDTNTKRSFVTVLSVALSDIATYYCA
Callorhinchus milii Vs133 trav AAVX01138425.1 748 VYGQDVVSQYPPEITDFEGQNFTLNCSYSTLQTAFWYRQYPDGAPQYLFRIYSSGKVDNPPDRFTTELIKDNKVIELHILGAVVGDSAVYYCALD
Callorhinchus milii Vs136 trav AAVX01142128.1 1979 HCGGDAITQLQSTVTEREDVYLQCNYTATSEYNTYLFWYRHFPNKSPEYILSTDTNNRIRKGAEFEEESFSRNVSQAERTVPLNVLQVRVTDSAGYYCALS
Callorhinchus milii Vs137 trav AAVX01144854.1 619 VSGQDVVSQYPREKTEIEGQDVALNCNISRLNTVFWYRQNSGGALQYALRILTTGTVNKSPDLPERFTAKLINKNKVIKLQILVAVVGDSAVYYCALD
Callorhinchus milii Vs134 trav AAVX01141724.1 1369 VSLQDIGNQPIAEISVEEGKDVKLSCTLKKISDASSHYWYRQASRNAPVYILYSIAAKDYLSSDFQDRFSSKVNKTNEDFELSIVTVLISDSAVYYCAKR
Callorhinchus milii Vs135 trav AAVX01142128.1 405 VSGQDVVSQYPREKTEIEGQDVALNCNISRLATVFWYRQNPDGDPQYALRIFTSGTVDKSPDLPERFTAELIKENKVTKLQILGAVVGDSAVYYCALD
Callorhinchus milii Vs437 trav AAVX01086567.1 757 YCGGDSVTQLESALTVNEGEDVSLQCNYTATSITTPYLFWYRHYPNRAPEYILWTYSRGQPQHADFAKERFSTKLDESRRTVPLNISQVRITDSAAYYCALS
Callorhinchus milii Vs436 ighv AAVX01085807.1 473 VQTAVVMTQPPTLTGKTGQSLRLTCRSSGFNYNRYYCMYWYRQLPGKQREKLLTSDCYSSNSFESGVGNRVTVVREDNNKIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs435 trav AAVX01085679.1 319 TNADITLTQPPSISSSPGNTVKITCTMSGGSIGNFYASWYQQKPDGAPVFVWYQSGTTGQGIPDRFTGSKESSNIHLTISGVQPEDAADYYCGAWYSGSP
Callorhinchus milii Vs434 trdv AAVX01084194.1 609 SSFTASQSPSEQTAVAGERINLHCQYSGFCGQNFSVSWYRQSPGETLEYLLHRNPSGEGGKPTGGHISVSLDTAKKSRVLTIAELRLTDSAMYHCALS
Callorhinchus milii Vs432 trav AAVX01081433.1 740 VGGQNIVSQYPPEITDFEGKDVTLKCNISRLDTAFWYRQCPDGNLHYLFKIYTSGKVDKSPDLPERFTAELIKENKVIKMQILRAVVGDSAVYYCAQE
Callorhinchus milii Vs430 trav AAVX01073212.1 988 NSLQDIGNQTIAEIPVEEGKDVKLSCTLKKISDAGYHYWYRQASRNAPIYILYSVAGKDYKSPDFQDRFSSNVDKTSEDFKLIIANVLIRDSAVYYCAKR
Callorhinchus milii Vs439 trav AAVX01087526.1 343 LCVGDSLCQKAATVVQKERETVTLQCTYSTTQSAHGLFWYRNDQDKQPEFIIRRDTRNDSHVSATGFGKSFYAKLHKSISTTSLSISALVLSDSAVYYCAINL
Callorhinchus milii Vs438 trbv AAVX01086950.1 1307 LSLGVLVTQGPRTVTATEGETVSFTCYQNDSALDTMLWYIQPHQGGLTLIAYIYMSPTYEKGFESGYNMTKTTNDKESTLEISSLNPTQEGVYYCAARE
Callorhinchus milii Vs678 ighv AAVX01635580.1 696 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYWMHWVRQVPGKGLEWLLWYYTSSSNAFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARG
Callorhinchus milii Vs224 trav AAVX01294327.1 266 DLAESDVSQTPQAVTVNENGNVSMECSTTVNNPFFHWYKQHGKGSIRFLVLGKSDVNMKDRIRALAERKQKNCTLTIEDVQMSDTAIYFCAE
Callorhinchus milii Vs225 trav AAVX01294700.1 559 RCGGESVTQLQSIVTVTEGEDVSLQCNYTATGGISDYLFWYRHYSIIAPEYILSTDTNNRIKDEADFAKERFSTNVSKAERTVPLNIFQVRVTDSAEYYCALS
Callorhinchus milii Vs52 trav AAVX01036550.1 764 NSLQHIGNQPIAEISVEEGKDVKLSCALKKISDAYSLFWYRQASRNAPVYILLSVAGKDNKSPDFQQRFSSKVDKTKEDFKLSIATVLIGDSAVYYCANE
Callorhinchus milii Vs223 trav AAVX01292850.1 247 NSLQDIGNQPIAEISVEEGKDVKLSCILKKISDAYSLFWYRQASRNAPVYVLYSVGRIDYRSPDFPDRFSAKVNETIEDFELSIVTVLVRDSAVYYCAKR
Callorhinchus milii Vs50 ighv AAVX01035830.1 246 VQADLVLKQPPYLTGKTGQALRLTCESSGFNLSIAHMSWYRQLPGKQQENLLQYDGSSIKSFGSGFENRVTVIREDSQSIFDLIIKCPTVHDTSTYYCEIK
Callorhinchus milii Vs221 trav AAVX01291618.1 1081 VSGQDVASQYPREKTEIEGQDVILNCNISRLATVLWYRQNPGGALRYELRIFASGKVDKSPDLPERFTAELIKENKVIKLQILGAVVGDSDVYYCALEP
Callorhinchus milii Vs341 trav AAVX01008298.1 681 RGGGDGVTQLRSIVTVTEGEDVSLQCNYTVANTGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHADFAEERFSTNVSKSEKTVPLNILHVRVADSAGYYCALS
Callorhinchus milii Vs340 trav AAVX01008298.1 2604 VSGQDTVSQSPLPVTVAEKEQVIISCSTTESRALQWYRQYPNQALKHLVTGQTGEQQKERITATMNYRDGRSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii Vs343 trav AAVX01008566.1 1924 VSGQDVVSQYPREQTEIEGQDVPLNCNISRLDTVFWYRENPGGALQYALKIFTSGKVSKSPDLPERFTAELIKKNKVIKLQILGAVVGDSAVYYCALD
Callorhinchus milii Vs345 trdv AAVX01009951.1 1455 DSVSQDYSSVNLEMGQRFEANCPYSTTAQRYDLFWYQQYSGKTPQMVLWRSASNSNGKGKDISHRFSSKMSKPDKICFITITDVQLGDSAMYYCAFALSVS
Callorhinchus milii Vs344 trav AAVX01009083.1 1555 QCGGDAITQLQSTVTVTEVEDVYLQCNYKATSEYNTYLFWYRHFPNKPPEYILSKDTNNRNKDGADFAEERFSTNVSKAERTVSLNILQVRVTDSAVYYCALS
Callorhinchus milii Vs168 trav AAVX01208523.1 169 VSGQDVVSQYPREKTEIEGQDLALNCNVSRLDTVFWYRQNPGGALQYALRIFSSGTVDKSSDLPERFTAELIKKNNVIKLQILSAVVGDSAKYYCSLD
Callorhinchus milii Vs213 ighv AAVX01274489.1 411 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFSLSSYWMSWVRQVPGKGLEWLLMYYSSSSNGFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARD
Callorhinchus milii Vs676 ighv AAVX01634101.1 884 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYYMSWVRQVPGKGLEWLLSYYSSSYKYFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARE
Callorhinchus milii Vs503 trav AAVX01197341.1 439 VLAESDVSQSPQVVTGNENGNVSMECNTTGYSPTFQWYKQYGNGSIRFLVLGKSEVNVKDRIRASTNTKEKNCTLTIKNVRLTDTATYFCAD
Callorhinchus milii Vs502 trav AAVX01196943.1 1100 YCGGDSVTQLQSAVTVNEGEAVYLQCNYTATTGSDAYLFWYRHYPNKAPEYILNTYIKNNKQQRADFAKERFSTNVSNAERTVHLNIFQVRVTDSAVYYCSLS
Callorhinchus milii Vs501 iglv AAVX01195080.1 354 GCDGFTLSQPRSMTGKSGKVARITCTKNDMGNDYVHWYRENPGKGLQWILYYHSENKKDNSPDFLGFSADKNRDSCTLKIKSLTSDDSGIYYCGVWD
Callorhinchus milii Vs500 trdv AAVX01193873.1 741 LTLGDSVTQKVASVIGKEGGSVTMECHYDTSLSNYYLKWYREKQETQPQYVLQQYSGGSTYKADFAKKRFSIELQISTKFSSLTISLLQLSDSAVYYCALQ
Callorhinchus milii Vs507 trbv AAVX01205070.1 759 LSLGALVTQRPRTVIAREGETVTLRCRQDDSSVYTMLWYIQPHQGGLTLIAYVSASTPNYEKGFESDYKVNQTSNRKESFLEISRLTPTQEGVYYCAARE
Callorhinchus milii Vs505 trdv AAVX01202266.1 938 LTQGDSVTQKVASVTGKEGGSVTIDCHDDTSLSDYYLHWYREQQERQPQYMLKKYSNGNTYKADFAEKRFSVELQTSTKSCCLTIFLLELSDSAVYYCALQ
Callorhinchus milii Vs504 trav AAVX01201770.1 1261 HCGGDAVTQLQSTVTVNEGEAVHLQCNYTNTSTFPDLFWHRHYAKKAPEYILWTDKRNNPRQADFAKDRFTTHVDEAERTVPLSISQVRFTDSTVYYCALS
Callorhinchus milii Vs509 trav AAVX01209950.1 1010 VYGKDVVSQYPPEITDFEGQNVTMNCSYSTINVAFWYRQYPDGAPQYLFRIYSSGKVDNPPDRFTAELIKENKVIKLQILSAVVGDSAVYYCALN
Callorhinchus milii Vs536 ighv AAVX01243964.1 1376 VQADVVLTQPPTLTGEPGQALRLTCKTSGFDLSTSWMDWIRQVPGKGLEWLLSYYNPSNKNYAPGIENRVTVIKEDSKNIFDLIIKSPRVNDTAIYYCVRG
Callorhinchus milii Vs537 trav AAVX01244889.1 841 HCGGDSVTQLQSTLTVNEGDDVSLQCNYTARSGSGNNYLFWYRHYPNKAPEYILRKDTSNKLPDHADFAKERFSTDVSKAERTVPLNIIQVRVADSAGYYCALS
Callorhinchus milii Vs243 ighv AAVX01331979.1 427 VQAEVVLTQPPSLSGKPGHPLRLTCKTSGFNLGSYYMSWVRQVPGKGLEWLLWYYSSSYKYFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARE
Callorhinchus milii Vs246 trdv AAVX01343167.1 39 SNYTVSQSPPEQTAFAGERTNLHCQYSGYCGQDFSVSWYRQSPGETLEYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIADLRLTDSALYHCALS
Callorhinchus milii Vs531 ighv AAVX01237653.1 391 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYGMSWVRQVPGKGLEWLLYYYKPSHSYNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARE
Callorhinchus milii Vs618 trbv AAVX01434670.1 358 LSLGALVTQWPRTVTAREGETVTLNCHQDDSSLNTMLWYLQPHQGGLTLIGYGVYSVITHERPDYNITTTPDNMNSTLEITSMNPTQEGVYYCAARE
Callorhinchus milii Vs611 trav AAVX01413960.1 617 LCDGDSVSQKAATMVKSKGETASFECTYSTTVSRYYLSWYRHYPDKQPEYILRRYSGNENQYRGTGFGNRFSAQLHKSISSTSLSISLLVVSDSAVYYCAFN
Callorhinchus milii Vs610 trav AAVX01412453.1 719 LCDGDTVSQKVAPIVRKETETATFECTFHTTESNYLLLWYRHYRERHPEFIVVRYSWVDDQDKGTGFGNRFSAQLYKSSSFTSLSISELEVSDSAVYYCAFR
Callorhinchus milii Vs358 iglv AAVX01021482.1 1042 GCDGFTLSQPRSTIGKLGKIARITCTKNNIGNDYIHWYRETPGKGLQWILYYHAEDKKENSPDFPRFSAHKSGDSCTLRIIRLTSIDSGIYYCGVWD
Callorhinchus milii Vs359 trav AAVX01021686.1 2069 RCGGDGVTQLQTIVTVTEGEDVSLQCNYTGANTGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHAEFAKQRFSASVSQAERTVPLNILQVRITDSAGYYCALS
Callorhinchus milii Vs681 ighv AAVX01646639.1 321 VQAEVVLTQPPSLSGKPGHPLRLTCKTSGFNLGSYYMSWVRQVPGKGLEWLLWYYSSSYKYFAPGIEDRVTVIKENSNNIFDLIIKSPRVDDTAIYYCARE
Callorhinchus milii Vs445 trdv AAVX01099277.1 1145 SSYTVSQSPPEQSAFSGERINLHCQYSGICGQDFNVSWYRQSPGEELKYLLHTKPSGVGGNPSGGHISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii Vs141 iglv AAVX01153406.1 794 GCDGFTLSQPLSMIVKSGKAVKITCTKNNIGNDYVHWYRETPGKGLQWILYYHSGNKKENSPDFPGYSAQKTVDSCTLRIKSLTSGDSGIYYCGVWD
Callorhinchus milii Vs269 trdv AAVX01472033.1 80 IANAISVEPSQMEVSVGEGQTANMSCTYSADFTDVLMYWYLQYPGDPPLYTRRHDYDGDTFSAEFAKQRFSTTLDTNTKRYGLTVFPVALSDMAKYYCAIR
Callorhinchus milii Vs146 iglv AAVX01174161.1 504 GCDGFTLSQPRSMIKNQGRTARITCTMHGKSMGEDYVHWYLGNPGKGLQWILYNKGTETKISPDFPRRFSADKSGDSSILTITKPEPNDSGIYYCGVWD
Callorhinchus milii Vs145 trav AAVX01170304.1 258 VVVGDPVRQQTAELSKQEGDTVSLSCSYTTSSNYAALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNKEQTTLIILSVIVTDSATYYCGLRSD
Callorhinchus milii Vs144 trdv AAVX01170204.1 693 LCDGDSVSQKVAQIVRKETETATFECTFPSTGSNYILLWYRHYRERHPEFIVVTYSWKDNQDKGTGFGNRCSAQQYKSSSFTSLSISELQVSDNAMYYCAFS
Callorhinchus milii Vs92 trdv AAVX01084191.1 853 SSNAVCQTQPQQSAFAGETVSLHCKYILLSEEDFSIYWYRLSPGEALEYLIERESSVEGGNPAGGRISASLDTVKEISILTIAGLRLTDSAMYHCALN
Callorhinchus milii Vs263 trav AAVX01434158.1 424 VSGQDVVSQYPREKTEIEGQDVALNCNISRLATVFWYRQNPGEALQYALRIFTSGAVDKSPDLPERFTAELIKENKVTKLQILGAVVGDSAVYYCALE
Callorhinchus milii Vs149 trav AAVX01178746.1 780 HCGGDAVTQLQSTVKVNEGEDVYLQCNYTATTTSDPDLYWYRHHPNKAPEYILWTDKRNNPRHADFAKDRFITHVEEAERTVPLNISQVTVADSAVYYCALR
Callorhinchus milii Vs261 trav AAVX01428507.1 122 HCGGVSVTQLQSTVTVNEGETVYLQCNYTATNNDNPYLFWYRHYPNKAPEYILNKYIRNNKQQHADFAKERFSTNVSQAESTVHMNILQVRVTDSAVYYCALS
Callorhinchus milii Vs96 trbv AAVX01087004.1 608 LSLGALVTQRPRTVTAREGETVTLRCSHNDKSLDTMLWYIQPHQGGLTLIGYNEYSTVYEDRFKSGYNITKTPNNMNSTLEITNINPTQEGVYYCAARE
Callorhinchus milii Vs267 trav AAVX01452133.1 207 FSVQDVVSQYSREKTEIEGQDVPLNCNISRLDTVFWYRQNPGGALQYALRILTTGTVNKSPDQPERFTAELINKNKVIKLQILGAVVGDSALYYCALD
Callorhinchus milii Vs94 trdv AAVX01085711.1 217 STLSVSQQPGQETSVADTTATITCGFSTRCESHISVHWYRQYPGQQPTFLLQRGDQGDGEDTLPSGHISVSREPNKRVSRLTIFRQRLTDSAVYYCALRLD
Callorhinchus milii Vs95 trav AAVX01085734.1 341 VLAESDVSQRPEAMTENEHGNVSMECSITGNKPYFHWYKQYGNGSIRFLVLEKSDINVKDRIRAFANIRQGNCTLTIQNVRASDTATYFCAV
Callorhinchus milii Vs118 trdv AAVX01114267.1 429 SRFTVSQSPPEQTAFAGERINLHCQYSGFCGQDFSVSWYRQSPGETLEYLLHRKRSGEGGNPTGDHISASLDTAKKISILTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs560 trdv AAVX01286340.1 799 LCDGASVSQKAVPMVRKEGETVTFECTYSTSYSSYNLCWFRRYPGNQPEFIVRRYSRDDNQYKGTGFGNRFSAQLQKSKSFTSLSISELVVSDSAVYYCAF
Callorhinchus milii Vs546 trdv AAVX01260459.1 4670 SRFSVSQSPPEQTAFAGEMINVHCQYSGYCGQDFSVSWYRQSHGETLEYLLHRKPSGEGGNHTGGHISASLDTAKKISILTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs545 iglv AAVX01260001.1 1058 GCDGFTLSQPLSMFGKLGKIARITCTKNNIGNDYIHWYRETPGKGLQWILYYHSEDKKENLPDFPRFSAHKSGDSCTLRIIRLTSDDSGIYYCGVWD
Callorhinchus milii Vs544 trav AAVX01258902.1 430 VSGQDVVSQYPREKTEIEGQDVILNCNISRLDTVFWYRQNPGGALQYALKIFTSGTVDKSPDLPERFTAELIKKNKVTKLQILGAVVGDSAVYYCALE
