WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Tupaia belangeri AAPY00000000.1 (AAPY01) 266 65 87 26 53 23 6 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Tupaia belangeri V4 iglv AAPY01016761.1 3395 FLSQPVLTQPPSLSTSPGALVRLICTLSNGFAVGGYWIEWHQQKPESAPCYLLRHDSDSSKHQGSGVPSRFSGSKDISANAGVLHISGLQPDDEAVYYCGT
Tupaia belangeri V5 iglv AAPY01017936.1 11741 SVFPGSLSQPALTQPPSASASLGQAVTLTCTLNGGYNYYVEWYQQRPGKGPWFVMTVGISGISGSKGDGIPDCFSGSGSGLDQFLTIQNLQEDDESDYHCGVS
Tupaia belangeri V45 trgv AAPY01086594.1 431 GDTTIKLSQDQLSFTRRLDRTVHISCRLSGVPLDNAIVHWYQHKEGEPLKRILYGSSKKYKKDQPNPRLEADEKDDGVFYLIINNVIQSDEATYYCACWD
Tupaia belangeri V51 igkv AAPY01106384.1 1225 SRGDIVMTQTPLSLPVILGESVSISCRSSRSLLSSDGNTYLNWLLQKPGQAPRLLIYMVSNRFSDVPDRFSGSGSGTDFTLKISSVEAEDAGVYYCQQV
Tupaia belangeri V59 trgv AAPY01112892.1 563 ANGDILITQLVTSVTKKKGSTAFLGCQIKTATLQNNLYIHWYRQQAGQPLKRILCISSNENVLHERGISDRKFEARKQRGLSWSLRIHQVAEEDAGMYYCAY
Tupaia belangeri V98 igkv AAPY01204087.1 1853 ARCDIKMTQSPSSLPASLGDKVTISCRASQGISNYLHWYQQKPGKSPKLLIYRASNLHSEVPSRFSGSGSGTDFTLTINNLEAEDGGIYFCQQGYDNP
Tupaia belangeri V162 ighv AAPY01311635.1 1672 VLSQVQLQESGPGLVKPSQTLSLTCFVSGFSITTSGYYWHWIRQSPGKGLQWVGEISYSGVTKYNAALKSRSSISRDTSKNQLSLQLSSVTPEDTALYYCVG
Tupaia belangeri V179 trav AAPY01347798.1 2757 DVRAQSVTQPDGHVTLSEKDSLELRCTYSGTSTPYLFWYVQYPGQGLQLLLKYYSGDTLVKGSNGFEAEFKKSDSSFNLKKSSVHWTDTAEYFCALS
Tupaia belangeri V180 trav AAPY01347801.1 1942 VRGFQVEQSPPALSLQEGTDSTLRCNFSAAINTVQWFRQNPGGSLINLFFVASGTKQNGRLEATINSKDLYSTLHITASQLEDSGTYLCAAEAQCS
Tupaia belangeri V181 trav AAPY01347802.1 426 VSRGENVEQRPSTLRVLEGDSSVINCSYSDSASDYFPWYKQEPGKGPQLIIDIRANKDKNNNQRLTVFLDKAKKHFSLHIAATQPGDTAIYFCAAR
Tupaia belangeri V182 trav AAPY01347807.1 320 VRSQQKEVEQSSESLSVAEGAIASLNCTYRDRASSYFAWYRQYSGKGPEMLILTFSSDKEEGRFTMKVNKDSLYVSLIIKDSQPRDSATYFCAV
Tupaia belangeri V183 trav AAPY01347810.1 483 GSRAQTVTQPEDHLSVLEGDPVQVKCNYSYSGSPVLFWYVQYPNTGPQLLLKHISGESTKGFTAHLNKGEASFHLKKSTAQEEDSATYYCALS
Tupaia belangeri V184 trav AAPY01347819.1 401 RSNGDSVTQTEGPITLSEGAPLILNCTYQVSGFQTPFLFWYIQYLSKAPQLLLKSSTGKQRTENQDFHADFVKDNSSFHLQKPSVQTSDSAVYYCALG
Tupaia belangeri V185 trav AAPY01347824.1 140 VRSQQKEVEQSSESLSVAEGAIASLNCTYRDRTSSSFAWYRQYSGKGPEMLILTFSSGDKEEGRFTMKVNKDSLYVSLIIKDSQPRDSATYFCAV
Tupaia belangeri V186 trav AAPY01347827.1 1266 SSMAQTVTQAQTATSVMEKGSVTLGCGYETSVTTYSLFWYKQPPTGEMIALIRQDSYNEKNASEGRYFLTFLKSARSINLTISASQLTDSAVYFCALR
Tupaia belangeri V187 trav AAPY01347834.1 1056 RSNGDSVTQTEGVVTLPEEAALLLNCTYQSTYSAFLFWYVQYPNKEPELLLKSSSEHQGLDSRGFRANHIKSDSSFHLQKPSVQTSDSAVYYCALR
Tupaia belangeri V188 trav AAPY01347837.1 1708 KSDQQQVKQGPQSLVLHEGEISILNCSYENSAFDYFLWYKQYPGKGLELIASIRSVKNENEAGRFTVFFNKSEKRFSLHIPASQPGDSATYFCAA