Callorhinchus milii Vs212 trav AAVX01272828.1 820 VVLGDPVRQQTAELSKQEGGTVTLSCSYTTSSNYAALYWYRHHPGLAPQYILYRHTNGVDNTADNAKGRFTSQLDKNQEQTTLILLSVIVTDSATYYCGLRSD
Callorhinchus milii Vs542 trav AAVX01253747.1 873 LSLGALVTQRPRTVTAREGETVSLNCHQNNKDYLIMLWYLQPHQGGLTLIGYNQYSTVYEDKFKSGYNITKTPDNMNSTLEITNINPTQEGVYYCAARE
Callorhinchus milii Vs540 ighv AAVX01250227.1 576 VQADVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYWMSWVRQVPGKGREWLLSYYSSSYKAFAPGIEDRVTVIKENSNNIFDLIIKCPRVDDTAIYYCVRG
Callorhinchus milii Vs549 iglv AAVX01262607.1 1216 GCDGFTLSQPRSMIVKLGKVARITCIKNNIGNDYVHWYRETPGKGLQWILYYHSEDKTDISPDFSRFSADKSGDSCTLIIIRPTSDDSGIYYCGVWD
Callorhinchus milii Vs548 trav AAVX01261826.1 444 YCGGDSVTQLESSLTVNVGQDVTLQCNYTAISTTTPYLFWYRHYPNRAPEYVLRKDTNNKFPDHADFAKQRFSTNVSKEERTAPINIIQVRVADSAVYYCALS
Callorhinchus milii Vs469 trav AAVX01126037.1 1263 VLAESDVSQSPQVVTGNENGNVSMECNTTGYSPTFQWYKQYGNGSIRFLVLGKSEVNVKDRIRASTNTKEKNCTLTIKNVRLTDTATYFCAD
Callorhinchus milii Vs464 trdv AAVX01115391.1 348 LCDGASVGQKAVPMVRKEGETVTFQCTYSTSYSSYNLYWFRRYPDKQPEFIVQRYSRDDNQYKGTGFGNRFSAQLQKSKSFTSLSISELVVSDNAVYYCAFS
Callorhinchus milii Vs466 trbv AAVX01116879.1 478 LSLGALVTQWPRTVTAREGETVSLRCSHNDKSLKMMLWYIQPHQGGLTLIGYNELSTVYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE
Callorhinchus milii Vs467 trav AAVX01117965.1 1219 VSGQEVVSQYPREKTEIEGQDVILNCNISRLDTVFWYRQNPDQALQYVLRIFASGKVDKSPDLPVRFAADLIKENKVIKLQILGAVVGDNAVYYCALD
Callorhinchus milii Vs460 trav AAVX01111694.1 348 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSNLSITGTEVTDAASYLCAVE
Callorhinchus milii Vs461 trdv AAVX01113424.1 1541 LTQGDSVTQKVASVTGKEGGSVTMECHYDTSLSSYFLHWCREQQEKQPQYVLKKGSGGDTYKADFAKKRFSAELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii Vs462 trav AAVX01114331.1 1464 ASHQDSVAMKVSSISKREGDTVTIECTYSTHNTSYIIYWYRQYGDGIPEFIVWKYSGGNEAKADWAKSRFSVALLKSNTTVRLMVSQLQVADSARYHCALR
Callorhinchus milii Vs463 iglv AAVX01114770.1 417 GCDGFTLSQPRSMIAQLGRVAKLSCTKSDMGNDFVHWYRETPGKGLQWILYYHSEDEKDNSPDFPRFSADKSGDSCTLTSIRLTSDDSGIYYCGVWD
Callorhinchus milii Vs316 trdv AAVX01587729.1 188 SSNAVCQTQPQQAAFAGETVSLHCKYILFSEEYFIIYWYRQSHSETLTYRLQRKPAGEGGNPAGDRISAFLDTAKKISVLTIADLRVTDSAMYHCALS
Callorhinchus milii Vs317 trav AAVX01593884.1 268 HCGGGSVKQLESTVTVNEWEAAHMHCNYTTTDTNPNLFWYRQYPSKAPEYILWASTFSKPKYAEFAKERFSTNVSKAERTVTLNIIQVRVTDSAGYYCALS
Callorhinchus milii Vs314 trbv AAVX01586206.1 445 LSLGALVTQWPGTVTAREGETVSLNCYQNDTDYQVMLWYFQPHHGGLTLIAYAVVTTPTYEKGFESGYNMTKTTDDKESSLKISNLNPTQEGVYYCAARE
Callorhinchus milii Vs522 trav AAVX01230071.1 1073 VVLGDSVRQQTAGLSKQDGDTVSLSCSYTNSSNYSALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDRNQERTTLIILSVIVTDSATYYCGLRSD
Callorhinchus milii Vs312 trdv AAVX01584926.1 169 VCNADSVTQKAATMVKKEGDHVILRCTYSTTESFYYLYWYRQSTDKQPEFIVEMHSSNENPVKATGFGNRVSAQLQKFSSSTSLFFSGLVVSDSAVYYCAFS
Callorhinchus milii Vs310 ighv AAVX01582784.1 121 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFNLGSYGMSWVRQVPGKGLEWLLYYYKPSHSYNAFAPGIEDRVTVIKEDSNNIFDLIIKSPRVDDTAIYYCARG
Callorhinchus milii Vs311 trav AAVX01583843.1 156 ASHQDSVAMKVSSISKREGDTVTIECTYSTHNTSYIIYWYRQYGDGIPEFIVWKYSGGNEAKADWAKSRFSVALLKSNTTVRLMVSQLQVADSARYHCALR
Callorhinchus milii Vs319 trav AAVX01595902.1 267 HCGGDAVTQLQSTVPVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADSAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii Vs389 ighv AAVX01034207.1 1467 VQAAEVLTQPATLSGETGQTLRLTCTTSGFNYGTYYYWMYWYRQFPGKQKEWLLSYYSSSYKGFASGIENSVTVIRDDSNNIFDLIIKSPTVEDTATYYCAAD
Callorhinchus milii Vs388 trav AAVX01033821.1 2684 LCGEDSVSQKAAMLLKKEGDAVTFDCIYFTNESAFILFWFRQYPVKQPEFMVWRFSYNNKETKGAGIGNRFSSQLDSSQSVTRLSISELQVSDSSMYICA
Callorhinchus milii Vs352 trav AAVX01016235.1 1678 RCGGDGVTQLRSVVTVTEGEDFSLQCNYTVANTGSEYLFWYRHLTNKAPEYILRTSTKNRNKDHADFAKERFSANVSKAEKTVPLNILQVRITDSAGYYCALS
Callorhinchus milii Vs385 trav AAVX01031208.1 3536 MVVGDSIRQQTAGLSKQEADTVSLSCTYTTSSNYAALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNQKKTTLFIPSVIVTDSATYYCGLRSD
Callorhinchus milii Vs384 trav AAVX01031098.1 590 RCGGDGVTQLQSIVIVTEREDVSLQCNYTGASDGSDYLFWYRHLTNKAPEYILRTSTNNRNKDHADFAKERFSTNVSKSEKTVPLNILHVRVADSAGYYCALS
Callorhinchus milii Vs387 ighv AAVX01033632.1 1794 VQADLVLKQPPYLTGKTGQALRLTCESSGFNLSIAHMSWYRQLPGKQQENLLQYEGSSIKSFGSGFENRVIVIREDSQNIFDLIIKCPTVHDTSTYYCQIK
Callorhinchus milii Vs386 trav AAVX01032399.1 1381 VSGQEDVYQTPLSVTVGEKENVLINCSTKGTTQAFQWYRQYPNQALKHLVTGKTGEQQKERITATMNYRDSSSNLTITGTEVTDAATYLCAVE
Callorhinchus milii Vs381 trav AAVX01029999.1 1375 NSLQNTAKQQKGDRTVEEGNDVKLSCSLKKIGDTSYLYWYRKASRNAPVYILRSISGTDYMSSDFPNRFSSTVNKTSEDFELSIVTVLIRDSAVYHCAKR
Callorhinchus milii Vs380 trav AAVX01029689.1 2374 VHAEINVSQRPQAVTENENGNVSVECTNTESTNAIQWHTQYGNRSIRFLVLGTRDINVIDRISALAIPGQRNCTLTIQNLRVTDTATYFCAA
Callorhinchus milii Vs383 trav AAVX01031098.1 2507 VSGQDTVSQSPLSVTVGEKEQVIISCFTTQSRALQWYRQYPNQSLKHLVTGQTGEQQMKRITATMNFREKGSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii Vs382 trav AAVX01030186.1 1988 HCGGDSVTQLQSTVTANEGEFIYLQCNYTAASTTNNYLFWYRHFPNKSPEFILSTSSNNRIKQNADFAKERFSANVDEMGRTVQLKVLQVRVADSAGYYCALS
Callorhinchus milii Vs588 trav AAVX01342578.1 540 YCRGDSVTQLQSTVTVNEEEDGTLQCNYTTTSNTLYLFWYRQYPNKAPEYILWTYGRGQPQHADFAKERFSTKLDESRRTAPLNISQVRVADSAAYYCALS
Callorhinchus milii Vs353 trav AAVX01016239.1 1721 HCGGDSVTQLQSTLTVNEGDDVSLQCNYTATSGSGNPYLFWYRHYSNKSPEYILRTDTSNKFPDHADFAKERFSTNVSKVERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii Vs582 trbv AAVX01322481.1 516 LSLGALVTQLPRTVTAREGETVTLNCHQKDTAYQTMLWYLQPHQGGLTLIGYGFASNPTMEDAYKLDYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii Vs644 trav AAVX01525865.1 684 VSLQDTGKQPIAEISVEEGKFVKLSCTLKKISDASYLYWYRQASRNAPVYILQSAVGKDYMSPDFPDRFSSIVNNTNEDFELSIVNVLIRDSAVYYCAKR
Callorhinchus milii Vs645 trdv AAVX01530381.1 776 IPVCTVSQSPPEQTAFAGERINLHCQYSGSCGQNFSVSWYRRSPGEGLKYLLHRNPSEEGGNSNGDHISASLDTAKKICVLTITGLGLTDSAMYHCALS
Callorhinchus milii Vs646 trav AAVX01534872.1 558 YCGGDSVTQLETSLTVNEGEDVTLQCNYTTTSTSPFLFWYRHYPNRAPEYILRKDTSNKFPDHADFAKQRFSTNVSKEERTAPINIFQMRVADSARYYCALS
Callorhinchus milii Vs640 trav AAVX01509918.1 484 VYGKDVVSQYPPEITEFEGQNVTMNCSYSTINVAFWYRQYPDGAPQYLFRIYSSGKVDNPPDRFTAELIKENKVIKLQILSAVVGDSAVYYCALN
Callorhinchus milii Vs642 ighv AAVX01511407.1 369 VQTAVVMTQPPTLTGKTGQSLRLTCRTSGFNSNWYYCMFWYRQLPGKQREKLLTSNGISSNSFESGVGNRVTVVRENSNNIFDQIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs648 ighv AAVX01542651.1 502 VQTAVVMTQPPTLTGKTGQSLRLTCRSSGFNYNRYYCMYWYRQLPGKQREKLLTSDCYSSNSFESGVGNRVTVVREDNNKIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii Vs328 trav AAVX01000422.1 2122 FCDGDSVIQKAATMVKKERESVILQCTYSTTEIAFALHWYRHYVGKQPEFIIWSYPGGESQKKGEGFGDRCHAQLHKFNSSTSLSISELVVSDSAVYYCAFSL
Callorhinchus milii Vs451 iglv AAVX01104319.1 1402 GCDGFTLSQPRSMIKNQGRTAMITCTMHGKSMGNDYVHWYLGNPGKGLQWILYNKGTETETSPDFPRRFSADKSEDSSILTITKVKPNDSGIYYCGVWD
Callorhinchus milii Vs420 iglv AAVX01065758.1 3235 GCDAFTLSQPLSMIVKSGKVATITCKKNNIDNDNVHWYRESPGKGLQWILYYHSRNKKDNLPDFLSRFSSDKSGDSCTLTIIRLTSDDSGIYYCGVWD
Callorhinchus milii Vs421 ighv AAVX01065758.1 513 GCDGLSLTQPGSMVKKTGRTVEMTCTLAGASMQNVYVHWYRGNPGKEFQWILYYRSESQTETSPAFSERFSAVKSGQLCILTIIKPVQEDTATYYCGLWH
Callorhinchus milii Vs422 trgv AAVX01065759.1 3535 GSVALSQPRLSLTSKLNKTVQIPCIIDSKTLNTDFVHWYRKSADKKLQWILYFQNQQKKEIDSAFKARFFVEKVEQTKSCNLIILDTREADTGVYYCALWS
Callorhinchus milii Vs423 trdv AAVX01068326.1 2206 SSFTVSQSPPEQTAFAGERINLHCQYSGFCGQNFSVSWYRQSPGEGLKYLLHRKPSGEAGNPTGDHISVSLDIAKKISVLTIADLRLTVSAMYHCALS
Callorhinchus milii Vs425 trav AAVX01070473.1 1532 FCGGDSVTQLQSIVTVTEGEDVSLQCNYTGASDGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHSDFAEERFSTNVSKAERTVPLNILHVRVTDSAGYYCALS
Callorhinchus milii Vs426 trav AAVX01070639.1 2674 FCDGDSVTQKHATVVKKERETVILQCTYSTTESDYLLHWYRHYAGKQPEFIIWRYSGSELEEKGVGFGNRFSAQLHKSNSSTSLSISELVVSDSAVYYCALSL
Callorhinchus milii Vs427 trav AAVX01070639.1 665 VVLGDSVRQQTAGLSKQEGDTVSLSCSYTTSSSYAALNWFRHQPGLAPQYVLYRDTAGGSNTADFAARRFSSRLDDNQRKTTLIIRSVVITDAAAYYCGLTS
Callorhinchus milii Vs583 ighv AAVX01324431.1 941 VQASGSLTQPPTLTGKTGQSLRLTCRTSGFDHDSYYYCMYWYRQLPGKQREKLLTSDYRSSNSFESGVGNRVTVVRENSNNIFDLIIKSPRVEDTATYYCGAY
Callorhinchus milii Vs429 trav AAVX01073212.1 5755 VSGQDVVSQYPREKTEIEGQDVALNCNVSRLDTVFWYRQNPGGALQYALRIFSSGTVDKSPDLPERFTAELIKENKVIKLQILGAVVGDNAVYYCALE
Callorhinchus milii Vs580 trav AAVX01313477.1 1056 HCGGDAVTQLQSTVKVNEGEDVYLQCNFSATTTSDPDLYWYRHYPNKSPEYILWTDKRNNPRHADFATDRVITHVDEAERTVPLNVSQVTVADSAVYYCALR
Callorhinchus milii Vs587 trdv AAVX01342574.1 385 SKYTVSQSPPEQTAFAGERIHLHCQYSGFCGQDFSVSWYRQSLGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSAVYHCALS
Callorhinchus milii Vs586 trdv AAVX01335456.1 495 SSYTVSQSPTEQAAFTGERINLHCQYSGFCGQDFSVSWYRQTPGEGMKYLFHRKPSGEGRNRTGDHISASLDTAKKISVLTIAGLRLSDSATYHCALS
Callorhinchus milii Vs585 trbv AAVX01334290.1 566 LSLGALVTQLTRTVTAREGETVSLNCQHNDKSLTVMLWYLQPHQGGLILIGYNEFSTVYEDKFKSGYNITKTPDNMNSSLEITNMNPTQEGVYYCAARE
Callorhinchus milii Vs584 trav AAVX01331120.1 411 VYGQDAVTQYPPEITDFEGQNVTLNCSYSSLQTAFWYRQYPDGALQYLFRIYASGNEDNPPDRFTAELIKENKVINLQILGAVVGDSAVYYCALD
Callorhinchus milii Vs450 trav AAVX01103499.1 1288 HCGGDSVKQLESTVTVNEGEAAHMHCNYTTADINPNLFWYRHYPSKAPEYILWASAYSKPKYADFAKERFLTNVSKAERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii Vs518 trbv AAVX01227405.1 491 LSLGALVTQEPRTVTAREGETVTLRCSQHDSALNTMLWYVQPHQGGLTLIGYNRASTTYEDKFKSGYNITKTPDRMNSTLEISNINPTQEGVYYCAARE
Callorhinchus milii Vs264 trdv AAVX01438697.1 53 LCVGDSVSQKAATMVKKEGEIAILQCTYSTTESYYYLFWYRHYPDKQPEFIIWRYSGNDDQVKGIGFGNRFSAQLQTSNSSTSLSISELVVSDSAVYYCALS
Callorhinchus milii Vs265 trav AAVX01440003.1 95 VVLGDSVRQQTAGLSKQEGGTVSLSCSYTTSSNYAALYWYRHHPGLAAQYILYRHTNGVENTADYAKGRFTSHLDKNQEQTTLIILSVIVTDSAAYYCGLRSD
Callorhinchus milii Vs452 trav AAVX01105303.1 1485 VVLGDPVRQQTAGLSKQEGGTVSLSCSYTTSSNYVALYWYRHHPGLAPQYILYRHTNGVDNSADYAKGRFTSHLDKNQEQTTLIILSVIVTDSAAYYCGLRSD
Callorhinchus milii Vs75 ighv AAVX01065757.1 4269 GCEGFSLIQVEKTITKPEGKTTIFTCKMQGGSMSSSVIHWYRHQPGKELQWMLYYNTQSQKEYAEEFQQKFSARKKDDTCLLSITNIAKADAATYYCASWD
Callorhinchus milii Vs165 iglv AAVX01203892.1 743 GCDGFTLSQPRSMIVKLGKVARITCTKNNIGNDDVHWYRETPGKGLQWILYYHSGNKKENSPDFSSRFSADKGGDSCTLTIIGLTSDDSGIYYCGVWD
Callorhinchus milii Vs167 iglv AAVX01208118.1 287 GCDGFILSQPLSMIGKLGSVVRITCTKNDMGNDYVHWYRENPGKGLQWILYYHSGNKKDNSPDFPRFSAHKSGDSCTLRIKSLTSDDSGIYYCGVWD
Callorhinchus milii Vs369 trav AAVX01024136.1 563 LCGADTVSQQAATMVWKKGDTVTFNCTFSTNESAFFLFWYRQYPVKKPEFMVWRFSYNNKETKGAAIGNRFSSQLDIIQSVTSLSISELQVSDTAMYLCA
Callorhinchus milii Vs251 trdv AAVX01364340.1 190 MSREDSVSQDYSSVNLEMGQRFEANCTYSTTAQRYDLFWYQQYSGKTPQMVLWRSASNSNGKVKDISHRFSSKMSKPDKIFFITITDVQLGDSAMYYCAFAL
Callorhinchus milii Vs66 trav AAVX01047902.1 2018 HCGGDSVTQLQSTLTVNEGENVYRQCNYTATSTSDPYLFWYRHYPNKAPEYILRTDSSNKFPDHADFAKGRFSTNVSKGERTVPLNISQVRVTDSAEYYCALS
Callorhinchus milii Vs172 trdv AAVX01215001.1 1793 LTQGDSVTQKVGSVTGKEGGSVTMECHYDTSLSGYYLHWYREQQETQPQYVLKTYSDGSAYKADFAKKRFSAELQTSTKFSSLTISQLELSDSAVYYCALQ
Callorhinchus milii Vs275 trdv AAVX01486726.1 32 LTQGDSVTQKVGSVNGKEGGSVTMECHYDTSLSDYYLHWYREQQETQPQYVLETYSDGSAYKADFAKKRFSAELRTSTKFSSLTISQLELSDSAVYYCALE
Callorhinchus milii Vs373 trav AAVX01025811.1 727 HCGADSVTQLQSTVRVKEGETVYLQCNYTATNDNNPYLFWYRHCPNKPPEYILRTDSSNKFPDHADFAKERFSTNVSKAERTVPLNISHVRVTDTAGYYCALS
Callorhinchus milii Vs377 trdv AAVX01029007.1 1295 SSYSVSQSPPEQTAVAVERIHLHCQYSGFCGQNFSVSWYRQSPGEGLKYLLHRNPSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii Vs56 trav AAVX01038540.1 764 RCGADGVTQLQSIVTVTEGEDVSLQCNYTGASDGFDYLFWYRRLTSKAPEYIISTSTNNRNKDHAEFAEERFSTNVSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii Vs227 trav AAVX01296943.1 251 VSLQDTGKQPIAEISVEEGKFVKLSCTLKKISDATYLYWYRQASRNAPVYILQSAVGKDYMSPDFPDRFSSIVNNTNEDFELSIVNVMIRDSAVYYCAKR
Callorhinchus milii Vs680 trdv AAVX01638263.1 802 LCGGDSVSQKTARMVKKEGETVNFECIYSTTDNSYYLFWYRHYPHKQPDFIVRRYSSGNDDPVKGAGFGNRFSAQVQKSNSTTSLSVSELVVSDSAVYYCAFSL
Callorhinchus milii Vs147 trbv AAVX01174846.1 295 TGSFGTQEPRTVTAREGETVTLRCSHNDKSLNMMLWYIQPHQGGLTLIGYNQASTTYEDKFKSGYNITKTPDRMNSTLEISNINPTQEGVYYCAARE
Callorhinchus milii Vs313 trdv AAVX01585211.1 310 VVVGDSVREQTAGLNKQEGDTVSLSCSYITSSSYAALYWYRHHPGLAPQYILYRDTIGNDNTADFAKGRFTSQLDTNQRNTTLSISSVIVTDDATYYCGLTT
Callorhinchus milii Vs318 trdv AAVX01595785.1 208 SSYTVSQSPPEQTAFAGERINLHCEYSGFCGQDFSVSWYRQTPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSAPYHCALS
Callorhinchus milii V11 trdv AAVX02040072.1 12952 LCDGNSVSQKAVTMVKKEGEIVILQCTYSTTGSYYYLYWFRHYSDKQPEFIIWKYSGSDNQDKGIGFGNRFTAHLQKSNSFISLSISELVVSDSAVYYCAFI
Callorhinchus milii V10 trdv AAVX02040072.1 11167 LTQGDSVTQKVASVTGNDGGSVAMECHYDTSLSVYYLHWYREQQETQPQYVLQKYSSGSTYKADFASKRFSIELQTSTKFTSLTISLLELSDSAVYYCALQ
Callorhinchus milii V9 trav AAVX02039481.1 5059 SGQDVVSQYPREKTEIEGQDVALNCNISRLATVFWYRQNPDGDPQYALRIFTSGTVDKSPDLPERFTAELIKENKVTKLQILGAVVCDSAVYYCALD
Callorhinchus milii V8 trav AAVX02039480.1 3065 DGVTQLQTIVTVTEGEDVSLQCNYTGANTGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHAEFAKQRFSASVSQAERTVPLNILQVRITDSAGYYCALS
Callorhinchus milii V7 trav AAVX02039480.1 1114 VSGQDTVSQSPLPVTAGEKEQVIISCSTTESQVLQWYRQYPNQTLKHLVTGQTGEQQKERITATMNYREKGSNLSITGTEVTDAATYLCALETQ
Callorhinchus milii V6 trav AAVX02039479.1 10884 HCGGDSVTQLQSTVTVNEGETVYLQCNYTATNNDNPYLFWYRHYTNKAPEYVLNTYIRNNKQQHADFAKERFSTNVSQAETTVHMNILQVRVADSAVYYCALS
Callorhinchus milii V5 trav AAVX02039479.1 2956 VSGEDTVSQSPVSVTVGEKEQVFISCSATGSNNALQWYRQYTNQALKHLVTGKTGEQQKERITATVNYRDSSSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii V4 trav AAVX02039479.1 974 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQALQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSNLSITGTELTDAATYLCAVGTQ
Callorhinchus milii V3 trdv AAVX02038440.1 1151 SSYTVSQTPPEQTAFAGQNTTLHCKYSGLCGQDLSVSWYRPSPGEALKYLLHRKPSGEGGNPTGDHISASLDTAKGISILTIAGVRLTDSALYHCALS
Callorhinchus milii V2 ighv AAVX02033992.1 3743 VQADVVLTQPPSLTGKPGHPLRLTCKTSGFDLGSDRMHWVRQVPGKGLEWLLHYYSSSNSGFAPGIEDRVTVIKEDSKNVFDLIIKSPRVDDTAIYYCARD
Callorhinchus milii V1 igkv AAVX02033724.1 1805 TAAAVTLTQPSSISSSPGNTVKITCTMSGGSIGSHFVSWFQQKPDGAPLFVWDEDDTMGPGIPDRFTGSVDSSSNAMYLTISGVQPEDAADYYCGAGDSNSP
Callorhinchus milii V0 igkv AAVX02024708.1 6299 VSGEIIMTQTPSMLPVTVGQTATITCKASSSISKYLSWYQQKAGDRPKLLIHTATTLYTGTPARFSGHQSSTTFTMTITGVQPEDFADYYCMQSYSN
Callorhinchus milii V48 trav AAVX02045633.1 6344 YVGADAVSQPQSTVIVNEGEEVYLQCNYTAAGYGSEYLFWYRQYPEKTPEYIIRTDKGNKNQKHADFATERFSVNADQERSTVPLNIIQVRVTDSAVYYCALS
Callorhinchus milii V47 trav AAVX02045633.1 4487 VVAEVGGQDVISPNIPEITEIEGQDVTLNCNISRLETILWYRQYPDGAPQYFLSIYTSGRVDKPPGLPHRFAAYVNKRNRIMNLQIHRAVVGDSSVYYCALE
Callorhinchus milii V46 trav AAVX02045633.1 1254 IGNQSTAEISVEEGKDVKLSCTLKKISDAYSLFWYRQAARNAPVYILQSAAGKDNKSPDFQQRFSSNVDKTNEDFILSIATVLIGDSAVYYCAKE
Callorhinchus milii V45 trdv AAVX02045618.1 3300 LTQGDSVTQKVASVTGKEGGSVTMECHYDTSLSSYYLKWYREQQETEPQYVLQKGSRGSTHIADFAKKRFSAELQTSTTFTRLTISLLELSGSAVYYCALQ
Callorhinchus milii V44 trav AAVX02045618.1 1846 GGQDVISPNIAETTEIEGQDVTLNCNIARLDTILWYRQYPDGAPQYFLSIYTSGRVDKPPGLPHRFAAYVNKRNKIMNLQIHRAVVGDSSVYYCALE
Callorhinchus milii V43 trdv AAVX02045115.1 3017 SNYTVSQSPPEQTAVADERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V42 trav AAVX02044916.1 9013 LCGEDSVSQKAATLLKKEGDAVTFDCIYFTNESAFILFWFRQYPVKQPEFMVWRFSYNNKETKGAGIGNRFSSQLDSSQSVTRLSISELQLSDSSMYICA
Callorhinchus milii V41 trdv AAVX02044916.1 4245 SSQTVSQSPPEQAAFTGERINLHCQYSGFCGQDFSVSWYRQSPGEELKYLLHRKPSGEGGNPTGGHISASLDTAKKISVLTIADLRLSDSAMYHCALS
Callorhinchus milii V40 trav AAVX02044827.1 3196 FCGGDSVTQLQSIVTVIEGEDVSLQCNYSVASDGSDYLFWYRHLTNKAPEYILRTSTINRNKDHAEFAKERFSTNVSKAERTVPLNILHVRVTDSAGYYCALS
Callorhinchus milii V39 trdv AAVX02044715.1 425 LCDGDSVSQKAANMIKKEGEIAMLQCTYSTTESDCFLYWYRHYPDKQPEFIIRRYSGNDNQVKGIGFGNRFTAQLQKSNSTTSLSISELVVSDSAVYYCAFS
Callorhinchus milii V38 trdv AAVX02044711.1 632 SSYTVSQSPPEQSAFAGERINLHYQYSGFCGQDFSVSWYRQSPGEELKYLLHRKSSGERRNPTGDHISASHDTAKKISVLTIADLRLTDSAMYHCALT
Callorhinchus milii V37 trav AAVX02044623.1 6338 HSGGDSVTQLQSIVAVNEGEDVYMQCNCTATNTIDPYLFWYRHYPNKAPEYILRTDTSNKFPDHADFAKGRFSKNVSKGERTVPLNISQVRVADSAGYYCTLS
Callorhinchus milii V36 trdv AAVX02044558.1 1266 SSYTVSQSPPEQTAFAGERINLHCQYSGICGQDFSVSWYRQSPGEALKYLLHRKPSGEGGNPTGDHISVSLDTTKKISVLTIADFRLTDSAMYHCALS
Callorhinchus milii V35 ighv AAVX02044307.1 2792 VQADLVLTQPPYLIGKTGQALRLTCESSGLDTTVAHMSWYRQLPGKQQENLLEYEGSSIKSFGSGFENRVIVIREDSQNIFDLIIKCPTVHDTSTYYCQIK
Callorhinchus milii V34 trdv AAVX02044049.1 797 FCDANTVRQTAATMVKRDGESVIFQCSYSTTESYYTLYWYRHYPDKQPEFVIWRYSGDDNQQKGTGIGHRFSAELHKSDSSTSLSISELVVSDSAVYYCALR
Callorhinchus milii V33 trdv AAVX02043826.1 3685 VVLGAPVRQQRAGLSKQEGDTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGIENTADYAKGRFASHLGKDPLQSTLIIPSVIFNDAATYYCALTSV
Callorhinchus milii V32 trdv AAVX02043825.1 6566 SSFTVSQSPPEQTAVAGERINLHCQYSGFCGQNFSVSWYRQSPGEELKCLFRRKPSGEEGNPTGDNISASLDTAKKISILTIAGLRLTDSAMYHCALS
Callorhinchus milii V31 trdv AAVX02043732.1 191 VVLGDSVTEQTAGLSKQKGDTVSLSCSYTTSSTYAALYWYRHHPGLAPQYILYRDTNGNDNTADFVKGHFTSQVDKNQKHSTLNIFSVIVTDAATYYCGITT
Callorhinchus milii V30 trdv AAVX02043731.1 10771 CNADSVTQKAATMVKKEGDHVILRCTYSTTESFYYLYWYRQSTDKQPEFIVEMHSSNENPVKATGFGNRVSAQLQKFSSSTSLFFSGLVVSDSAVYYCAFS
Callorhinchus milii V29 trdv AAVX02043731.1 9015 LTLGDSVTQKVASVTGKEGGSVTMECLYDTSLSNYYFNWYREQEEKQPQYVLQQHSGGSPYKADFAKKRFSVELQISTKFSSLIISLLELSDSAVYYCALQ
Callorhinchus milii V28 trdv AAVX02043731.1 4244 SSYTVSQSPTEQAAFTGERINLHCQYSGFCGQDFSVSWYRQTPGEGMKYLFHRKPSGEGRNRTGDHISASLDTAKKISVLTIAGLRLSDSATYHCALS
Callorhinchus milii V27 trav AAVX02043327.1 5170 VVVGDPVRQQTAELSKQEGDTVSLSCSYTTSSNYAALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNKEQTTLIILSVIVTDSATYYCGLRSD
Callorhinchus milii V26 trdv AAVX02043325.1 1721 GFNADSVTQKASSKVKKEGDHVILRCNYSTTESSNYLYWYRHSIDKQPAYTVEMYSSNENPVKATGFGNRISAQLQKFSSSTSLFISGLVVSDSAVYYCAFS
Callorhinchus milii V25 trav AAVX02043088.1 4448 LCDGDTVSQKVAPIVRKETETATFECTFHTTESNYLLLWYRHYRERHPEFIVVRYSWLDDQDKGTGFGNRFSAQLYKSSSFTSLSISELEVSDSAVYYCAFSI
Callorhinchus milii V24 trav AAVX02043088.1 1957 LCDGASVSQKAVPMVRKEGETVTFECTYSTSYSSYNLYWFRRYPGKQPEFIVRRYSRDDNQYKGTGFGNRFSAQLQKSKSFTSLSISELVVSDSAVYDCAF
Callorhinchus milii V23 trdv AAVX02043086.1 1552 LTQGDSVTQKVASVIGKEGGRVTMECHYDTSLSNYYLNWYREQKETQPHYVLQKYSGGHTDKADFAKKRFSIELQTSTKFTSLTTSLLELSDSALYYCALE
Callorhinchus milii V22 trdv AAVX02042328.1 2556 LTQGDSVTQKVTSVTGKEGGNVTMECHYDTSLSGYYLNWYREQQETQPHYVLKKSSDGDKDKADFAEKRFSVELQTSTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii V21 trdv AAVX02042327.1 1912 LTQGDSVTQKVTSVTGKEGGNVTMECHYDTSLSGYYLNWYREQQETQPHYALKKGSVCDKYKADFAEKRFSVELQTSTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii V20 trav AAVX02042326.1 6728 HCGGDSVTQLQSTVTANEGEFIYLQCNYTAASTTNNYLFWYRHFPNKSPEFILSTSSNNRIKQNADFSKERFSANVDEMGRTVQLKVLQVRVADSAGYYCALS
Callorhinchus milii V19 trdv AAVX02041715.1 1640 LCDGDSVSQKAVTMVKKAGETVILQCTYSKTESDFILSWYRHYPGKELEFIIRKYSWDHNPFKGTGFGNRFSAQLHKSNSSTSLSISELVVSDSAMYYCAFS
Callorhinchus milii V18 trdv AAVX02041520.1 18955 STLSVSQQPGQETSVADTTATITCGFSTRCESHISVHWYRQYPGQQPTFLLQRGDQGDGEDTLPSGHISVSREPNKRVSRLTIFRQRLTDSAVYYCALRLD
Callorhinchus milii V17 trbv AAVX02041196.1 2552 LSLGALVTQLPRTVTAREGETVTLNCHQKDTAYQTMLWYLQPHQGGLTLIGYGFASNPTMEDAYKLDYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii V15 trdv AAVX02041167.1 1055 SRYTVSQSPPEQTAFAGETINVHCQYSGFCGQDFSVSWYRQSPGETLKYLLHRNPSGEGGNPTGDHISASLDTAKKISDLTIADLRLTDSAMYHCALS
Callorhinchus milii V14 trav AAVX02041166.1 2046 VSGQEKVYQSPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSNLSITGTEVTDAATYLCAVE
Callorhinchus milii V13 trbv AAVX02040774.1 1889 LSLGALVTQLPRTVTAREGETVTLNCHQKDTAYQTMLWYLQPHQGGLTLIGYGYASNPTMEDAYKLEYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii V12 trbv AAVX02040774.1 291 LSLGALVTQWPGTVTAREGETVSLNCYQNDTDYQVMLWYFQPHHGGLTLIAYAVVTTPTYEKGFESGYNMTKTTDDKESSLKISNLNPTQEGVYYCAARE
Callorhinchus milii V86 trav AAVX02048875.1 4473 YCGGDSVTQLQSTVTVNEGEAVYLQCNYTATSGSNPYLFWYSHYANKAPEYILNTYIRNTKQQRADFAKERFSTNVSNAERTVHLNISQVRVTDSAVYYCSLS
Callorhinchus milii V85 trav AAVX02048875.1 1823 VLAESDVSQSPQAVTGNENGNVSMECNTTVSGPSFHWYTQYGNGSIRLLVLVTRDVDMKDRISALANTRQKNCTLTIQNLRVTDTATYFCAE
Callorhinchus milii V84 trdv AAVX02048564.1 549 SRYTVSQSPPEQTAVAGERINLHCQYSGFCGKDFSVSWYRQSPGEGLKYLLHRKPSGVGGKPTGGHISASLDTAMKISVLTIAGLRLADSAMYHCALSL
Callorhinchus milii V83 trav AAVX02048413.1 1362 VVLGDPVRQQTAGLSKQEGGTVSLSCSYTTSSNYVALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNQEQTTLIILSVIVTDSAAYYCGLRSD
Callorhinchus milii V82 igkv AAVX02048271.1 2262 AITQLQSTVTVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNKPPEYILSTDTNNRIKKGADFAEECFSTNVSKAERTVALNILQVRVTHSAGYYCALSPTE
Callorhinchus milii V81 trav AAVX02048257.1 5626 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATGEYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADFAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii V80 trav AAVX02048257.1 4056 SGQDVVSQYPREQTEIEGQDVALNCNISRLATVFWYRQNPGGALQYALRIFASGTVDKSHDLPERFTAELIKENKVIKLHILGAVVGDSAVYYCALD
Callorhinchus milii V79 trdv AAVX02047856.1 1598 LCGGDSVSQKAASMVRTEGESVTFECSYSTTESYFYLFWYRHYKEKQPEFIIRRYSHNDNTIKGAGFENRFSAELQKSNSFTSLSISELVLSDSAVYYCA
Callorhinchus milii V78 trav AAVX02047672.1 4128 VSGQEKVYQSPLSVTVGEKENVVIRCSAKGTTQALQWYRQHLNQALKHLVTGKTGEQRKERITATINYGDRSSNLSITGTEVTDAAIYLCAVETQ