Tupaia belangeri V189 trav AAPY01347841.1 526 GTRAQSVTQPDVHVAVPEGAHLELRCNYSSSVPSYLFWYVQYPNQELQLLLKYSFGISLVTGIKNFEAEFRKSETSFHLKKTSAHLSDSAGYFCALSDSA
Tupaia belangeri V190 trav AAPY01347843.1 1291 VSSEQEVRQSPEALSVREGDNLVLNCSYTDSTMYSLQWFRQDPGKGLTFLIILRSNQRDESSGRLKASLDTSSRHSSLYIAASQPGDSATYLCAV
Tupaia belangeri V191 trdv AAPY01347852.1 246 SSAAQKVIQAQPAISGPMGTSVTLECAYETSWTSYVLFWYKQLPSGEIVFVISQPSSSQNERNDRYSSDLKRSAKLISLTISSLQLEDSAKYFCAFRK
Tupaia belangeri V192 trav AAPY01347855.1 2565 VSSVPNVAQSPRSLHVQEGESTNFTCSFPSSSFYGLHWYRQEPAKSPKILFVISVNGDEKQEGRVKVTLNTKEGYSFLYIKGSQPEDSASYLCAS
Tupaia belangeri V193 trav AAPY01347856.1 4077 EVNGQQVNQIPQFLNVQEEEDFTAYCNSSSTLNSLQWYIQKPGERPVFLMRLVAGGEVKKHDRLTASFGETRKNSSLHIVATQTADVGTYFCA
Tupaia belangeri V194 trav AAPY01347866.1 2766 VRAQMKVEQSPQVLILQEGRNSFLTCNYSSTMTGMQWFQQNPGGRLISLFYIASGTKHNGRLKCTVNTKERYSQLHISDAQPEDSASYFCAVE
Tupaia belangeri V195 trav AAPY01347869.1 1608 VSGQKKDVVQSPSILAVWERETAVINCSYTDGASNYFPWYKQEAGKGPSLLIEMRSNVNSKQDRRFTLLLDKNAKHISLHITPTQPEDSASYFCAA
Tupaia belangeri V196 trav AAPY01347871.1 338 IMGDAKTTQPTSVKSAEEEPVHLPCNHSTISGSEYIHWYRQAPQQAPEFVIRGLKNNETNGMASLVIAADRKFSILILPRVTLRDTAVYYCMVR
Tupaia belangeri V197 trav AAPY01347875.1 970 VSTQGLEQSPPFQSIQEGEDFTVYCNSSSVFTRFQWYRQEPGKGLVLLMTLVKSGEVNKQKRLTARFGEARKDSSLHIATTQLGDAGVYLCAG
Tupaia belangeri V198 trav AAPY01347881.1 522 LSMTQTVTQSQSKMSVQETETVTLDCIYDTSERNYYLFWYQQPPSGQMIPIIRQEAFKQQNATENRFSVNFQKEAKSFSLKISDSQLTDAAMYFCAFV
Tupaia belangeri V199 trdv AAPY01347909.1 6711 VLSDVVLLPQDQTMAVSVGRSATFKCSMEKETITNYYVSWYRKTQGSTLTFIHREGSTYGSGFKDRFQSKVHGNQAVLEILEASERDEGFYYCAV
Tupaia belangeri V209 igkv AAPY01378276.1 203 SSGDVVMTQTPLSLPVIPGETVSISCKSSQSLLHSDGNTYLHWLQQKPGQAPRRLIYQVSNRDSGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCGQSTKRP
Tupaia belangeri V215 ighv AAPY01394711.1 659 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSISSGYCWHWVRQPPNKGLQWVGDICASGSTYYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V216 ighv AAPY01394761.1 461 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTDYGVHWVRQAPGKGLEWVGVIWSSGSTGYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCTR
Tupaia belangeri V217 iglv AAPY01398918.1 1076 SVTHARLTRLPLVSQNLRHTATLTCTGDSNNVGNEGTAWLQQHPGRVPKVLTHRNNYRAPGISERFSGSRSGNTASLTISELQPEDEADYYCTAWDSSVS
Tupaia belangeri V218 ighv AAPY01408273.1 381 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYAVHWVRQAPGKGLEWVGAIGYSGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCTR
Tupaia belangeri V219 ighv AAPY01408395.1 2539 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYPVHWVRQAPGKGLEWVGVIWSGGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTAIYFCAR
Tupaia belangeri V220 trav AAPY01409559.1 1012 TLGLAKTSQPLSMDAYEGQEVNMSCSHSSIATNEYIFWYRQFPNQGPQFFVQGYKTNIMNEASTLFIPGDRKSSILSLHRAALEDTAVYYCIVA
Tupaia belangeri V222 ighv AAPY01413197.1 245 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTDYNLHWVRQAPGKGLEWVGVIDYSGSTYYKPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V225 ighv AAPY01421680.1 798 VLSQVQLQESGPGLVKPSETLSLTCNVSGFSLTNYGVHWVRQASGKGLEWVGVISSGGSTYYNPALKSRASISRDTSKSQGYLSLHSLTPEDMVMYFCAR
Tupaia belangeri V227 trbv AAPY01425467.1 177 PVDTKITQIPKHLVTAMGSKRTLNCEQYLGHNAMYWYKQEPEKPLELMFSYNYKELVQNETVPSRFTPDCPDSAHLHLHLYALEPGDSAVYLCASSQ
Tupaia belangeri V228 ighv AAPY01426092.1 2432 VLSQEQLQESGPGLVTPLQTLSLTCTVSGFSITTSDYCWHWVRQLPGKGLEWVGQIYHNGNSYYSPFLKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCA
Tupaia belangeri V230 trav AAPY01428865.1 70 VRGFQVEQSPPALSLQEGTDSTLWCNFSATVDNVQWFRQNPGGSLINLFFVASGKKQNGRLEAMVNSKDRYSTLHITASQLEDSGTYLCAAAAQCSQ
Tupaia belangeri V234 trav AAPY01434256.1 716 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSWNPSLFWYVQYPNQGLQFLLKYISGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia belangeri V235 trav AAPY01434257.1 469 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSWSPYLFWYVQYPNQGLQFLLKYVTGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia belangeri V236 iglv AAPY01434707.1 900 SVTSSAVTQSPSVSVALGQTVKITCQGGDLRILPANWYQQKPDQSPALLIYGDSSRASGVPERFSGSRSGGTATLTITGAQAEDEADYFCQSTDSLTL
Tupaia belangeri V238 iglv AAPY01436948.1 968 SVASSALTQPPALSVALGETVSLTCQGGDLERRYAHWYQQKPAQRPALLIYDDSNRASGVPERFSGSSSGGTATLAITDIQVDDEADYFCLSSDDENYL
Tupaia belangeri V240 iglv AAPY01437130.1 590 SLSQPVLTQPSSLSASPGASARLTCTLSSGFTVSDFDLRWYQQMSENPPRYLLRYKSDSDKYQGSGVPSRFSGSKDTLANAGVLYISGLQPEDEADYYCNV
Tupaia belangeri V241 iglv AAPY01437131.1 368 SFAQPVLTQPPSLSASPGETVKLGCALSSDVSVGGYTMYWYQQKPGSPPQWFLYYYSDSDKKLGPGVPSRVSGSKDTSKNTAFLHISGLQAEDEAVYYCQI
Tupaia belangeri V244 iglv AAPY01440642.1 1494 FWAQSALTQPSSVSGALGEKVTLSCVGSSNDIGRYNLVSWYQQHPGSPPKLLIYAVSSRPSGISTRFSGSKSGNTASMTISELQDEDEADYFCNSYAGSGI
Tupaia belangeri V252 ighv AAPY01446771.1 4845 VLAQIVLKESGPGLLKPGETLTLTCTVSGFSLSTSGIAVSWIRQPPGKPLEWLSLIYWDDDKCYSPSLKSRLAISKDSSKNQVFLEMSSMDPADTATYYCAR
Tupaia belangeri V253 ighv AAPY01448797.1 639 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYWSWIRQPPGKGPEWVGYISYSGSTNYNPALKSRCSISRDTSKNQYSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V254 igkv AAPY01449208.1 448 SSGEIVLTQSPASMAVSQRETVTITCRACESVNNNYLRWYQQKPGVPPKLLTSNLASGVPARFSGSGSGASFSLTISSVEAEDFDDYYCQQGSSNP