Callorhinchus milii V77 trav AAVX02047618.1 1049 LCDGDSVSQKAATMVKRKGETASFECTYSTTLSDYCLSWYRHYPDKQPEYILRRYSGNENQYRGTGFGNRFSAQLHKSISSTSLSISVLVVSDSAVYYCAFRP
Callorhinchus milii V76 trdv AAVX02047617.1 1734 SNYTVSQSPPEQTAFACERINLHCQYSGYCGQDFSVSWYRQTPGEELKYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii V75 trdv AAVX02047368.1 1070 SNYTVSQSPPEQTAFAGERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRNPSGEGGKPTGDHISVSLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V74 trav AAVX02047155.1 1325 VHAEIIVSQRPQAVTENENGNVSVECTNTESTNAIQWYTQYGNRSTRFLVLGTRDINVIDRISALAIPGQRNCTLTIQNLRVTDTATYFCAA
Callorhinchus milii V73 trav AAVX02047154.1 2357 NSLQDIVNQTIAEIPVEEGKDVKLSCTLKKISDANYLYWDRQASRNSPVSVLYSIAGKDYMSPDFPDRFSSNVDKTSEYFKLSIPNVLIRDSAVYYCAKE
Callorhinchus milii V72 trav AAVX02047153.1 86 DAVTQLQSTVTVTEGEDVYLQCNYTATSECNTYLFWYRHFPNKSPEYILSKDTNNRNKDGADFAEERFSTNVSKAERTVSLNILQVRITDSAVYYCALS
Callorhinchus milii V71 trav AAVX02047065.1 5841 NSLQDIGNQTIAEIPVEEGKDVKLSCTLKKISDAGYHYWYRQASRNAPIYILYSVAGKDYKSPDFQDRFSSNVDKTSEDFKLIIANVLIRDSAVYYCAKR
Callorhinchus milii V70 trav AAVX02047065.1 1062 VSGQDVVSQYPREKTEIEGQDVALNCNVSRLDTVFWYRQNPGGALQYALRIFSSGTVDKSPDLPERFTAELIKENKVIKLQILGAVVGDNAVYYCALE
Callorhinchus milii V69 trgv AAVX02046954.1 5299 SVTQLQSTVRVKEGETVYLQCNYTATNDNNPYLFWYRHCPNKPPEYILRTDSSNKFPDHADFAKERFSTNVSKAERTVPLNISHVRVTDTAGYYCALS
Callorhinchus milii V68 trdv AAVX02046736.1 6861 SRYTVSQSPPEQTAFAGETINVHCQYSGFCGQDFSVSWYRQSPGETLKYLLHRNPSGEGGNPTGDHISASLDTAKKISDLTIADLRLTDSAMYHCALS
Callorhinchus milii V67 trdv AAVX02046736.1 682 LTQGDAVTQKVASVIGKEGGSVTMECHYDTSLSSYYLNWYREQQETQLQYVLQKYSGGYTDKADFAKKRFSIELQTSTKFSSLSISLLELSDSAVYYCALQ
Callorhinchus milii V66 trav AAVX02046524.1 5777 VSGQDTVSQSPLSVTVGEKEQVIISCSTTESRALQWYRQYPNKTLKHLVTGPTGDQQKKRITATMNSREKGSNLSITGAEVTDAATYLCAVETQ
Callorhinchus milii V65 trav AAVX02046524.1 366 YCGGDSVTQLQSAVTVNEGEADYLQCNYTATTGSDAYLFWYRHYPNKAPEYILNTYIKNNKQQRADFAKERFSTNVSNAERTVHLNIFQVRVTDSAVYYCSLS
Callorhinchus milii V64 trav AAVX02046456.1 357 VSGQDVITQYPREQTEIEGQDVALNCNISRLATVFWYRQNPGGALQYALRIFTSGAVDKSPDLPERFTAELIKENKVTKLQILGAVVGDSAVYYCALD
Callorhinchus milii V63 trav AAVX02046455.1 3302 DSVTQLESALTVNEGQDVALQCNYTTTSNTPNLFWYRHYPNKAPEYILWTYGRGQPQHADFAKERFSTKLDESRRTVPLNISQVRVTDSVAYCCALS
Callorhinchus milii V62 trav AAVX02046455.1 1113 VLAESDVSQSPQAVTGNDNGNVSVECNTTGYNPTFQWYKQYGNGSIRFLVLGKREINVKDRIRALTNTKEKNCTLTIKNVRLTDTATYFCAD
Callorhinchus milii V61 trav AAVX02046454.1 296 NSLQDIGNQPIAEISVEEGKDVKLSCTLKKISDANYLYWYRQASRNAPVYILYSISDKDYKSTDFPHRFSSTVNESNEDFELSIVTVLIGDSAVYYCANE
Callorhinchus milii V60 ighv AAVX02046427.1 7687 VQADVVLTQPPSLTGEPGHPLRLTCKTSGFNLGSYNMYWVRQVPGKGLEWIVYYYSSSDNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARD
Callorhinchus milii V59 trav AAVX02046365.1 2631 ALAESDVSQSPQAVTGNENGNVSMECNTTVPGPTFHWYTQYGNGSIRFLVLGTRDISENDRISALANTRQRNCTLIIQHLRVSDTATYFCAA
Callorhinchus milii V58 trav AAVX02046365.1 537 NSLQDIGNQPIAEISVEKAKDVKLSCTLKKISDAYGLFWYRQASRNAPVYVLYSVGRNDYRSPEFPDRFSAKVNETIEDFELSIGNVLIGDSAVYYCAKE
Callorhinchus milii V57 trdv AAVX02046261.1 1128 SSNVVCQTQPQQAAFAGDTVSLHCKYILLSEEDFSIYWYRLSPGEALEYLLQRESSVEGGNPIRDRISASLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii V56 trdv AAVX02046255.1 5373 LCDGDSVSQKAATMVKKEGEIEILECTYSTTESDYYLYWYRHYPDKQPEFIIWRFSGNDNQNKGTGFGNRFSAQLQISNSSTSLSISELVVSDSAVYYCAFR
Callorhinchus milii V55 trav AAVX02046255.1 3589 LTQGDSVTQKVGSVNGKEGGSVTMECHYDTSLSDYYLHWYREQQETQPQYVLKTYSDGSAYKADFAKKRFSAELRTSTKFSSLTISQLELSDSAVYYCALE
Callorhinchus milii V54 trav AAVX02046241.1 5258 VVLGDSVRQQTAGLSKQDGDTVSLSCSYTNSSNYSALYWYRHHPGLAPQYILYRHTNGLDNTADYAKGRFTSHLDKNQERTTLIILSVIVTDSATYYCGLRSD
Callorhinchus milii V53 trdv AAVX02046241.1 3206 LCDGDSVSQKAAKMMKKEGEIAMLQCTYSTTESDYYLFWYRHYPDKQPEFIIWRYSGNDDQVKGIGFGNRFSAQLQTSNSSTSLSISELVVSDSAVYYCALS
Callorhinchus milii V52 trav AAVX02045971.1 5908 ALAESDVSQRPQTVTQHENGNVSMECTTTESGPTFHWYTQYGNGSIRYLVLGKRDITVKDRIRALVNTKQRSCTLTIQDVRVSDTATYFCAD
Callorhinchus milii V51 trav AAVX02045907.1 8945 HCGGDSVTQLQSTLTVNEGDDVSLQCNYTATSGSGNNYLFWYRHYPNKAPEYILRTDTSNKLPDHADFAKERFSTDVSKAARTVPLNIIQVRVADSAGYYCALS
Callorhinchus milii V50 trav AAVX02045907.1 1077 VSGQDTVSQSPLPVTVAEKEQVIISCSTTESRALQWYRQYPNQALKHLVTGQTGEQQKERITATMNYRDGRSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii V124 trdv AAVX02060027.1 159 ICDGDSVSQKAATTVKIEGQSEVIECTYSTTVGYYYLFWYRHYPEQQPEFIFRSYSNRDNPVKGPGFGNRFTAELHKSIPFTGLTISELVLSDSAVYYCA
Callorhinchus milii V123 trdv AAVX02058747.1 482 VVLGAPVRQQRAGLSKQEGYTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGIENTADYAKGRFASYLGKDQLQSTLIIPSVIVNDAATYYCALTSD
Callorhinchus milii V122 trbv AAVX02058456.1 166 LSLGALVTQWPRTVTAREGETVSLNCHQDDSSLTVMLWYIQPHQGGLTLIGYNQYSTTYEDKFKSGYNITKTPDKMNSTLEIANMNPTQEGVYYCAARE
Callorhinchus milii V121 trav AAVX02058432.1 325 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYLNQALKHLVTGKTGEQQKERITATMNYRVKGSHLSITGTEVTDAATYLCAVE
Callorhinchus milii V120 trav AAVX02058017.1 311 VSGQDVVSQYPREKTEIEGQDVALNCNISRLATVFWYRQNPGGALQYALRIFASGTVDKSHDLPERFTAELIKKNKVTKLQILGAVVGDSDVYYCALE
Callorhinchus milii V119 trdv AAVX02057481.1 609 SSNAVCQTQPQQSAFAGETVSLHCKYIFLSEEDLSIYWYRQSPGEALEYLLQREPSVEGGNPTGGRISASLETAKKISVLTIADLRLTDSVMYHCALS
Callorhinchus milii V118 trdv AAVX02057232.1 1007 LTQGDAVTQKVASVIGKEGGSVTMECHYDTSLSSYFLHWYREQQETQPQYVLKTYSDGSAYKADFAKKRFSAELQTSTKFCSLTISLLELSDSAVYYCALQ
Callorhinchus milii V117 trav AAVX02056433.1 384 NSLQDIGNQTIAEISVEEGKDVKLFCTLKKISDATYLYWYRQASRNAPVYILYSIAGKDYLSSDFQDRFSSKVNKTKEDFELSIVTVLISDSAVYYCAKS
Callorhinchus milii V116 trav AAVX02054831.1 1024 AVTQLQSTVKVNEGEDVYLQCNYTATTTSDPDLYWYRHYSNKAPEYIFWTDKRNNPRHADVAIDRFITHVDEAERTVPLNISQVTVADSAVYYCALR
Callorhinchus milii V115 trdv AAVX02054645.1 16 SSFTVSQSPPEQTAVAGERINLHCQYSGFCGQNFSVSWYRQSPGEELKCLFRRKPSGEEGNPTGDNISASLDTAKKISILTIAGLRLTDSAMYHCALS
Callorhinchus milii V114 trav AAVX02054034.1 1338 IGNQPIAEISVEEDKDVKLCCALKKISDATYLYWYRQASRNGPVYILYCIAGKDYLSSDFPDRFSSNVDKTNEDFELSIVTVLISDSAVYYCAKE
Callorhinchus milii V113 trdv AAVX02052536.1 1924 VKLGDSVRQQTAGLSKQEGDTVSLSCSYTTSSSYAALNWFRHHPGLAPQYVLYRDTAGGSNTADFAARRFSSQLDEIQRQTTLIIRSVVITDAAAYYCGLTS
Callorhinchus milii V112 trav AAVX02052151.1 562 SGQDVVSQYPREKTEIEGQDVALNCNISRLATVFWYRQNPGEALQYALRIFTSGAVDKSPDLPERFTAELIKENKVTKLQILGAVVGDSAVYYCALE
Callorhinchus milii V111 ighv AAVX02051985.1 2720 VQADLVLKQPPYLTGKTGQALRLTCESSGFNLSIAHMSWYRQLPGKQQENLLQYDGSSIKSFGSGFENRVTVIREDSQSIFDLIIKCPTVHDTSTYYCEIK
Callorhinchus milii V110 trav AAVX02051918.1 387 DAVTQLQSTVTVNEGEAVHLQCNYTTTSTFPDLFWYRHYANKAPEYILWTDKRNNPRQADFAKDRFTTHVDEAERTVPLSISQVRFTDSTVYYCALS
Callorhinchus milii V109 trdv AAVX02051817.1 868 VVLGAPVRQQRAGLSKQEGDTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGINNTADYAKGRFASHLGKNQFQSTLIIPSVIVNDAATYYCALT
Callorhinchus milii V108 trav AAVX02051741.1 1484 SVTQLQSTVTVNEGETVYLQCNYTATNNDNPYLFWYRHYPNKAPEYILNKYIRNNKQQPADFAKERFSTNVSQAETTVHMNILQVRVTDSAVYYCALS
Callorhinchus milii V107 trav AAVX02051732.1 332 AVTQLQSTVKVNEGEDVYLQCNYTATTTSDPDLYWYRHHPNKAPEYILWTDKRNNPRHADFAKDRFITHVEEAERTVPLNISQVTVADSAVYYCALR
Callorhinchus milii V106 trav AAVX02051641.1 2299 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSNLSIKGTEVTDAATYLCAVETQ
Callorhinchus milii V105 trav AAVX02051489.1 232 GVTQLRSIVTVTEGEDVSLQCNYTVANTGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHADFAEERFSTNVSKSEKTVPLNILHVRVADSAGYYCALSPTE
Callorhinchus milii V104 ighv AAVX02051405.1 3120 VQADLVLKQPPYLTGKTGQALRLTCESSGFNLSIAHMSWYRQLPGKQQENLLQYEGSSIKSFGSGFENRVIVIREDSQSIFDLIIKCPTVHDTSTYYCEIK
Callorhinchus milii V103 trav AAVX02051398.1 1822 VLAESDVSQSPQAVTGNENGNVSMECNTTVSGPSFHWYTQYGNGSIRLLVLVTRDVDMKDRISALANTRQKNCTLTIQNLRVTDTATYFCAE
Callorhinchus milii V102 trav AAVX02051169.1 1337 AVTQLQSTVKVNEGEDVYLQCNYTATTTSDPDLYWYRHYPNKAPEYILWTDKRNNPRHADFAKDRFITHVEEAERTVPLNISQVTVADSAVYYCALR
Callorhinchus milii V101 trdv AAVX02051020.1 2055 LTQGDSVTQKVASVIGKEGGRVTMECHYDTSLSNYYLNWYREQKETQPHYVLQKYSGGHTDKADFAKKRFSIELQTSTKFTSLTTSLLELSDSAVYYCALE
Callorhinchus milii V100 trdv AAVX02050685.1 3354 SKYTVSQSPPEQTAFAGERIHLHCQYSGFCGQDFSVSWYRQSLGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSAVYHCALS
Callorhinchus milii V99 trav AAVX02050665.1 336 QCGGDAITQLQSTVTVTEVEDVYLQCNYKATSEYNTYLFWYRHFPNKPPEYILSTDSKNRIKDGAEFAEERFSTNLSKAERTVSLNILQVRVTDSAGYYCALS
Callorhinchus milii V98 ighv AAVX02050605.1 1222 VQADLVLTQPPTLTGKTGQALRLTCETNGIDLSRNYTGWFRQLPGKQRENLLVHDGSSIKSFGSGIENRVTVIREDSQSIFDLIIKCPTVHDTATYYCARA
Callorhinchus milii V97 trav AAVX02050534.1 2067 RGQDVVSQYPPEITDIEGKDVTLKCNISTLNTAFWYKQYPDGNLHYLYRIYTSGKVDKSPDLPERFTAELIKENKVIKLQILGAVVGDSAVYYCALE
Callorhinchus milii V96 trav AAVX02050479.1 1238 INGQDVVSQYPREKTEMEGQDVALNCNISRLATVFWYRQNPGGALHYALRIFSSGTVDKSPDLPERFTAELIKKNKVTKLQILGAVVGDSAVYYCALD
Callorhinchus milii V95 ighv AAVX02050366.1 434 VQADLVLKQPPYLTGKTGQALRLTCESSGFNLSIAHMSWYRQLPGKQQENLLQYEGSSIKSFGSGFENRVTVIREDSQSIFDLIIKCPTVHDTSTYYCKIK
Callorhinchus milii V94 trav AAVX02050079.1 1706 ASHQDSVAMKVSSISKREGDTVTIECTYSTHNTSYIIYWYRQYGDGIPEFIIWKYSGGNEAKADWAKSRFSVALLKSNTTVQLMVSQLQVADSARYHCALR
Callorhinchus milii V93 trav AAVX02049939.1 880 YCGGDSVTQLQATVTVNEGEAVYLQCNYTATSGSDTYLFWYRHYANKAPEYILNTYIRNNKQQRADFAKERFSTNVSNEERAVHLNISQVRLTDSAGYYCALS
Callorhinchus milii V92 trdv AAVX02049660.1 1649 VVLGAPVRQQRAGLSKQEGDTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGIDNTADYAKGRFASHLGKNQLQSTLIIPSVIVNDAATYYCALT
Callorhinchus milii V91 trav AAVX02049450.1 1528 NSLQHIGNQPIAEISVEEGKDVKLSCTLKKISDAYSLFWYRQASRNAPVYILLSVAGKDNKSPDFQQRFSSKVDKTKEDFKLSIANVLIGDSAVYYCANE
Callorhinchus milii V90 trav AAVX02049353.1 492 HCGGDSVTQLQSTVTVNEGEAVYLQCNYTATSAGDPYLFWYRHYANKTPEYILNTYIRNNKQQRADFGKERFSTNVSNAERTVHLNISQVRLTDSAGYYCALS
Callorhinchus milii V89 trav AAVX02049352.1 181 FGNESNAQISDEEGKDVILSCTLKKISDANYLYWYRQASRNSPVYILYSISGKDYTSPDFQDRFSSKVNKTNEDFELSIVTVLISDSAVYYCAKE
Callorhinchus milii V88 trav AAVX02049186.1 511 SLQDIGNQPIAEISVEEGKDVKLSCTLKKISDASSHYWYRQASRNAPVYILYSIAAKDYLSSDFQDRFSSKVNKTNEDFELSIVTVLISDSAVYYCAKR
Callorhinchus milii V133 trgv AAVX02021505.1 70515 ECDAQKLTQPALSTRKHSGKIVLFACKVEEVSFSSASIHWYRQTKHEALKGILYIQSELNPIREDGFDARFSAEKVENEKSCNLIIKGIELKDAGIYYCAYWD
Callorhinchus milii V132 trgv AAVX02021505.1 75973 FSLIQVEKTITKPEGKTTIFTCKMQGGSMSSSVIHWYRHQPGKELQWMLYYNTQSQKEYAEEFQQKFSARKKDDTCLLSITNIAKADAATYYCASWD
Callorhinchus milii V131 trav AAVX02067288.1 697 PVLTQSPAQVTVREGQTVHLLCAMKNGEMGKIHLHWYQRRPGQGNRQIITHYQNHVQRYDVTERFGSKKNLTDNSCTLTITDVRLTDSSIYTCA
Callorhinchus milii V130 trdv AAVX02066870.1 356 SVQPSQMEVSVAEGQTATLSCTYSADFSNVFIYWYGQYPGEPPLYTRRHDYDGETFSAEFAKQRFSTTLDTNTKRSSVTVLSVALSDTATYYCAIT