Tupaia belangeri V255 ighv AAPY01449452.1 997 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTDYAVHWVRQAPGMGLEWVGTIWGDGSTYYNPALKSRVSISRDTSKSQGYLSLRSLTPEDTATYFCS
Tupaia belangeri V256 ighv AAPY01449453.1 4749 VLSQVQLQESGPGLVKPLQTLSLTCAVSGYSITSGYDWSWIRQLPGKGLEWVGYISSGGSTNYNPALKSRCSISRDTSKNQFSLQLSSVTPEDKAIYYCAR
Tupaia belangeri V257 ighv AAPY01449761.1 1790 VLSQVQLQESCPGLVTPLQTLSLTCTVSGLSITTSDYCWHWVRQLPGKGLEWMGNINYAGGIAYNLSLKSCSSISRDTSKKQFSLWLSSVTPEDMAMYYCAR
Tupaia belangeri V258 trav AAPY01450918.1 7679 AESKDQVFQPSTMASSEGAVVEISCNHSVSNAYTFFWYLHFPGCAPRLLVKGTRPAQQGRYNMTYERFSSSLLIHQVQVADAAVYYCALEDTEAGS
Tupaia belangeri V262 ighv AAPY01452569.1 2145 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITTGYWWHWIRQLPGKGLEWVGYISSGGSTYYSPALKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCAE
Tupaia belangeri V265 trdv AAPY01464107.1 1339 FSVAQKVTQAQPAISRPMGTSVTLECAYETSWTSYVLYWYKQLPSGEMIFVIYQFPTGQNKKIGRYSTNFQKSARSISLIISPLQLEDSAKYFCALSE
Tupaia belangeri V269 iglv AAPY01470187.1 21 SLSQPVLTQPLSLSASPGASARITCTVSSGFNVGDYWIKWYQQNPESPPRFLLNYYSESNKHQGSGVPSRFSGSKDTSANAGVLHIAGLQPEDEADYYCAI
Tupaia belangeri V270 iglv AAPY01470187.1 33307 SGFQTVLTQVCSLMVTQGGIVILTCDFSTGVVTNGHHPYWFQQKPGHVPRTVTHDTSNRFFWTSDYFSGSLLGGRAVLTLSGAQPENEAEYYCWLSDRHA
Tupaia belangeri V271 trav AAPY01472216.1 911 VTGQKIDQNPQALSIQEGGKASLICNYTNYFPAYMQWYRQDPGKGLVFLLLVRENEGEKQKGRLRVTFDTARKQSSFHVSAAQPADSATYLCAA
Tupaia belangeri V272 trav AAPY01472217.1 1616 RTHGDSVTQTEGPVTLSEEAALTLNCTYQTNNVVFLFWYVQYVNKAPQLLLKSSLDKQKTENEGFYANHIKDDSSFHLQKRSVQTSDSAVYYCAMR
Tupaia belangeri V273 iglv AAPY01475147.1 103 TWAQSVLTQPSSVSGALGQRVTISCTGSGNNIGKKYVCWYQQLPETSPRLLIYENSKRPSGITDRFSGSKSGTSASLTMSGLQAEDEAIYHCHSYDESLKA
Tupaia belangeri V275 iglv AAPY01479821.1 653 SRSLPVLIQLPSLFAFLGTSARLTCTLGSGFSVGKFWISWYQQKPGNPPRYLLPFHSDSDKHQGSGFPSRFSRTSDASANTGILHISGLQPEDQADYYCRTYHG
Tupaia belangeri V279 igkv AAPY01484937.1 294 ACGDIVMTQSPGSLAASVGQRVTINCKSSQSLLLSSNQKNYLAWHQQKPGQAPKLLISWASTRAPGIPDQFSGSGSGEDFTLTISSLRPEDMAAYYCQQYYSVP
Tupaia belangeri V280 ighv AAPY01485232.1 2361 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYDWSWIRQPPGKGLEWVGAISSGGSTYYSPALKSCSSISRDTSKNQFSLQLSSVTPEDMAIYYCAR
Tupaia belangeri V281 ighv AAPY01488796.1 817 VLSQVQLQESGPGLVTPSQTLSLTCTLSGFSITTSGYCWEWIRQPPGKGLEWVGRICYNGNTHYTPSLKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCAR
Tupaia belangeri V282 igkv AAPY01490312.1 3727 TMGEAVLTQTPASLSLSPGERASLTCRASQGISNYVAWYQQKPGQAPRLLIYDASTRASGMPDRFSGSGSGTDFTLTISSLEPEDLALYYCYQYYSG
Tupaia belangeri V283 igkv AAPY01490313.1 1895 SSGDVVLTQTPLSLTVMPGEPASISCRSSHSLLHTDGNTYLSWYVQKPGQFPQLLIYKVSSHVSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYHCQQARHTP
Tupaia belangeri V284 iglv AAPY01490438.1 2325 SFAQPVLTQPSSLSASPGETVKLGCALSSDVNVGSKNMYWYQQKPGSPPRWFLYYYSDSDKQLGPGVPSRVSGSKDTSKNTAFLHISGLQAEDEAVYYCHI
Tupaia belangeri V286 iglv AAPY01491070.1 5495 SVASSALTQPSSVSVALGGKVSITCKGGSLGSYYSHWYQQKPDQRPALLIYDDSKRASGVPDRFSGSSSGGTATLTITGAQAEDEADYFCQSWD
Tupaia belangeri V288 iglv AAPY01492803.1 3908 SVASSALTQPPAVSVALGETVSITCQGGDLESYAAHWYQQKPAQSPALIIYYDDEQASGVPERFSGSRSGGTATLTITGAQAEDEADYFCQSWDSSGEV
Tupaia belangeri V292 iglv AAPY01499053.1 472 SRSLPVLIQLPSLFAFLGTSARLTCTLGSGFSVGKFWISWYQQKPGNPPRYLLPFHSDSDKHQGSGFPSRFSRTSDASANTGILHISGLQPEDQADYYCRTYHG
Tupaia belangeri V296 ighv AAPY01501988.1 910 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTDYALNWVRQAPGKGLEWVGVIGSTGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V298 ighv AAPY01504227.1 3613 VLSQVQLQESGPGLVKPSQTLSLTCAVSEFSLMTSDYCWHWVRRLPEKGLEWVGQIYHNGNSYYSPSLKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCA
Tupaia belangeri V300 ighv AAPY01505759.1 608 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYHMHWVRQAPGKGLEWVGVIWNSGSTGYNPALKSRASISRDTSKSQSYLSLRSLTPEDTATYFCTR
Tupaia belangeri V301 ighv AAPY01505761.1 7113 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTDYDLNWVRQAPGKGLEWVGVIGYSGSTYYNPALKSRTSISRDTSKSQGYLSLRSLTPEDTATYFCTR
Tupaia belangeri V303 iglv AAPY01510063.1 1577 MCHLASLSIHWVPGPEGAISCTGSSNNIGDNSVHWYQQLPGTVPNLLIYDDSDGPLQVPDQFSASKSGTLASLAISGLQALDEADYHCQCYD
Tupaia belangeri V304 ighv AAPY01513076.1 1555 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYYWHWIRQPPGKGLEWVGYIHYDGSTYYSPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V305 iglv AAPY01513208.1 766 CWAQSALTQLPSISGNPGERVSLSCVGSSSDIGSYGASWYQQHPETRPKLLMYGDNTRPSGIPARFSGSKSGNTAFLTISDVSSGDEAIYYCASYRSGGT
Tupaia belangeri V306 iglv AAPY01513211.1 285 CWAQSALTQLSSISGNPGERVSLSCVGSNSDIGRYGVSWYQQHPETRPKLLIYGDNTRPSGIPDRFSGSKSGNTAFLTMSDILPEDEGDYYCASYRSGGT
Tupaia belangeri V309 ighv AAPY01515464.1 864 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSAHWSWIRQPPGKGLEWVGYINSGGSTYYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V310 ighv AAPY01515465.1 2573 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTSYAVHWVRQAPGKGLEWVGTIWGDGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCTR
Tupaia belangeri V311 ighv AAPY01515467.1 2045 VLAEVILKESGPGLVKPGETLTLTCTVSGFSLSTSGTRVGWIRQPPRKPLEWLAYIKWDDNKYYSPSLKSRLTISKSISKSQVFLKMSSMDPADTATYYCAR
Tupaia belangeri V313 iglv AAPY01516985.1 2461 RLTQLPSVSQNLRHMATLACTGDSNNVGNEGAAWLQQHPGRVPKVLTHRNNNRTPGISERFSGSRSGNTASLTISGLQPEDEADYYCTAWDSSV