Callorhinchus milii V129 trav AAVX02065099.1 453 ALAESDVSQRPQTVKQHENGNVSMECTTTVSGPTFQWYTQYGNGSIRFLVLGKRDITVKDRIRALVNTKQRSCTLTIQHVRVSDTATYFCAD
Callorhinchus milii V128 trbv AAVX02063652.1 611 LSLGALVTQLPRTVTAREGETVTLRCYQKDSALNTMLWYLQPHQGGLTLIGYGYASNPTMEDAYKLDYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii V127 trav AAVX02062040.1 833 VYGQDVVTQYPPEITDFEGQNVTLNCSYSTINAAFWYRQYPDGAPQYLFRRYSSGKVDNPPDRSTAELIKENKVINLQILSDVVGDSAVYYCALN
Callorhinchus milii V126 trdv AAVX02060882.1 157 SSYSVSQSPPEQTAVAVERIHLHCQYSGFCGQDFSISWYRQSPGEGLKYLLQRKPSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSALYHCALS
Callorhinchus milii V163 trav AAVX02033984.1 3097 HCGGDAVTQLQSTATVNEGKAVYLQCNYTTTSTNPDLFWYRHYPSKATEYILWASTYSKPQNADIANERFSTNVSKAERTVPLKIIQVRVSDSAGYYCALS
Callorhinchus milii V162 trav AAVX02033984.1 8009 NSLQDIGNQPIAEISVEEGKDVKLSCTLQKISDTSYLYWYRQVSRNAPVFILQPVAGKDNKSPDVPDRFSSKVDKSNKDFKLSIVTVLIMDSAMYYCAKE
Callorhinchus milii V161 trav AAVX02033981.1 2289 VGGQNIVSQYPPEITDFEGKDVTLKCNISRLDTAFWYRQCPDGNLHYLFKIYTSGKVDKSPDLPERFTAELIKENKVIKVQILRAVVGDSAVYYCAQE
Callorhinchus milii V160 trdv AAVX02033981.1 6377 LCGGDSVSQKTARMVKKEGETVNFECIYSTTDNSYYLFWYRHYPHKQPDFIVRRYSSGNDDPVKGAGFGNRFSAQVQKSNSTTSLSVSELVVSDSAVYYCAFSL
Callorhinchus milii V159 trav AAVX02033980.1 1318 VLAESDVSQSPQAVTGNENGNLSMECNTTVSVPTFHWYTQYGNGSIRFLVLGTRDISENDRISALANTRQRNCTLTIQHLRVSDAATYFCAA
Callorhinchus milii V158 trav AAVX02033979.1 2413 VLADSDVSQSPQAVTGNENGNVSMECNTTGYSPTFHWYTQYGNGSIRFLVLGTKDINMKDRIRALANTRQRNCTLTIQNLRVTDTATYFCAE
Callorhinchus milii V157 trav AAVX02033977.1 5427 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNRPPEYILSTDTNNRIKKGADFAEERFSTNVSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii V156 trav AAVX02033977.1 6987 NGQDVVSQYPREKTEMEGQDVALNCNISRLATVFWYRQNPGGALRYALRIFTSGTEDKSPDLPERFTAELIKENKVIKLPILGAVVGYSAVYYCALD
Callorhinchus milii V155 trav AAVX02033977.1 9706 YCGGDSVTQLESSLTVNEGQDVTLQCNYTATSTTTPYLFWYRQYPNKAPEYILWTYSRGQPQHADFAKERFSTKLDESRRTVPLNISQVRVTDSAADYCALS
Callorhinchus milii V154 trdv AAVX02033976.1 29401 SRETVSQSPPEQSAFSGERINLHCQYSGICGKDFNVSWYRQSPGEELKYLLHTKPSGVGGNPSGGHISASLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii V153 trdv AAVX02033971.1 4415 SSYTVSQSPPEQTAFAGERIILHCQYSGFCGQDFSVSWYRQSPGEGLKYLLHRKSSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSAMHHCALS
Callorhinchus milii V152 trdv AAVX02033957.1 141 LCGGDSVSQKAAPMVRTEGESVTFECSYSTTESYFYLFWYRHYKEKQPEFIISRYSHSDNPDKGKGFENRFSAELQKSNSFTSLSISELVLSDSAVYYCAFT
Callorhinchus milii V151 trdv AAVX02033955.1 634 VVVGDSVREQTAALRKQEGDTVSLSCSYTTSSSFAALYWYRHHPGLAPQYILYRDTDGNDNTADFAKGRFTSQLHTNQRKTTLSISSVIVTDAATYYCGLSRG
Callorhinchus milii V150 ighv AAVX02033936.1 7048 VQAAVVVTQPPTLTGKTGQSLRLTCRTSGFDHASYGSAISWYRQLPGKQREILLISTSSSPNSFVSLVGNRFTVVREDNNNIFDLIIKSARVEDTATYYCGEE
Callorhinchus milii V149 igkv AAVX02024707.1 10776 VSGELVMTQTPSMLPVTVGQTATITCKASSSISNYLGWYQQKAGERPKLLIYSATTLYTGTPARFSGHQSSTTFTMTITGVQPEDFADYYCMGYQSSS
Callorhinchus milii V148 iglv AAVX02021507.1 1963 GCDGFTLSQPLSMFGKLGKIARITCTKNNIGNDYIHWYRETPGKGLQWILYYHSEDKKENLPDFPRFSAHKSGDSCTLRIIRLTSDDSGIYYCGVWD
Callorhinchus milii V147 iglv AAVX02021507.1 6018 GCDGFTLSQPRSMIVKSGKAAMITCRKSDMENDYVHWYRETPGKGLQWILYYHSEDKKDNSPDFPRISAHKSGDSCTLRIIRLTSDDSGIYYCGVWD
Callorhinchus milii V146 iglv AAVX02021507.1 8736 GCDGFTLSQPRSMIKNQGRTAMITCTMHGKSMGNDYVHWYLGNPGKGLQWILYNKGTETETSPDFPRRFSADKSEDSSILTITKVKPNDSGIYYCGVWD
Callorhinchus milii V145 iglv AAVX02021507.1 10183 GCDGFTLSQPRSVIVKSGSIARITCTKNNIDNDYVHWYRENPGKGLQWILYYHSENKKDNSPDFLVYSAHKSGDSCTLRIKSLTSDDSGIYYCGVWD
Callorhinchus milii V144 iglv AAVX02021507.1 12585 GCDGFILSQPLSMIGKLGSVVRITCTKNDMGNDYVHWYRENPGKGLQWILYYHSGNKKDNSPDFPRFSAHKSGDSCTLRIKSLTSDDSGIYYCGVWD
Callorhinchus milii V143 iglv AAVX02021507.1 14981 GCDGFTLSQPRSMTGKSGKVARITCTKNDMGNDYVHWYRENPGKGLQWILYYHSENKKDNSPDFLGFSADKNRDSCTLKIKSLTSDDSGIYYCGVWD
Callorhinchus milii V142 iglv AAVX02021506.1 2101 GCDGFTLSQPRSMIKNQGRTARITCTMHGKSMGEDYVHWYLGNPGKGLQWILYNKGTETKISPDFPRRFSADKSGDSSILTITKPEPNDSGIYYCGVWD
Callorhinchus milii V141 ighv AAVX02021506.1 3661 GCDGLSLTQPGSMVKKTGRTVEMTCTLAGASMQNVYVHWYRGNPGKEFQWILYYRSESQTKTSPAFSERFSAVKSGQLCILTIIKPVQEDTATYYCGLWH
Callorhinchus milii V140 iglv AAVX02021506.1 6389 GCDAFTLSQPLSMIVKSGKVATITCKKNNIDNDNVHWYRESPGKGLQWILYYHSRNKKDNSPDFLSRFSSDKSGDSCTLTIIRLTSDDSGIYYCGVWD
Callorhinchus milii V139 iglv AAVX02021506.1 10003 GCDGFTLSQPRSMIAQLGRVAKLSCTKSDMGNDFVHWYRETPGKGLQWILYYHSEDEKDNSPDFPRFSADKSGDSCTLTSIRLTSDDSGIYYCGVWD
Callorhinchus milii V171 trav AAVX02033987.1 3142 HCGGDSVKQLESTLTVNEGEAVHMHCNYTTADNNPNLFWYRHYPNKAPEYILWASTYSKPKYADFAKERFSTNVSKAERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii V170 trav AAVX02033986.1 465 AETQLQSTVTGTEVEDVYLQCNYTATSEYNTYLFWYRHFPNRPPEYIFSTDTNRIKNGADFAEEGFSTNVSKAERTVPLNILQVRVTDSVGYYCALS
Callorhinchus milii V169 trav AAVX02033986.1 2049 VSGQDVASQYPREKTEIEGQSVILNCNISRLAIVFWYRQNPGGALQYELRIFASGKVDKSPDLPERFTAELFKENKVIKLQILGAVVGDSDVYYCALEP
Callorhinchus milii V168 trav AAVX02033986.1 3719 DSVTQLQSTLTVNEGENVYMQCNYTATSTSDPNLFWYRHYPNKAPEYILRTDTSNKFPDHADFAEGRFSTNVSKGERTVPLNISQVRVTDSAGYSCALS
Callorhinchus milii V167 trav AAVX02033986.1 8853 VSGQDTVSQSPLSVTVWQKEHVFICCSTTDTSQALQWYRQYPNQALTHLVTGKTGQQQKERITATMSYRDGKSNLSIRHTEVTDAATYLCAVE
Callorhinchus milii V166 trav AAVX02033986.1 10823 SGQDTVSQSPLTVTVVENEQVIISCSTTESQALQWYRQNPNQALKHLVTGETGVQQKKSITATMNYRENGSNLSITGTEVTDAATYFCAVETQ
Callorhinchus milii V165 trav AAVX02033985.1 641 SGQDVVSQYPREKTEIEGQDVILNCNISRLDTVFWYRQNPGGAPQYALRIFTSGKVSKSPDLPERFTAELIKENKVIKLQILGAVVGDSAVYYCAL
Callorhinchus milii V164 trav AAVX02033984.1 704 IGGQVVVTQYPPEITEFEGQNVTLNCSYSTKVTAFWYMQNPDGALQYLFRIYASGKAENLPDRFVAELIEENKVIKLQIHWAVVGDSAVYYCALE
Callorhinchus milii V276 trav AAVX02044120.1 9798 VLAESDVSQRPEAMTENEHGNVSMECSITGNKPYFHWNKQYGNGSIRFLVLGKGDINVKDRIRAFANTRQGNCTLTIQNVRVSDTAAYFCAV
Callorhinchus milii V275 trdv AAVX02044074.1 3945 IANGISVEPSMMEVSVGEGQTVNMSCTYTTDFTDVVMYWYRQYPGEPPLYTRRHDYDGDTFSAEFAKQRFSTNLDTNTKRYSLTVFPVALSDMAKYYCAIR
Callorhinchus milii V274 trav AAVX02043975.1 312 LCDGDSVSQKAAPKVRKEGETVTFECTYSTSYSSYNLYWFRHYPDKQPEFIVGRYSRDDNQYKGTGFGNSFSAQLQKSNSFTSSSISELVVSDSAVFYCAFS
Callorhinchus milii V273 trav AAVX02043848.1 1793 HCGGDAVTQLQSTVTVTEGEDVYLMCNDTATSGYNTYLFWYRHFPNTSPEYILSTDTNNRIKEGAYFAEERFSTNVSKAERTVPLNILQVRVTDSARYYCALR
Callorhinchus milii V272 trdv AAVX02043747.1 114 FGDTAAITLTVNEGDDVSLQCNYTARSGSGNNYLFWYRHYPNKAPEYILRTDTSNKLPDHADFAKERFSTDVSKAERTVPLNIIQVRVADSAGYYCALS
Callorhinchus milii V271 trav AAVX02043747.1 2830 DLAESDFSQTPQAVTVNENGNVSIECSTTVNNPFFQWYKQHGKGSIRILVLGKSDVNMKERIRALAERKQKTCTLTIEDVQISDTAIYFCAE
Callorhinchus milii V270 trav AAVX02043747.1 10757 VVAEVGGQDVISPNIPEITEIEGQDVTLNCNISRLDTILWYRQYPDGAPQYFLSIYTSGGVDKPPGLPHRFAAYVNKRNKIMNLQIHRAVVGDSSVYYCALE
Callorhinchus milii V269 trav AAVX02043747.1 14016 DSVTQLQSTVTVKEGETVYLQCNYTATSDNNPYLFWYRHSPNKPPEYILRTDTSNKFPGHADFAKERFSTNVSKAERTVPLNISHVRITDTAGYYCALS
Callorhinchus milii V268 trav AAVX02043516.1 2228 YCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSGYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADFAEERFSTNVSIAERTVPLNILQVRVRDSAGYYCALS
Callorhinchus milii V267 trdv AAVX02043515.1 1399 LTHGDSVTQKVASVTGKEGGSVTMECHYDTSLSSYFLHWCREQQEKQPQYVLKKGSGGDTYKADFAKKRFSAELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii V266 trav AAVX02043515.1 6361 VHAEINVSQRPQAVTENENGNVSVECTNTESTNAIQWYTQYGNRSIRFLVLGTRDINVIDRISALAIPGQRNCTLTIQNLRVTDTATYFCAA
Callorhinchus milii V265 trav AAVX02043515.1 8404 NSMQDIVNQPIAEISVEEGKDVKLSCTLKKISDAYSLFWYRQTSRNALVYILLSVAGKDNKSPDFPDRFTSNVDKTSEDFKLSIATVLIGDSAVYYCAKE
Callorhinchus milii V264 trdv AAVX02043514.1 772 VVVGDSIRQQTAGLSKQEGDTVSLSCSYTTSSAYAALYWYRHHPGLAPQYILYRDTDGNDHAADFAKGRFTSQLDKNQRQTTLNILSIIVTDAATYYCGLRTD
Callorhinchus milii V263 iglv AAVX02043473.1 941 GCDGFTLSQPRSIIAKSGSVARITCTKNNIDNDYVHWYRENPGKGLQWILYYHSGNKKENSPDFPSFSAQKIVDSCTLRIKSLTSGDSGIYYCGVWD
Callorhinchus milii V262 iglv AAVX02043472.1 2248 GCDGFTLSQPRSMIVKLGKVARITCIKNNIGNDYVHWYRETPGKGLQWILYYHSEDKTDISPDFSRFSADKSGDSCTLIIIRPTSDDSGIYYCGVWD
Callorhinchus milii V261 iglv AAVX02043472.1 4924 GCDGFTLSQPRSMINNQGRTARITCTMHGKSMGNDYVHWYLGNPGKELQWILYNAGTKTENSPDFPLRFSADKSGDSSILTIIKVKPNDSGIYYCGVWD
Callorhinchus milii V260 ighv AAVX02043472.1 6142 GCDGLSLTQPGSMVKKTGRTVEMTCTLAGASMQNVYVHWYHGNPGKEFQWILYYRSESQMKTSPAFSERFSAVKSGQLCILTIIKPVQEDTATYYCGLWH
Callorhinchus milii V259 iglv AAVX02043471.1 1604 GCDGFTLSQPRSMIVKLGKVARITCTKNNIGNDDVHWYRETPGKGLQWILYYHSGNKKENSPDFSSRFSADKGGDSCTLTIIGLTSDDSGIYYCGVWD
Callorhinchus milii V258 iglv AAVX02043471.1 5853 GCDGFTLSQPRSTIGKSGKAARMTCRKNNIGNDYVHWYRETPGKGLQWILYYHSGNKKDNSPDFSSRFSADKSGDSCTLRIRSLNSDDSGIYYCGVWD
Callorhinchus milii V257 trdv AAVX02043443.1 4801 FCDGDSVIQKAATMVKKERESVILQCTYSTTEIAYALHWYRHYVGKQPEFIIWSYPGGESQKKGEGFGDRCHAQLHKFNSSTSLSISELVVSDSAVYYCAFSL
Callorhinchus milii V256 trdv AAVX02043443.1 9355 LTQGDSVTQKVASVIEKVGVSATMECHYDTSLSSYYLNWHGEQQETQPQYVLQKGSRGSTHKADFAKTRFSIELQTATKFTSLTISLLELSDSAVYYC
Callorhinchus milii V255 trdv AAVX02043442.1 256 SSYTASQSPPEQSAFAGERINLNCQYSGLYGQNFSVSWYRQSPGEELKYLLHRNRSGEGGNLTGDHISASLDTAKKISVLTIAGLRLTDSAKYHCALS
Callorhinchus milii V314 trav AAVX02045494.1 429 VSGQQKVYQSPLSVTVGEKENVLINCSAEGTTQALQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSHLSITGTGVTDAATYVCAVE
Callorhinchus milii V313 trav AAVX02045388.1 525 AVLGDSVRQQTAGLTIQEGDSVSLSCSYPTSSSYAALYWYRHHPGLAPQYILYRTINGNIYRADFAKGRFNSQLDTNQRQTTLSISSVIVTDAATYFCGLRTE
Callorhinchus milii V312 trdv AAVX02045388.1 3824 LTKGDSVTQKVTLVTGKEGGSVTMECHYDTSLSDYYLHWYREQQETQPHYALKKGSVCDKYKADFAEKRFSVELQTSTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii V311 trav AAVX02045388.1 7160 ISLHDPGKQSTDEILAQVGEDVKIYCSLKKVSDASYLYWYRKASRNVLVYILRSFGGKDKNNPDFPNRFYSTVDKTSEEFELSIDTVLMTDSAVYYCAKE
Callorhinchus milii V310 trdv AAVX02045323.1 3046 SSYSVSQSPPEQTAVAVERIHLHCQYSGFCGQNFSVSWYRQSPGEGLKYLLHRNPSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii V309 trdv AAVX02045320.1 939 VVVGDSVREQTAGLSKQEGDTVSLSCSYTSSSSYPALYWYRHHPGLAPQYILYRDTIGNDNTADFAKGRFTSQLDTNQRTTTLSISSVIVTDAATYYCGLTT
Callorhinchus milii V308 trdv AAVX02045244.1 4504 ICDGDSVSQKAATTVKIEGQSEVIECTYSTTVGYYYLFWYRHYPDQQPEFIFRSYSNRDNPVKGPGFGNRFTAVLHKSISFTGLTISELVLSDSAVYYCAFS
Callorhinchus milii V307 trdv AAVX02045244.1 7462 VVLGAPVRQQRAGLSKQEGDTVILSCSYINSSNYVALYWYRHHPGLAPQYILYRHSNGIDNTADYAKGRFASHLGKDPLQSTLIIPSVIVNDAATYYCALTSV
Callorhinchus milii V306 trdv AAVX02045220.1 94 VTQGDSVTQKVASLIGKEGGSVTMECHYDTSLSNYYLNWYREQKETQPHYVLQKYSGGHTDKADFAKKRFSIELQTSTKFTSLTISLLELSDSALYYCALE