Tupaia belangeri V314 igkv AAPY01517130.1 819 SSGDVVMTQTPLSLPVIPGETVSISCKSSQSLLHSNGNTYLHWLQQKPGQAPQGLIYRVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQSTKRP
Tupaia belangeri V318 iglv AAPY01521210.1 500 CWAQSALTQLSSISGNPGERVRLSCVGSSSDIGGYGASWYQQHPETRPKLIIHNDNTRPSGIPDRFSGSKSGNTAFLTMSDIRPEDEATYYCASYRSGGT
Tupaia belangeri V319 iglv AAPY01521214.1 89 SWAQSAPIQPSSISGNPGETVTISCAGSSSDIGRYNEVSWYQQHPETRPKLLLYNANTRPSEIPARFSGSKSENTASLTISGLQSEDEATYFCCS
Tupaia belangeri V320 iglv AAPY01522287.1 4560 SVASYDLTQQSSMSVALGQTARIPCGGDNIGRKSVQWYQQTPGTSPRLVIYYDNKRPSEIPDRFSGSNSGNMATLTISGVQAEDEADYYCQVWDSSNDI
Tupaia belangeri V321 iglv AAPY01522287.1 11380 AAASYQLTQPSSVSVALGQTATITCSGDLLDKIYTQWFQQHPGQAPVRVIYDDSKRPSGVPDRFSGSSSGKTVTLTITGAQAEDEADYYCQSGDNDKN
Tupaia belangeri V322 iglv AAPY01522287.1 17688 SVASYDLTQQSSMSVALGQTARITCGGDNIGGKNVQWYQQTPGTSPRLVIYNDNKRPSGIPDRFSGSNSGNTAALTISGVQAEDEADYYCQVWDSSNYI
Tupaia belangeri V323 iglv AAPY01522287.1 21570 SVTSSALTQPPSVSVALGGTVSITCQGEDLESYGANWYQQKPFQRPALLIYYDDEQASGVPDRFSGSRSGGTATLTITGAQAEDEADYYCQSADS
Tupaia belangeri V324 iglv AAPY01522289.1 2632 SMAYFVLTQPPLVSVALGQTARITCQGSGLRESYANWYQQKPGQGPWLLISEENNRASGVPDRFSSSSSGARATLTITGAQAEDEADYYCQSLERINYH
Tupaia belangeri V325 iglv AAPY01522292.1 3963 SVASSGLTQSPAVSVALGQTVRITCQGGVIEILGANWYQQKPAQRPELLIYGDSDRESGVPERFSGSRSGGTATLTITGAQAEDEADYYCQSADSSGTI
Tupaia belangeri V332 iglv AAPY01528509.1 2926 SLSQPVMTQSPSTSASYGASARLTCTLNSDFSVGSYYIYWYQQKTGSPPHYLLWYHSDSSKHQGSGVLSCFSGSNDVSANTVILQISGLQLEDEANYHCQT
Tupaia belangeri V333 iglv AAPY01528509.1 12136 SWAQSLLTQTPLVSGAPGQRVTISCSGHSNNFGSGYSVHWYQQLPGMAPRLLIYEDTERPSGVPDRFSSSRFGTSVSLSISGLQAEDEADYHCQSWDG
Tupaia belangeri V334 igkv AAPY01529276.1 2926 ARCDIQMTQSPSSLPASLGDKVSISCRASQGISNYLHWYQQKPGKAPKLLIYYASSLQPGVPSRFSGSGSGTDFALTISSLEPDDFGIYYCQQGNSWP
Tupaia belangeri V335 igkv AAPY01529278.1 2386 SNGDIVLTQSPALLPGSPGDTVTITCRTSEGISTNLHWYQQQRDQAPKLLIKYASQSVSGVPSRFSGSGSGTGFTLTIKNMEAEDAAVYYCQESSSYP
Tupaia belangeri V336 igkv AAPY01530406.1 458 SSGDVVMTQTPLSLPVIPGETVSISCKSSQSLLHSDGKTYLNWLLQKPGQAPRRLIYQVSNRDPGIPDRFSGSGAGTDFTLKISRMEAEDVGVYYCLQG
Tupaia belangeri V337 ighv AAPY01532550.1 700 VLCDIQLVETGGDLRQPRGSLTLSCKASGFTFTDYTIHWVCQAPGQGLEWVAGVSKPSGSKQWYSPSVQGRFTIARDNPTNTVSLKMDNLKVEDTGLYYCT
Tupaia belangeri V339 iglv AAPY01534564.1 14315 SWAQSGLTQPPSVSEALGQSVTLSCTGSSNNIGKDYGVQWYQKLPGTAPRLLIYSNSIRPSGSLHRFSGSKSGTSASLTISGLQAEDEADYYCQSWDSDLR
Tupaia belangeri V341 trav AAPY01536077.1 6819 DTRAQSITQPDSHVTLSEGASLELRCNYSYGATPYLFWYIQYPGQGLQLLLKHISGDTLVKGINGFEAEFKKSESSFHLRKPSVHWSDTAEYFCALS
Tupaia belangeri V342 trav AAPY01536079.1 89 DARAQSVTQPDSHVIVSEKALLELRCTYSGTSTPYLFWYVQYPGQGLQLLLKYYSGDTLVKGSNSFEAEFKKSDSSFNLKKSSVHWTDTAEYFCALR
Tupaia belangeri V343 trav AAPY01536080.1 1135 VRGFQVEQSPPALSLQEGTDSTLRCNFSATANNVQWFRQNPGGSLINLFFVASGTKRSGRLEATANSKDRYSTLHITASHLEDSGTYLCAAEAQCSR
Tupaia belangeri V344 trav AAPY01536084.1 272 VSRGENVEQRPSTLRVLEGDSSVINCSYSDSASDYFPWYKQEPGKGPQLIIDIRANKDKNHDQRLTVFLDKAKKHFSLHIAATQPGDSAIYFCAAR
Tupaia belangeri V347 trgv AAPY01541149.1 1365 CQVSSNSEVTVRAAGKAGSSIAITCGLRPGSGSYVHWYRLQEGKAPRRLLDHVPSSDTVVVDSGISQGKYHAYKSTRGSYKLLLRNLEKSDSAVYYCAVWT
Tupaia belangeri V348 trgv AAPY01541157.1 2478 SQVSSNLEGRMIVTGKTGSTVVISCNLQVSASYIHWYQFQEGKAPRRLLYLIQSSSKVVMDSGIRQEKYQAYKTTGNNYELVLRYLENSDSGMYYCAFWP
Tupaia belangeri V352 iglv AAPY01543283.1 241 SLAQPVLTQSPSTSVSPGTSAKLTCTLSREHSTYYIEWFQQQPGKGPRYVMWLKSDGSHSKGDGIPDRFSGSSSGADRYLTISNLQPEDEADYFCGVSYSGG
Tupaia belangeri V353 iglv AAPY01543285.1 513 SLSQSVQTQLPFLSASPGASARLTCTLSSGFSVCSYRIDWYQENPESPLRSLLSYHTDSDKHQGSGVPSCSSGSKDTLANAGILHISGLQPEDEAGYYCGT
Tupaia belangeri V354 iglv AAPY01543287.1 1814 AASQFVVTQEPSLSMTPGGTVTLTCGSSAGAVTTSNYAAWVQQMPYQAPRGLIGGTSNRYPGVPARFSGSLLGGKAALTITGAQPEDEAEYFCALWYSNH
Tupaia belangeri V463 ighv AAPY01708228.1 797 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITTGYWWHWIRQLPGKGLEWVEAISSGGSTYYSPALKSRCSISRDTSKNQFSLQLSSVTPEDTAMYYCAR
Tupaia belangeri V464 trav AAPY01710785.1 1280 AHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Tupaia belangeri V481 trav AAPY01733776.1 1587 DTRAQSITQPDSHVTLSEEASLELRCNYSYSVTPSLFWYVQYPGQGLQLLLKHISGDALVKGINGFEAEFKKSDSSFHLRKPSVHWSDTAEYFCALS
Tupaia belangeri V482 trav AAPY01733778.1 558 DARAQSVTQPDSHVSLSEKASLELRCTYSGTSTPYLSWYVQYPGQGLQFLLKYYSGDSLVKGSNGFEAEFKKSDSSFHLRKPSVHWTDTAEYFCALG
Tupaia belangeri V483 trav AAPY01733779.1 2483 VRGFQVEQSPPALSLQEGTDSTLRCNFSATANNVQWFRQNPGGSLINLFFVTSGTKRSGRLEATVNSKDLYSTLHITASHLEDSGTYLCAAAAQCSQ
Tupaia belangeri V484 trav AAPY01733779.1 7083 VSRGENVEQRPSTLRVLEGESSVINCSYSDSASSYFPWYKQEPGKGPQLIIDIRSNRDKNHNQRLTVFLDKAKKHFSLHIAATQPGDSAIYFCAAS
Tupaia belangeri V485 trav AAPY01733788.1 527 VRGFQVEQSPSVLSLQEGTGSTLRCNFSATANKVQWFRQNPGGSLINLFFVASGTKRSGRLEATANSKDRYSTLHITASHLEDSGTYLCAAEAQCPQ
Tupaia belangeri V486 trav AAPY01733791.1 67 DQVKQSPEMLRLQEGDNSSLSCSYTVSYFRGVQWYRQDPGKGPELLIALYSDGDDKWTGRLRATSSKKESTLHITAPTPEDSAMYFCAVDTQCSP
Tupaia belangeri V487 trav AAPY01733791.1 3732 VSSEQEVRQSPEALSVREGDNLVLNCSYTDSAVYSLQWFRQDPGKGLTFLIILRSNQRDESSGRLKASLDTSSRHSSLYIAASQPGDSATYLCAA
Tupaia belangeri V488 trav AAPY01733800.1 4331 VSGIQVEQSPLALSLQEGASSTLWCNFSTSVTNVQWFRQNPGGRLITLFYVPSGTKRNGRLNATTVANERHSSLHVSSSQTTDSAVYYCAVEPQRSR