Callorhinchus milii V305 trav AAVX02045220.1 4948 VFAEINVSQRPQAVTENENGNVSVECTTTESTNAFQWYIQYGNGSIRFLVLGTSDISVKERIRALSNTRQRNCTLTIQNLRVTDTATYFCAA
Callorhinchus milii V304 trav AAVX02045220.1 6973 NSLQDIGNQTIAEISVEEGKDVKLSCTLKKISDANYLYWYRQASRNTPVYILYSIAGKDYMSPDFPDRFSSIVNKINEDFELSIVTVLIGDSAVYYCGKE
Callorhinchus milii V303 trdv AAVX02045192.1 3976 SSYTVSQSPPEQSAFAVERIKLHCQYSGYCGQDLSVSWYRQSPGGELKYLLHRKPSGEGGSPTGDHISVSLDTAKKTSVLTIAGLRLTDSAMYHCALS
Callorhinchus milii V302 trdv AAVX02045191.1 4922 LTQGDYVTQKVASVTGKEGVSVTMECHSDTSMSYYYLHWNREQQETQPQYVLQKGSGGDIYKADFAEKRFSIELQTSTKFTSLTISLLELSDSAVYYCALQ
Callorhinchus milii V301 trdv AAVX02045189.1 5162 VTQGDSVTQKVASVSGKEGGSVTMQCHYDTSLSNYYLHWYREQQETQPQYVLQKGSGGTYKADFAEKRFAIELQTSTKFTSLTISLLELSDSAVYYCALQ
Callorhinchus milii V300 trdv AAVX02045180.1 1782 VVLGDSVRQQTAGLTKQEGDTVSLSCSYTTSSSCAALNWFRHQPGLAPQYVLYRDTAGGSNTADFAARRFSSQLNKNQRQTTLIIRSVVITDAATYYCGLTS
Callorhinchus milii V299 trav AAVX02045122.1 7858 AVTQLQSTVTVNEEEDVSLQCNYTDTSGSGNLCLFWYRHYPNKSTEYILSTDTNNRIKKGADFAEERFSTNVSKAERTVPLNILQVRVTDSAGYHCALS
Callorhinchus milii V298 trav AAVX02045120.1 2748 RCGGDGVTQLQSIVIVTEGEDVSLQCNYTGASDGSDYLFWYRHLTNKAPEYILRTSTNNRNKDHADFAKERFSTNVSKSEKTVPLNILHVRVADSAGYYCALS
Callorhinchus milii V297 trav AAVX02045120.1 4692 VSGQDTVSQSPLSVTVGEKEQVIISCFTTQSRALQWYRQYPNQSLKHLLTGQTGEQQMKRITATMNFREKGSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii V296 trav AAVX02045120.1 6841 VYGQDAVTQYPPEITDFEGENVTMNCSYSTINAAFWYRQNPDGAPQYLFRIYSSGKVDSPPDRFTAELIKENKVINLQILSAVVGDSAVYYCALE
Callorhinchus milii V295 trav AAVX02045120.1 9147 HCGGDSVKQLESTVTVNEGEAAHMHCNYTTADINPNLFWYRHYPSKAPEYILWASAYSKPKYADFAKERFSTNVSKAERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii V294 trgv AAVX02045118.1 299 SVTQLQSTVRVKEGETVYLQCNYTATNDNNPYLFWYRHCPNKPPEYILRTDSSNKFPDHADFAKERFSTNVSKAERTVPLNISHVRVTDTAGYYCALS
Callorhinchus milii V293 trav AAVX02045118.1 5753 VSGQGTVSQSPVSVTVGETERVIFSCSATGSNNALQWYRQYPNQALKHLVTGKTGEQQKERITATMNYREKGSNLSITGTEVTDAATYLCAMETQ
Callorhinchus milii V292 trav AAVX02045118.1 7577 GLAESDVSQRPEAMTVNEHGNASMECSITGNNPYFQWYTQYGNGSIRFLVLGKGYINVKDRIRALANTRQRNCTLTIENVRVSDTATYFCAA
Callorhinchus milii V291 trav AAVX02045118.1 9713 NSLQNTAKQQKGDTTVEEGNDVKLSCSLKKIGDTSYLYWYRKASRNAPVYILRSISGTDYMSSDFPNRFSSTVNKTSEDFELSIVTVLIRDSAVYHCAKR
Callorhinchus milii V290 trdv AAVX02045073.1 2777 SSKAVSQSPPEHMSFAGENITLFCKVTACSGEDFSVSWYRHSPGEELRYLLHGKPSGEGGNPTGGHTSASLDTAKKVSVLNIAGLRLTDSAMYHCALS
Callorhinchus milii V289 trav AAVX02045016.1 590 VYGQDVVSQYPPEITDFEGQNVTLNCSYSSLQAAFWYRQYPDGTPQYLFRIYSSGNVDNPPDRFTADLTKENKVIELHILGAVVGDSAVYYCALE
Callorhinchus milii V288 trav AAVX02045016.1 3284 YCGGDSVTQLQSAVTVNEGEAVYLQCNYTATSGSDTYLFWYRHYANKAPEYILNAYIRNNKQQHADFAKERFSTNVSQAETTVHMNILQVRVIDSAGYYCALS
Callorhinchus milii V287 trav AAVX02045016.1 5934 VLAEIGVSQSPQAVTGNETGNVSMECNTTVSDPTFHWYTQHGNGSIRFLVLGTREIDVKDRIRALANTRQRNCTLRIQDLRVSNTATYFCAA
Callorhinchus milii V286 trdv AAVX02044442.1 1396 SNYTVSQSPPEQTAFSGERINLHCQYSGYCGQDFSVSWYRQSPGEELKYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIANLRLTDSAMYHCALS
Callorhinchus milii V285 trav AAVX02044435.1 1265 SLCQKAATVVQKERETVTLQCTYSTTQSAHGLFWYRNDQDKQPEFIIRRDTRNDSHVSATGFGKSFYAKLHKSISTTSLSISALVLSDSAVYYCAINL
Callorhinchus milii V284 trdv AAVX02044435.1 3036 FCDGDSVTQKAATMVKKERETVILQCTYLTTESDYLLHWYRHYAGKQPEFIIWRYSGSELEEKGVGFGNRFSAQLHKSNSSTSLSISELVVSDSAVYYCALQ
Callorhinchus milii V283 trdv AAVX02044431.1 249 SSYTVSQSPPEQTAVAGERINLHCQYSGICGKDFSVSWYRQSPGEEPKYLLHRNPSGEGGNSNGGHISASLDTAKKISILTIAGLRLTDSAMYHCAIS
Callorhinchus milii V282 trav AAVX02044398.1 2413 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTETLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSHLSITGTEVTDAATYLCAVE
Callorhinchus milii V281 trav AAVX02044397.1 1782 LGQDVVSQYPPEITDIEGKDVTLKCNISTLSTAFWYKQYPDGNLHYLFRIYTSGKVDKSPDLPERFTAELIKENKVIKLQILGAVVGDSAVYYCALE
Callorhinchus milii V280 trav AAVX02044397.1 4285 SVTQLQSTAAVNEEEDVYLQCNYTATSTIDPYLFWYRHYPDKSPEYILITDSSNKFPDHADFAKGRFSTNVSKGERLVPLNISQVRVTDSAEYYCALS
Callorhinchus milii V279 ighv AAVX02044346.1 12201 VQSGAVMTQPPTLIGKTVQALRLTCRISGFNLANYWMHWKRQFPGKQRENFLAYFSSSNYFESEIENRVTVIKDTSKNIFDVIIKSPTVEDTATYYCGAR
Callorhinchus milii V278 trav AAVX02044120.1 2687 SGQDVVSQYPRGKTEIEGQDVAVNCNISRLDTVFWYRQNPGGALQYALKIFTSGKVSKSPDLPERFTAELIKENKVIKMQILSAVVGDSAVYYCALD
Callorhinchus milii V352 trav AAVX02047816.1 4808 AVTQLQSTVKVNEGEDVYLQCNYTATTTSDPDLYWYRHYPNKAPEYILWTDKRNNPRHADFAKDRFITHVDEAERTVPLNISHVTVVDSAVYYCALSPTE
Callorhinchus milii V351 trdv AAVX02047734.1 197 LCGGDTVNQKEASRLKREAETVKLKCTYSTIQSNYRLFWYRRYPVKQPEFIVVLYSSDDDEDKGEGFGNRFSAQLQKSNSTTSLTISELVLSDSAVYYCAFT
Callorhinchus milii V350 trdv AAVX02047734.1 6179 SSCTVSQSPPEQTAFAGERINLHCQYSGSCGQNFSVSWYRRSPGEGLKYLLHRNPSEEGGNSNGDHISASLDTAKKICVLTITGLGLTDSAMYHCALS
Callorhinchus milii V349 trdv AAVX02047644.1 4249 SNFTVSQSPPEQTAFAGERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGVNPTGDHISASLDTAKNIRFLTIADLRLTDSAMYHCALS
Callorhinchus milii V348 trdv AAVX02047643.1 382 LTEGDSVTQKVGSVTGKEVGSVTMECHYDTSLSSYYVNWYREKQEAQLQYVLQKGSRGSTDIADFAKKRFSAELQTSTNFTSLTISLLELSDSAVYYCALQ
Callorhinchus milii V347 trav AAVX02047470.1 4530 VSGQDVLSQYPREKTEIEGQDVRLHCSISRLDTVFWYKHNPDGALKYVLRIFTSGKVYKSSDLPERFTAVLIKKNKVIKLQILGPVVGDSTVYYCALE
Callorhinchus milii V346 trav AAVX02047470.1 6909 DSVTQLQSAVTVNEGEVVYLQCNYTAASTSDPYLFWYRHYPNKAPEYILRTDTSNKFPDHADFAKGRFSTNVSKVERTVPLNISQVRVTDSAGYYCALS
Callorhinchus milii V345 trdv AAVX02047334.1 4231 SNYTVSQSPPEQTAFAGERTNLHCQYSGYCGQDFSVSWYRQSPGETLEYLLHRKPSGEGGNPTGDHISVSLDTAKKISVLTIADLRLTDSALYHCALS
Callorhinchus milii V344 trdv AAVX02046891.1 4022 LTQGDSVTEKVASVTGKEGGSVTMECHYETSLNGYYLYWYREQQEKQPQFPLKKGSSGDIDKADFAKKRFSAELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii V343 trav AAVX02046891.1 7309 YCGGDSVTQLESSSTVNEGEDVTLQCNYTATSTTTPYLFWYRHYPNRAPEYILWTYSRGQPQRADFAKERFSTKVEERRRTVPLNIAQVRVTDSGAYNCALS
Callorhinchus milii V342 ighv AAVX02046860.1 2109 VQAEVVLTQPPSLTGKPGHPLRLTCKTSGFDLSSYTMSWVRQVPGKGLEWLLYYYSSSNNAFAPGIEDRVTVTKDLSNNIFDLTIKSPRVDDTAIYYCARE
Callorhinchus milii V341 trdv AAVX02046847.1 2616 YNYTVSQSPPEQTAFAGERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRNPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V340 ighv AAVX02046834.1 6818 VQTTVVMTQPPTLTGKTGQALRLTCRSSGFNYNRYYCMFWYRQLPGKQREKLLTSNGISSNSFESGVGNRVTVVRENSNNIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii V339 trdv AAVX02046757.1 5263 SSYTFSQSPPEQTAFAGERINLYCQYSGLCGQDFSVSWYRQSPGETMEYLLHRKPSVEGGNPTGGHISVSLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii V338 trdv AAVX02046756.1 577 TANGASVQPSQMEVSVPEGQTATLSCTYSADFSNVFMYWYRQYPGEPHLYTRRHDYDGETFSAEFAKQRFSTTLDTNTKSSSVTVRSVSLSDTATYYCA
Callorhinchus milii V337 trav AAVX02046742.1 7399 YCGGDSVTQLESFLTVNEGEDVSLQCNYTTTSINTPYLFWYRHYPNRAPEYILWTYSRGQPQHADFAKERFSTKLDESRRTVPLNISQVRITDSAAYYCALS
Callorhinchus milii V336 trav AAVX02046627.1 1677 DSVTQLQSAVTVNEGEVVYLQCNYTAASTSDPYLFWYRHYPNKAPEYILRTDTSNKFPDHADFAKGRFSTNVSKVERTVPLNISQVRVTDSAGYYCALS
Callorhinchus milii V335 trav AAVX02046627.1 4542 LLAASDVSQIPQAVTVNENGNVSMECIASVTSPVFHWYKHYGNRSIRFLLLGKSDVNTKDRIRALAERKQKNCTLTIEDVRISDTAIYFCAE
Callorhinchus milii V334 trdv AAVX02046613.1 5269 VVLGDSVRQQTAWLSKQEGDTVSLSCSYTTSSTYAALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNQEQTTLIILSVIVTESATYYCGLRSD
Callorhinchus milii V333 trav AAVX02046598.1 4017 VYGQDAVTQYPPEITDFEGENVTMNCSYSTINAAFWYRQNPDGAPQYLFRIYSSGKVDSPPDRFTAELIKENKVINLQILSAVVGDSAVYYCALE
Callorhinchus milii V332 trav AAVX02046598.1 6327 HCGGDSVKQLESTVTVNEGEAAHMHCNYTTADINPNLFWYRHYPSKAPEYILWASAYSKPKYADFAKERFSTNVSKAERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii V331 trav AAVX02046597.1 2592 HCGGDSVTQRQSTVITNEGDDVYLQCNYTTTSINTPYLFWYRHYPNKAPEYILRTDTSNKFPDYADFAKERFSTIVSKAERTAPINISQVRVTDSAGYYCALS
Callorhinchus milii V330 trav AAVX02046597.1 8058 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGKTGEQQKERITATMNYKEKGSHLSITGTEVTDAATYLCAVE
Callorhinchus milii V329 trav AAVX02046226.1 2578 VSGQDTVSQSPLPVTIAEKEQVINSCSTTQSQVLQWYKQYPNQTPKHLVTGQTGEPQKGRITATMNYREKGSNLSITGAEVTDAATYLCAVEIGR
Callorhinchus milii V328 ighv AAVX02046223.1 1066 VQTAVVMTQPPTLTGKTGQSLRLTCRSSGFNYNRYYCMYWYRQLPRKQREKLLTSDCYSSNSFESGVGNRVTVVREDNNKIFDLIIKSPRVEDTATYYCAAD
Callorhinchus milii V327 ighv AAVX02046069.1 8684 VQASGSLTQPPTLTGKTGQSLRLTCRTSGFDHDSYYYCMYWYRQLPGKQREKLLTSDYRSSNSFESGVGNRVTVVRENSNNIFDLIIKSPRVEDTATYYCGAY
Callorhinchus milii V326 trdv AAVX02046002.1 3819 LCDGNSVSQKAATMVKRKGETASFECTYSTTLSDYDLSWYRHYPDKQPEYIVRRYSGNENQYRGTGFGNRFSAQLHKSISSTSLSISELVVSDSAVYYCAFS
Callorhinchus milii V325 trdv AAVX02046002.1 8417 SSYTVSQSPPEQTAFAGERINLHCEYSGFCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSALYHCALS
Callorhinchus milii V324 trdv AAVX02045880.1 1862 SSFTASQSPSEQTAVAGERINLHCQYSGFCGQNFSVSWYRQSPGETLEYLLHRNPSGEGGKPTGGHISVSLDTAKKSRVLTIAELRLTDSAMYHCALS
Callorhinchus milii V323 trdv AAVX02045854.1 3242 SSFTVSQSPPEQTAFAGERINLHCQYSGFCGQNFSVSWYRQSPGEGLKYLLHRKPSGEAGNPTGDHISVSLDIAKKISVLTIADLRLTVSAMYHCALS
Callorhinchus milii V322 trdv AAVX02045849.1 518 SSYTISQSPPEQTAFAGERINLHCQYSGFCGQNFSVFWYRQSPGETLKYLLYRNPSGEAGNSNGYHISASLDAAKNISLLTIAGLRLTDSAMYHCALS
Callorhinchus milii V321 iglv AAVX02045739.1 1234 GCDGFTLSQPRSIIAKSGKAAMISCTKSDMENDYVHWYRETPGKGLQWILYYHSGNKKENSPDFPRFSAHKSGDSCTLRIKSLTSDDSGIYYCGVWD
Callorhinchus milii V320 iglv AAVX02045738.1 2238 GCDGFTLSQPRSMIVKSGKAARISCTKNNIGNDYVHWYRETPGKGLQWILYYHSEDNKDKSLDFLGFSAQKSGESCTLRIKSLTSIDSGIYYCGVWD
Callorhinchus milii V319 ighv AAVX02045723.1 809 VQADLVLKQPPYLTGKTGQALRLTCESSGFILNITHMSWYRQLPGKQQENLLQYDGSSIKSFGSGFENRVTVIREDSQSIFDLIIKCPTVHDTSTYYCEIK
Callorhinchus milii V318 trav AAVX02045675.1 547 VSGQDAVTQYPPEITDFEGENVTMNCSYSTINAAFWYRQNPNGAPQYLFRIYSSGKVDSPPDRFTAELIKEKKVINLQILSDVVGDSAVYYCALD
Callorhinchus milii V317 trav AAVX02045675.1 3143 YCGGDSVTQLQSAVTVNEGEAVYLQCNYTATTGSDAYLFWYRHYPNKAPEYILNTYIRNNKQQRAVFAKERFSTNVSNAERTVHLNIFQVRLTDSAGYYCALS
Callorhinchus milii V316 trav AAVX02045553.1 2460 YCGGDSVTQLQSTVTVNEGETVYLQCNYTATSDNPYLFWYRHYANKAPEYILNTYIRNNKQQLADFAKERFSTNVSQAETTVHMNILQMRVTDSAVYYCALS
Callorhinchus milii V390 trav AAVX02058938.1 349 VLAASDVSQTPQAVTVNENGNVSMECSTTVNNPLFQWVKHYGNGSIRFLVLGKTDVNMKGRIRALAERKQKNCSLTIEDVRISDTAIYFCAE
Callorhinchus milii V389 ighv AAVX02058269.1 622 VQAAVVMTQPPTLTRKTGQSLRLTCRSSGFYSSYYYCMFWYRQLPGKQREKLLTSIGYSSSSFESGFGNRVTVVRENSNRIFDLIIKSPRVEDTATYYCAAE
Callorhinchus milii V388 trav AAVX02058063.1 862 FCGGDSVTQLQSIVTVTEGEDVSLQCNYTGASDGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHSDFAEERFSTNVSKAERTVPLNILHVRVTDSAGYYCALS
Callorhinchus milii V387 trdv AAVX02054736.1 556 IANAISVEPSQMEVSVGEGQTANMSCTYSADFTDVLMYWYLQYPGDPPLYTRRHDYDGDTFSAEFAKQRFSTTLDTNTKRYGLTVFPVALSDMAKYYCAIR
Callorhinchus milii V386 trdv AAVX02054275.1 943 SSYTVSQSPPEQTAFAGERINLHCQYSGFCAEDFSVSWYRQTPGEELKYLLHRNPSGEGRNPTGDHISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V385 trbv AAVX02053961.1 472 LSLGALVTQRPRTVTAREGETVTLRCSHNDKSLNMMLWYIQPHQGGLTLIGYGYLSNPTYEKGFESGYNITQSNDKNKSSLEISSMNPTQEGVYYCAARE
Callorhinchus milii V384 trav AAVX02053374.1 286 DSVTQLESSLTVNVGQDVTLQCNYTAISTTTPYLFWYRHYPNRAPEYVLRKDTNNKFPDHADFAKQRFSTNVSKEERTAPINIIQVRVADSAVYYCALS
Callorhinchus milii V383 trbv AAVX02053346.1 316 LSLGVLVTQGPRTVTATEGETVSFTCYQNDSALDTMLWYIQPHQGGLTLIAYIYMSPTYEKGFESGYNMTKTTNDKESTLEISSLNPTQEGVYYCAARE
Callorhinchus milii V382 trbv AAVX02053346.1 1505 LSLGALVTQEPRTVTAREGETVTLRCSQHDSALNTMLWYVQPHQGGLTLIGYNRASTTYEDKFKSGYNITKTPDRMNSTLEISNINPTQEGVYYCAARE
Callorhinchus milii V381 trdv AAVX02052768.1 1439 SSYTVSQSPPEQTAFAGERINLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTRDHISASLDTAKKISVLTIAELRLTDSAMYHCALS
Callorhinchus milii V380 trav AAVX02052133.1 685 VVLGDPVRQQTAGLSKQKGDSVSLSCSYNTTSNYAALYWYRHHPGLAPQYILYRHTNGVDNTADYAKGRFTSHLDKNQEQTTLIILSVIVTDSATYYCGLRSD
Callorhinchus milii V379 trav AAVX02051800.1 142 VSGQDTVSQSPLTVTVVEKEKLIISCSTTEQNRILQWYRQYPNQPLKHLVSGQTGEQQKERITATMNYREKGSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii V378 trav AAVX02051642.1 2427 HCGGYAVTQLQSTVTVTKGEDVYLQCNYTATSEYNTYLFWYRHFPNKSPEYILSTDTNNRIKNGADFAEERFSTNLSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii V377 trdv AAVX02051379.1 886 LCDGDPVSQKAASMVKRKGETASFECPYSTTLSSYDLAWYRHYPEKQPGVIVRRNSGNENQYRGAGFGNRFSAQLHKSNSSTSLSISELVVSDSAVYYCAFN
Callorhinchus milii V376 trav AAVX02050774.1 3358 SILQDIGNQPIAEISVEEGKVVKLSCTIQKISDTSYLYWYRQVSRNAPVYILQSVAGKDNKSPDFPDRFSSKVDKSNEDFKLSIVTVLIMDSAVYYCAKE
Callorhinchus milii V375 trdv AAVX02050326.1 2211 VCGGDSVSQKHSMMVMKEGETVTFQCTFSTTENSYSLFWYRHYPDKHPEFIVRRDSDDYEAKGDGIGNRFTSQLDTSKSVTKLSVSMLLLSDSAVYLCAVSPDI
Callorhinchus milii V374 trav AAVX02050316.1 1006 DGENVVNEYPPEITGIEGQNVTLNCSYSTMNAALWYRQYPDGALQYLFRIYSSGKVDNPPDRFTAELIKEKKVINLQILSAVVGDSAVYYCALE
Callorhinchus milii V373 trav AAVX02050283.1 159 VLAESDVSQSPQVVTGNENGNVSMECNTTGYSPTFQWYKQYGNGSIRFLVLGKSEVNVKDRIRASTNTKEKNCTLTIKNVRLTDTATYFCAD
Callorhinchus milii V372 ighv AAVX02049846.1 3286 VQADLVLTQPPTLTGKTGQALRLTCETNGIDLSRNYTGWFRQLPGKQREKLLVHDGSSIESFGSGIENRVTVIREDSQSIFDLIIKCPTVHDTATYYCARA
Callorhinchus milii V371 trbv AAVX02049729.1 265 LSLGALVTQLTRTVTAREGETVSLNCQHNDKSLTVMLWYLQPHQGGLILIGYNEFSTVYEDKFKSGYNITKTPDNMNSSLEITNMNPTQEGVYYCAARE
Callorhinchus milii V370 trbv AAVX02049729.1 1674 LSLGALVTQWPRTVTAREGETVTLRCYQNNTKYETMLWYLQPHQGGLTLIGYGYYSTPTMEDAYKLDYEVKQTDDYKNCSLEIKNPTQEGVYYCAARE
Callorhinchus milii V369 trbv AAVX02049728.1 212 LSLGALVTQEPRTVTAREGETVSLRCSQHDSPLNTMLWYIQPHQGGLTFIGYNQYSTIYEDKFKSGFNITKTPDRMNSTLEISNMNPTQEGVYYCAARE
Callorhinchus milii V368 trav AAVX02049715.1 794 VVLGDSVTQQTAGLSKQEGGTVSLSCSYTTSSNYAALYWYRHHPGLGPQYILYRHTNGVDNTADYAKGRFTSHLDKNQEQTTLIILSVIVTDSAAYYCGLRPD
Callorhinchus milii V367 trdv AAVX02049604.1 4116 LTQGDAVTQKVASVIGKEGGSVTMECHYDTSLSSYYLNWYREQQETQLQYVLQKYSGGYTDKADFAKKRFSIELQTSTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii V366 trdv AAVX02049224.1 2036 SRFTVSQSPPEQTAFAGERINLHCQYSGFCGQNFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIAGLRLTDSAMYHCALS
Callorhinchus milii V365 trav AAVX02049219.1 1415 RCDGDTVSQKLPQIVRNERETATFECTFSTTGSHYHLLWYRYNREKHPEFIVVRYSWKNNQDRGKGFGDRFSAQLYKSSSFTSLSISELVVSDSAVYYCAFN
Callorhinchus milii V364 trav AAVX02049093.1 2181 VSGQEKVYQSPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPKQALKHLVTGTTGEQQKERITAAMNYRDSSSNLSITGTEVTDAATYLCAVE
Callorhinchus milii V363 trav AAVX02049066.1 1167 HCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSEYNTYLFWYRHFPNKSPEYILSTDTNNRIKDGADFAEERFSTNVSKAERTVPLNILQVKVTDSAGYYCALS
Callorhinchus milii V362 trav AAVX02049066.1 2756 SGQDVVSQYPREITEIEGQDVALNCNISRLDTVFWYRQNAGRALQYALRIFTSGAVDKSPDLPERFTAELIKKNKVIKLQTLGAVVGDSAVYYCALE
Callorhinchus milii V361 trav AAVX02048844.1 1678 VVLGDSVTQQTAGLSKQEGGTVSLSCSYTTSSNYAALYWYRHHPGLGPQYILYRHTYGVDNTADYAKGRFTSHLDKNQEQTTLIILSVIVNDSATYCCGLRSD
Callorhinchus milii V360 trdv AAVX02048844.1 3744 LCVGDSVSQKAARMVKKEGEIAILQCTYSTTESYYYLYWYRHYPDKQPEFIIWRYSGNDDQVKGIGFGNRFSAQLQTSNSSTSLSISELVVSDSAVYYCALS
Callorhinchus milii V359 trav AAVX02048822.1 285 SVTQLQSTVTVNEGEAVYLQCNYTATSAGDPYLFWYRHYANKAPEYILNTYIRNNKQQRSDFAKEGFSTNVSNEERAAHLNIFQVRVTDSAVYYCALS
Callorhinchus milii V358 trav AAVX02048668.1 1821 HCGGDSVTQLQSTVTVNEGETVYLQCNYTATINDNPYLFWYRHYTNKAPEYILNTYIRNNKQQRADFAKERFSTNVSQAESTVHMNILQVSVTDSAVYYCALS
Callorhinchus milii V357 trav AAVX02048609.1 1609 VSGQEEVYQTPLSVTVGEKENVLINCSAKGTTQTLQWYRQYPNQALKHLVTGNTGEQQKERITATMNYKEKGSNLSITGTEVADAATYLCAVETQ
Callorhinchus milii V356 trdv AAVX02048374.1 5037 VVVGDSVRHQTAGLSKQEGDTVSLSCSYTTSSSYAVLYWYRHHPGLAPQYILYRDTNGNDNTADFAKGRFTSQLDTNQRKTTLSISSVIVTDAATYYCGLTT
Callorhinchus milii V355 trav AAVX02048182.1 3926 YCGGDAVTQLQSTVTVTEGEDVYLQCNYTATSGYNTDLFWYRHFPNKSPEYILSTDNNNRIKKGADFAEERFSTNVSIAERTVPLNILQVRVRDSAGYYCALS
Callorhinchus milii V354 ighv AAVX02048061.1 717 VQADVVLTQPPTLTGEPGQALRLTCKTSGFDLSTSWMDWIRQVPGKGLEWLLSYYNPSNKNYAPGIENRVTVIKEDSKNIFDLIIKSPRVNDTAIYYCVRG
Callorhinchus milii V396 trdv AAVX02065675.1 484 SNFTVSQSPPEQTAFAGERIHLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRKPLGEGGNPTGDHISASLDTAKNISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V395 trav AAVX02063801.1 548 KSLQDIGNQPIAEISVEEGKDVKLSCTLQKISDTSYLYWYRQVSRNAPVFILQSVAGKENKSPDFPDRFSSKVDKINEDFKLSIVTVLIMDSAVYYCAKE
Callorhinchus milii V394 ighv AAVX02063300.1 715 VQASGSLTQPPTLTGKTGQSLRLTCRTSGFNYNSYYYCMYWYRQLPGKQREKLLTSDYRSSNSFESGVGNRVSVVRENSNNIFDLIIKSPRVEDTATYYCGAY
Callorhinchus milii V393 trav AAVX02063084.1 326 VSGQDTVSQSPVSVTVGETERVIFSCSATGSNKALQWYRQYPNQALKHLVTGKTGEQLKERITATMNYREKGSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii V392 trav AAVX02061793.1 506 HCGGDAVTQLQSTVKVNEGEDVYLQCNYTATTTSDPDLYWYRHHPNKAPEYILWTDKSNNPRHADFATDRFITHVEEAERTVPLNLSQVRVADSAVYYYALS
Callorhinchus milii V397 trav AAVX02065806.1 519 VYGQDVVSQYPPEITDFEGHNVTLNCSYSTITAAFWYRQYPDGALQYLFRIYGSGKADNPPDRFTAELIKENKVIELQILSSVVGDSAVYYCALN
Callorhinchus milii V391 trav AAVX02061420.1 753 VLAESVVSQSPQVVTGNENGNVSMECNTNVSGPTFHWYTQYGNGSIRFLVLGTKDINVKDRISALADTRQRNCTLTTQDLRVSDTATYFCAE
Callorhinchus milii V353 trav AAVX02047816.1 602 LTQGDSVTQKVGSVNGKEGGSVTMECHYDTSLSDYYLHWYREQQETQPQYVLKTYSDGSAYKADFAKKRFSAELRTSTKFSSLTISQLELSDSAVYYCALE
Callorhinchus milii V315 trav AAVX02045553.1 5092 ILAESDVSQSPQAMTGNENGNVSMECTTTVSSPNFHWYTQYGNGSIRFLVLGKRDISENDRISALANTRERNSTLTIQNLRVTDSATYFCAE
Callorhinchus milii V277 trav AAVX02044120.1 4987 DSVTQLQSTVTLNEEEDVTLHCNYTTTRNTPYLFWYRQYPNKAPEYILWTYSRGQPQHADFAKERFSTKPDESRRTVPLNISQVRDTDSAGYYCALS
Callorhinchus milii V254 trbv AAVX02043375.1 470 LSLGALVTQLPRTVTAREGRTVSLNCHQDDSSLTVMLWYIQPHQGGLTLIGYGVYSVITHERPDYNITTTPDNMNSTLEITSMNPTQEGVYYCAARE
Callorhinchus milii V253 trbv AAVX02043375.1 1881 LSLGALVTQRPRTVTAREGETVTLRCYQNNTKYEAMLWYLQPHQGGLTLIGYGSYSNELSTVYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE
Callorhinchus milii V252 trbv AAVX02043375.1 1881 LSLGALVTQRPRTVTAREGETVTLRCYQNNTKYEAMLWYLQPHQGGLTLIGYGSYSNELSTVYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE
Callorhinchus milii V251 trbv AAVX02043375.1 1881 LSLGALVTQRPRTVTAREGETVTLRCYQNNTKYEAMLWYLQPHQGGLTLIGYGSYSNELSTVYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE
Callorhinchus milii V250 trbv AAVX02043375.1 3132 LSLGALVTQWPRTVTAREGETVTLNCHQDDKSLDMMLWYIQPHQGGLTLIGYNQYSTTYEDKFKSGYNITKTPDKMNSTLEISSMNPTQEGVYYCAARE
Callorhinchus milii V249 trbv AAVX02043375.1 3132 LSLGALVTQWPRTVTAREGETVTLNCHQDDKSLDMMLWYIQPHQGGLTLIGYNQYSTTYEDKFKSGYNITKTPDKMNSTLEISSMNPTQEGVYYCAARE
Callorhinchus milii V248 trbv AAVX02043375.1 4285 LSLGALVTQRPRTVTAREGETVTLNCHQDDTASTDITMLWYLQPHQGGLTLVGYNRYSTEYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE
Callorhinchus milii V247 trbv AAVX02043375.1 4285 LSLGALVTQRPRTVTAREGETVTLNCHQDDTASTDITMLWYLQPHQGGLTLVGYNRYSTEYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE
Callorhinchus milii V246 trbv AAVX02043374.1 39 LSLGALVTQVPRTVTAREGDTVTLNCHQKDTAYQTMLWYLQPHQGGLTLIGYGYLSNPTMEDAYKLEYEVKQTDDYKNCSLEIKKATQEGVYYCAARE
Callorhinchus milii V245 trbv AAVX02043374.1 1629 LSLGALVTQWPGTVTAREGETVSLNCYQNDTDYQVMLWYFQPHHGGLTLIAYAVVTTPTYEKGFESGYNMTKTTDDKESSLKISNLNPTQEGVYYCAARE
Callorhinchus milii V244 trav AAVX02043215.1 8238 AVTQLQSTVKVNEGEDVYLQCNFSATTTSDPDLYWYRHYPNKSPEYILWTDKRNNPRHADFATDRVITHVDEAERTVPLNVSQVTVADSAVYYCALR
Callorhinchus milii V243 trav AAVX02043215.1 13299 SGQDVVSQYPREKTEIEGQDLALNCNVSRLDTVFWYRQNPGGALQYALRIFSSGTVDKSSDLPERFTAELIKKNNVIKLQILSAVVGDSAKYYCSLD
Callorhinchus milii V242 trav AAVX02043215.1 16031 DSVTQLESFLTVNEGEDVSLQCNYTTTSNTPYLFWYRHYPNRAPEYILWTYSRGQPQHADFAKERFSTKVDESRRTVPLSIAQVRVADSAVYYCALS
Callorhinchus milii V241 ighv AAVX02043179.1 17198 VQSGAVMTQPPTLIGKTVQALRLTCRISGFNLANYWMHWKRQFPGKQRENFLAYFSSSNYFESEIENRVTVIKDTSKNIFDVIIKSPTVEDTATYYCGAR
Callorhinchus milii V240 trav AAVX02043150.1 1186 DSVTQLQATVTVKEGETVYLQCNYTATNDNNPYLFWYRHCPNKPPEYILRTDTSNKFPDHADFAKERFSTNVSKAERTVPLNISHVRVTDTAGYYCALS
Callorhinchus milii V239 trdv AAVX02043137.1 7593 VVLGDSVRQQTAGLTKQEGDTVSLSCSYTTSSSYAALYWYRHHPGLAPKYILYSDTDGGSNTADFAAGRFSSQLNKYQRKTTLIIRSVAITDAATYYCGL
Callorhinchus milii V238 trdv AAVX02043137.1 16025 SSFTVSQSPPEQTAFAGERINLHCQYSGFCGQNFSVSWYRQSPGETLEYLLHRKPSGEGGNPTGGHISVSLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V237 trav AAVX02043053.1 906 VSGQDKVSQLPLSVSVGENEQVLISCSTTEQGRGLQWYRQYPNQALKHLVTGQTGEQQKERITASMNYREKRSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii V236 trav AAVX02043053.1 2726 GLAESDVSQRPEAMTENEHGNGSMECSITGSNPYFHWYTQHGNGSMRFLVLGKSDINVKDRIRALANTRQRNCTLTIQNVRVSDTATYFCAV
Callorhinchus milii V235 trav AAVX02043053.1 7776 ICGGDSVTQLQSIVTVTEGEDVALQCNYTVANTGSDYLFWYRHLTNKAPEYILRTSTKNRNKDHADFAKERFSTNVSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii V234 trav AAVX02043053.1 12159 VYGQDAVTQYPPEITDFEGQNVTLNCSYSSLQTAFWYRQYPDGALQYLFRIYASGNEDNPPDRFTAELIKENKVINLQILGAVVGDSAVYNCALD
Callorhinchus milii V233 trav AAVX02043053.1 14767 SVTQLQSTVTVNEGETVYLQCNYTATNNDNPYLFWYRHYPNKAPEYILNTYIRNNKQQPADFAKERFSTNVSQAETTVHMNILQVRVTDSAVYYCALS
Callorhinchus milii V232 trav AAVX02043052.1 1914 DSVTQLQSTVTVNEEEDVTLQCNYTTTSNTLYLFWYRHYPNRAPEYILWTYGRGQPQRADFAKERFSTKLDESRRTVPLNISQMRITDSAAYYCALS
Callorhinchus milii V231 trdv AAVX02042390.1 5515 SRFTVSQSPPEQTAFAGERINLHCQYSGFCGQDFSVSWYRQSPGETLEYLLHRKRSGEGGNPTGDHISASLDTAKKISILTIAGLRLTDSAMYHCALS
Callorhinchus milii V230 trav AAVX02041806.1 421 DSVTQLESALTVNEGEDVSLQCNYTATSTTTPSLFWYRHYPNKAPEYILWTYSRGQPQHADFAKERFSTKVDEIRRTVPLSISQVRVADSAGYYCALS
Callorhinchus milii V229 trav AAVX02041806.1 2719 VLAESDVSQSPQAVTGNDNGNVSMECNTTGYNPTFQWYKQYGNGSIRFLVLGKREINVKDRIRALTNTKEKNCTLTIKNVRLTDTATYFCAD
Callorhinchus milii V228 trav AAVX02041806.1 5207 NSLQDIGNQTIAEIPVEEGKDVKLSCTLKKISDANYLYWYRQASRIAPVYILYSISGKDYMSTVFPHRFSSTVNESHEDFELSIVTVLIGDSAVYYCAKE
Callorhinchus milii V227 trav AAVX02041806.1 8993 VGGQDVVSQYPPEVTDLEGKDVTLKCNISTLDTAFWFRQYPDGNLQYLFRIYGSGKIDKTPDLPERFTAELIKENKVIKMQIFGAVMGDSAVYHCALN
Callorhinchus milii V226 trav AAVX02041806.1 11618 HCGGDSVTQRQSTVITNEGDDVYLQCNYTTTRINTPYLFWYRHYPNNAPEYILSTDTKNRIKDHADFAKERFSTNVSEVERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii V225 trdv AAVX02041804.1 5174 LTQGDSVTQKVASLIGKEGGSVTMECHYDTSLGNYYLNWYREQEEIQPHYVLQKGSGGDTYKADFAKKRFSIELQTSTKFSSLTISLLELSDSAVYYCALQ
Callorhinchus milii V224 trav AAVX02041804.1 10034 VFAESAVSQRPQAVTENENGNASVECTVTESTNAFHWYKQYGNGSIRFLVLGTSDISVKGRIRALANTRQRNCTLTIQNLRVSDTATYFCAA
Callorhinchus milii V223 trdv AAVX02041668.1 1976 LCDVDSVSQKAATMVKKEGETAILQCTYSTTESDYNLYWYRHYPDKQPEFIIWIYSGDNQGKGTGFGNRFSAQLQTSNSSTSLSISELVVSDSAVYYCAFR
Callorhinchus milii V222 trdv AAVX02041668.1 3773 LTQGDSVTQKVASVTGKEGGSVTIDCHDDTSLSDYYLHWYREQQERQPQYMLKKYSNGNTYKADFAEKRFSVELQTSTKSCCLTIFLLELSDSAVYYCALQ
Callorhinchus milii V221 trdv AAVX02041668.1 5679 IANAISVQPSQMEVSVGEGQTANMSCTYSADFTDVLMYWYLQYPGDPPLYTRRHNYGGDTFSAEFAKQRFSTNLDTNTKRYSLTLFPVALSDMATYYCAIR
Callorhinchus milii V220 trbv AAVX02041195.1 1901 TGSFGTQEPRTVTAREGETVTLRCSHNDKSLNMMLWYIQPHQGGLTLIGYNQASTTYEDKFKSGYNITKTPDRMNSTLEISNINPTQEGVYYCAARE
Callorhinchus milii V219 trbv AAVX02041194.1 1282 LSLGALVTQRPRTVTAREGETVSLRCSHNDKSLDMMLWYIQPHQGGLTLIGYNEYSTVYEDKFKSGYNITKTPDNMNSTLEITNINPTQEGVYYCAARR
Callorhinchus milii V218 trdv AAVX02041142.1 548 HCNGDSVSQKAATMVKKEGDIAILQCTYSTTESDYILYWYRHYPDKTPEFMIRRYSGNDIQNKGTGFGIRFSAQLQTSNSFASLSIAALVVSDSAVYYCAFK
Callorhinchus milii V217 trdv AAVX02041142.1 5748 SNYTVSQSPPEQTAFAGERIHLHCQYSGYCGQDFSVSWYRQSPGEGLKYLLHRNPSGEGGNPTRNHISASLDTTKKISVLTIADLRLTDSAMNHCALS
Callorhinchus milii V216 trdv AAVX02041141.1 1440 LCDGDSVSQKAATMVNKEGEIAILQCTYSTTESDYYLYWYRHYPDKQPEFIIWRYSGNDNQVKGIGFGNHFSAQLQKSNSSTSLSISELVVSDSAVYYCAFS
Callorhinchus milii V215 trdv AAVX02041141.1 3234 LTQGDSVTQKVASVTGKEGGSVTMECHYDTSLSDYYLNWYREQQETQPHYVLQKGSDGDKDKADFAKKRFSIELQTSTKFTSLTISLLELSDSAVYYCALE
Callorhinchus milii V214 trdv AAVX02041139.1 8491 SSYTVSQSPPEQSAFSGERINVHCQYSGFCGQNFSVSWYRQTPGEGLKYLLHRKPSGEGVNPTGDHISASLDTAKKISVLTIADLRLTDSALYHCALS
Callorhinchus milii V213 trav AAVX02039053.1 709 VYGQDVVSLYPPEITDFEGQTVTLNCSYSSLQAAFWYRQYPDGALQYLFRMYSSGKVDNLPDRFTAELIKENKVIELQILGAVVGDGAVYYCALN
Callorhinchus milii V212 trav AAVX02039053.1 5117 ALAESDVSQSPQALTGNENGNVSMECNTTVSVPAFQWYTQYGNGSIRFLVLGTRDIDMKDRISALANTKERKCTLTIQNVRVTDTATYFCAE
Callorhinchus milii V211 trav AAVX02039053.1 6924 VYGQDVISQYPPEITDFEGQNVTLNCSYSTLQTAFWYRQYPDGAPQYLFRIYVSGNVDNPPDRFTAELIKESKVINLQILSAVVGDSAVYHCALE
Callorhinchus milii V210 trgv AAVX02039053.1 9786 SVKQLESTVTVNEWEAAHMHCNYTTTDTNPNLFWYRQYPSKAPEYILWASTFSKPKYAEFAKERFSTNVSKAERTVTLNIIQVRVTDSAGYYCALS
Callorhinchus milii V209 trdv AAVX02039052.1 10138 FCDGDSVTQKAATMVKKERETVILQCTYFTTENDYVLHWYRHYRGKQREFIIWRYSGSELEEKGVGFGNRFSAQLHKSNSSTSLSISELAVSDSAVYYCAFSL
Callorhinchus milii V208 ighv AAVX02039052.1 14301 AVTQLQSTVKVNEGEDVYLQCNYTATTTSDPDLYWYHHYPNKPPEYILWTDKRNNPRYADFAKDRFITHVDAAERTVPLNIFQVTVAGSAVYYCALSPTE
Callorhinchus milii V207 trav AAVX02039052.1 18932 ICGGDSVTRLQSIVTVTEGEDVSLQCNYTVANTGSDSLFWYRHLTSKAPEYILSTSNNNRIKDHAEFATERFSTNVFQVERTAPLNIFQVRVTDSAGYYCALS
Callorhinchus milii V206 trdv AAVX02039050.1 16415 CNADSVTQKAATMVKEEGVNAILRCTYSTTESSYYLHWYRHSDDKQPEFIVQMYSNNENLVKATGFGDRISAQLQKFTSSTNLTISELVVSDSAVYYCAFSL
Callorhinchus milii V205 trdv AAVX02039050.1 25133 TVNGVSVQPSQMEVSVPEGQTATLSCNYSADFSNVFMYWYRQYPGEPPLYTRRHDYDGETFSAEFAKQRFSTTLDTNTKRSSVTVLSVALSDTATYYCA
Callorhinchus milii V204 trdv AAVX02039050.1 31417 SRFTVSQSPPEQTAFAGERIHLHCQYSGFWGQDFSVSWYRQSPGEGLKYLLHRKPSGEGGNPTGDHISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V203 trdv AAVX02039047.1 1410 KSYTVSQSPPEQTTIAGERINVHCQYSGICGQDFSVSWYRQSPGEALEYLLHRKSSGEGGNPTRNNIFAYLDTAKKISVLTIVGLRLTDSALYHCALS
Callorhinchus milii V202 trdv AAVX02038857.1 6287 LCGGDSVSQKAASMVRTEGESVTFECSYSTTESYFYLFWYRHYKEKQPEFIIRRYSHNDNTIKGAGFENRFSAELQKSNSFTSLSISELVLSDSAVYYCA
Callorhinchus milii V201 trdv AAVX02038857.1 12397 SSSAVCQTQPQQAAFAGETVSLNCKYILFSEEDFIIYWYRQSHGETLKYLLQRKSSVEGGNPTRDCISASLDTAKKISVLTIADLRLTDSAMYHCALS
Callorhinchus milii V200 trdv AAVX02038857.1 19002 VVLGDSVRQQTAGLSKQEGDTVSLSCSYTTSSSYAALNWFRHQPGLAPQYVLYRDTAGGSNTADFAARRFSSQLDENQRQTTLIIRSVVITDAAAYYCGLTS
Callorhinchus milii V199 trav AAVX02038857.1 21008 FCDGDSVTQKPATVVKKERETVILQCTYSTTESDYLLHWYRHYAGKQPEFIIWRYSGSELEEKGVGFGNRFSAQLHKSNSSTSLSISELVVSDSAVYYCALSL
Callorhinchus milii V198 trav AAVX02038857.1 23859 LCVGDSLCQKAATVVQKEREIVTLQCTYSTTQSAHGLFWYRNDQDKQPEFIIRRDTWNDSHVSAIGFGKSFYAKLHKSISTTSLSISALVLSESAVYYCAFNL
Callorhinchus milii V197 trdv AAVX02038857.1 25630 FCDGDSVTQKAATMVKKERETVILQCTYLTTESDYLLHWYRHYAGKQPEFIIWRYSGSELEEKGVGFGNRFSAQLHKSNSSTSLSISELVVSDSAVYYCALQ
Callorhinchus milii V196 trav AAVX02038857.1 35387 IFAESAVSQRPQTVTENENRNLSVECTNTESTTAFHWYKQFGNGSIRLFVLGTKDINVKDRIRALANTRQRNCTLTIQILRVTDTATYFCAA
Callorhinchus milii V195 trav AAVX02038857.1 37439 NSLQDIGNQTIAEISVEEGKDVKLSCTSKKISDANYLYWYRQASRNTPAYILYSIAGKDYMSPDFPNRFSSNVDKTNEDFELSIVNVLIGDSAVYYCGKE
Callorhinchus milii V194 trav AAVX02038857.1 41321 VGGQEVVSQYPPEVTDFEGKDVTLKCNISRLDTAFWYRQYPDGNLQYLFRIYGSGKVDKTPDLPERFTAEQIKENKVIKMQIYGAVTGDSAVYHCALN
Callorhinchus milii V193 trav AAVX02038857.1 43974 HCGGDSVTQRQSTVITNEGDDVYLQCNYTTTRINTPYLFWYRHYPNNAPEYILSTDTKNRIKDHADFAKERFSTNVSEVERTVPLNIIEVRVTDSAGYYCALS
Callorhinchus milii V192 trav AAVX02038857.1 46608 VLAESDVSQSPQVVTGNENGNVSMECNTTVSGPTFHWYTQYGNGSIRFLVLGTKDVNVKDRISALANTRQRNCTLKIQDLRVSDTATYFCAE
Callorhinchus milii V191 trav AAVX02038857.1 48881 NSLQDIGNQPIAEITVEEGKDVKLSCALQKISDTSYLYWYRQVSRNAPVYILLSVAGKDNKSPDFQQRFSSKVDKTKEDFKLSIATVLIGDSAVYYCANE
Callorhinchus milii V190 trav AAVX02038857.1 56387 HCGGDSVTQLQSTVTVNEGEFVYLQCNYTAASTTNNYLFWYRQFPNKSPEFILSTSSNNRIKQNADFAKERFSANVDEMGRTVQLKVLHVRVTDSAGYYCALS
Callorhinchus milii V189 trav AAVX02038857.1 58747 DLAESDVSQTPQAVTVNENGNVSMECSTTVNNPFFHWYKQHGKGSIRFLVLGKSDVNMKDRIRALAERKQKNCTLTIEDVRMSDTAIYFCAE
Callorhinchus milii V188 trav AAVX02038857.1 60864 KSLQDIGNQPIAEIPVEEGKDVKLSCTLKKISDANYLYWYRQASRNAPVYILYSVAGKDYMSPDFQDRFSSKVNKTKEDFELSIVTVLISDSAVYYCAKE
Callorhinchus milii V187 trdv AAVX02038857.1 110892 VVLGDSVRQQMAELSKQEGDRVSLSCSYTTSSSYATLYWYRHHPGLAPQYILYRDTAGGSNTADFATGRFSSQLNKNQRQTTLIIRSVVITDAAAYYCGLTS
Callorhinchus milii V186 trdv AAVX02038857.1 118823 SSFTVSQSPPEQTAFAGERINLHCQYSGFCGQNFSVSWYRQSPGEGLKYLLHRNPSGVGGNPTGDHISASLDTGKKICVLTIADLRLTDSAMYHCALS
Callorhinchus milii V185 trdv AAVX02038857.1 127775 TANGVSVQPSQVEVSVPEGQTATLSCTYSADFSNVFMYWYRQYPGEPPLYTRRHDYDGETFSAEFAKQRFSTTLDTKTKRSSVTVRSVALSDTATYYCA
Callorhinchus milii V184 trav AAVX02038667.1 1636 VYGKDVVSQYPPEITDFEGQNVTMNCSYSTINVAFWYRQYPDGAPQYLFRIYSSGKVDNPPDRFTAELIKENKVIKLQILSAVVGDSAVYYCALN
Callorhinchus milii V183 trav AAVX02038667.1 4245 YCGGDSVTQLQSTVTVHEGEAVYLQCNYTATSGSDPYLFWYRHYPNKAPEYILITYIRNNKQQRADFAKERFSTNVSEAETTVHINISQVRVTDSAVYYCALS
Callorhinchus milii V182 trav AAVX02038667.1 6672 VDGENFVDQYPPEITDFEGQNVTLNCSYSTMNAALWYRQYPDGALQYLFRIYSSGKVDNPPDRFTAELIKENKVIKLQILSAVVGDSAVYYCALE
Callorhinchus milii V181 trav AAVX02038667.1 9096 HCGGDSVTQLQSTLTVNEGDDVSLQCNYTATSGSGNPYLFWYRHYSNKSPEYILRTDTSNKFPDHADFAKERFSTNVSKVERTVPLNIIQVRVTDSAGYYCALS
Callorhinchus milii V180 trav AAVX02038667.1 11916 DLAESGVSQTPQAVTVNENGNVSMECITTVNNPFFQWYKQHGKGSIRFLVLGKSDVNLKDRIRALAERKQKNCTLTIEDVRISDTAIYFCAE
Callorhinchus milii V179 trav AAVX02038667.1 14061 NSLQDIGNQTIAEIPVEEGKDVKLSCTLKKISDATDLHWYRQASRNAPVYILYSVAGKDYKSPDFQDRFSSNVDKTSEDFKLSIANVLITDSAVYYCAKR
Callorhinchus milii V178 trav AAVX02038667.1 17794 RCGADGVTQLQSIVTVTEGEDVSLQCNYTGASDGFDYLFWYRRLTSKAPEYILSTSTNNRNKDHAEFAEERFSTNVSKAERTVPLNILQVRVTDSAGYYCALS
Callorhinchus milii V177 trav AAVX02038667.1 19764 VSGQDAVSQSPLSVTVGEKDEVLLSCSTTVSNQVLQWYRQYPKQALKHLVSGKTGEQQNKRITATMNYREKGSNLSITGTEVTDAATYLCAVE
Callorhinchus milii V176 trav AAVX02038667.1 21736 VSGQEDVYQTPLSVTVGEKENVLINCSAKGTTQAFQWYRQYPNQALKHLVTGKTGEQQKERITATMNYRDSSSNLTITGTEVTDAATYLCAVETQ
Callorhinchus milii V175 trav AAVX02038666.1 3197 DGVTQLRSVVTVTEGEDFSLQCNYTVANTGSEYLFWYRHLTNKAPEYILRTSTKNRNKDHADFAKERFSANVSKAEKTVPLNILQVRITDSAGYYCALS
Callorhinchus milii V174 trav AAVX02038666.1 5152 VSGQDTVSQSPLSVTVGEKEEVIISCFTTQSRALQWYRQYPNQALKHLVRGQSGEPQKERITATMNYREKGSNLSITGTEVTDAATYLCAVETQ
Callorhinchus milii V173 iglv AAVX02034034.1 58888 TNADITLTQPPSISSSPGNTVKITCTMSGGSIGNFYASWYQQKPGGAPVFVWYQSGTTGQGIPDRFTGSKESSNIHLTISGVQPEDAADYYCGAWYSGSP
Callorhinchus milii V172 trav AAVX02033987.1 593 VYGQDVVSQYPPEITDFEGQNFTLNCSYSTLQTAFWYRQYPDGAPQYLFRIYSSGKVDNPPDRFTTELIKDNKVIELHILGAVVGDSAVYYCALD
Callorhinchus milii V138 iglv AAVX02021506.1 18960 GCDGFTLSQPRSMIKNQGKTAKITCTMHGKSMGEDYVHWYLGNPGKGLQWILYNKGTKIETSPDFPRRFSAVKSGDSSILTITKVNPNDSGIYYCGVWD
Callorhinchus milii V137 trgv AAVX02021505.1 51029 GSVALSQPRLSLTSKLNKTVQIPCIIDSKTLNTDFVHWYRKSADKKLQWILYFQNQQKKEIDSAFKARFFVEKVEQTKSCNLIILDTREADTGVYYCALWS
Callorhinchus milii V136 trgv AAVX02021505.1 52551 GSFAQKVNQYPRSFTKPAGRTIRMKCDIKSSETVHWYQSKPNKPITRILYRANSKAQLDEETPGRFSTEAPSSNQQVLVINNVLEVDSATYYCAYWD
Callorhinchus milii V135 trgv AAVX02021505.1 55895 GCFAMILTQYPVSITKRLGKTIRIHCNRTDGEISSGLVVHWYQHKKNQPLTRLLIYNSGTVLDAGVDNRFKIEMDKKACSLIIDQITLDDSATYYCAAWE
Callorhinchus milii V134 trgv AAVX02021505.1 65824 ESLAQTLIQPELSITRDLMKTARMHCQVEGIAFESAVIHWYRQTPKQSIRRIMYIQSKSSPQRDDGFSNRFTAENIAEGGISRLEIAQLETSDAGTYYCACWVSTV
Callorhinchus milii V125 trav AAVX02060485.1 747 VSGQEEVYQTPFSVTVGEKENVLINCSAKGTTQALQWYRQYPNQALKHLVTGTTGEQQKESITATMNYKEKGSNLSITRTEVTDAATYVCAVETQ
Callorhinchus milii V87 trav AAVX02049003.1 3293 LCDGDSVSQKAATMVKRKGETASFECTYSTTVSRYDLSWYRHYPDKQPEYIVRRYSGNTIQYRGTGFGNRFSAQLRKSISSTSLSISEMVVSDGAVYYCAFN
Callorhinchus milii V49 trdv AAVX02045791.1 742 VCGGDSVSQKHSMMVMKEGETVTFQCTFSTTENSYSLFWYRHYPDKHPEFIVRRDSDDYEAKGDGIGNRFTSQLDTSKSVTKLSVSMLLLSDSAVYLCAVSPDI
Callorhinchus milii V16 trbv AAVX02041196.1 1138 LSLGALVTQWPRTVTAREGETVSLRCSHNDKSLKMMLWYIQPHQGGLTLIGYNELSTVYEDKFKSGYNITKTPDNMNSTLEITNMNPTQEGVYYCAARE