Tupaia belangeri V489 trav AAPY01733801.1 6405 MSSVPNVAQSPRSLHVQEGESTNFTCSFPSSSFYSLHWYRQEPAKSPKILFVISVNGDEKQEGRVKVTLNTKEGYSFLYIKGSQPEDSASYLCAS
Tupaia belangeri V490 trav AAPY01733802.1 1230 VNGQQINQIPQFLHIQEGEDFTAYCNSSSTLNNLQWYMQKPGERPVFLMRLVAGGEVKKHDRLTASFGETKKNSSLHIAATQTADVGTYFCA
Tupaia belangeri V491 trav AAPY01733806.1 1400 ALSDAKSTQPDAMVCAEGETVNLPCNHSSISTNDYIHWYRQGPSQSPQYLIHSLQNSVSNEVASLTIAANRKSSTLILPHVTLGDTAVYYCTVR
Tupaia belangeri V492 trav AAPY01733809.1 1860 ALSDAKSTQPDAMVCSEGEVVNLPCNHSSISTIEYIYWYRQGPRQSPQYLIHSLQNSVTNEVASLTIAADRKSSTLILPHVTLGDTAVYYCTVR
Tupaia belangeri V493 trav AAPY01733814.1 165 VRSQELEQSPQSLIVQEGKEITITCNSSKTLYTLHWYRQKDAEGLSFLMMLRKSGEEEKSHEKMTFTLDEKKQRSSLHIAVTRLSHSGTYFCGAE
Tupaia belangeri V495 trdv AAPY01733835.1 1207 VSLDITLEPDAETLTVSVGEPATFRCSVTGGDLKNYQMSWYKKNENNSLVLVYKLRNNSNDDLENNFKGKTDTLRSQFILDIQKATAKDVGTYYCGSD
Tupaia belangeri V511 ighv AAPY01760726.1 1565 VLSQVQLQESGPGLVKPSQTLSLICTVSGYSITSGYYWSWIRQLPGKGLEWVGYIYSSGSTYYNPALKSCCSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V512 trav AAPY01761373.1 919 VRGFQVEQSPPALSLQEGTDSTLRCNFSATVDNVQWFRQNPGGSLINLFFVASGKKQNGRLEAMVNSKDRYSTLHITASQLEDSGTYLCAAAAQCSQ
Tupaia belangeri V517 iglv AAPY01772592.1 9102 SGFQTVLTQVCSLMVTQGGIVILTCDFSTGVVTNGHHPYWFQQKPGHVPRTVTHDTSNRFFWTSDYFSGSLLEGRAVLTLSGAQPKNEAEYYCWLSDRHA
Tupaia belangeri V518 iglv AAPY01772607.1 691 SVASSALTQPSSVSVALGGKVSITCKGGSLGSYYSHWYQQKPDQRPALLIYDDSKRASGVPDRFSGSSSGGTATLTITGAQAEDEADYFCQSRDSSGNN
Tupaia belangeri V520 trav AAPY01774034.1 795 SSMAQTVTQAQTATSVMEKGSVTLGCGYETSDPTYYLFWYKQPPTGEMIALIRQDSYNEKNTSEGRYFLNFHKSARSISLTIMTSQLTDSAVYFCALR
Tupaia belangeri V521 iglv AAPY01774296.1 138 CADPAALLSASPGASARLTCALSSGFSVGSYGLWWYQQKPGRSPRYLLYYHTDSNKHQGSGVPSRFSGSKDTSANAGVLHISGLQPEDEADYYCNT
Tupaia belangeri V523 ighv AAPY01776018.1 398 VLSQVQLQESGPGLVTPSQTLSLTCAVSGFSLTTSDYCWHWVRQLPGKGLEWVGQIYHNGNSYYSPSLKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCA
Tupaia belangeri V524 iglv AAPY01776408.1 585 TWAQSVLTQPSSVSGALGQRVTISCTGSSDDIGNNYVHWYQQLPGTSPRLLIYENSKRPLGITDRFSGSKSGTSASLTISGLQAEDEAVYHCQSYDDSLKA
Tupaia belangeri V525 trav AAPY01776599.1 357 RTHGDSVTQTEGPVTLFEEAALTLNCTYQTSRTVFLFWYVQYVNKAPQLLKSSLDKQKTENEGFYANHIKDESSFHLQKPSVQTSDSAVYYCVMR
Tupaia belangeri V527 iglv AAPY01777926.1 1789 SVASYDLTQQSSMSVALGQTARITCGGDNIGGKNVQWYQQTPGTSPRLVIYYDNKRPSGIPDRFSGSNSGNTAALTISRTQAEDEADYYCQVWDSSNDI
Tupaia belangeri V528 ighv AAPY01778466.1 28 VLSQVQLQESGPGLVKPSETLSVTCTVSGFSLTSYAVHWVHQAPGKGLEWVGVIWGDGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPGDTATYFCS
Tupaia belangeri V530 iglv AAPY01779261.1 96 SVASYDLTQQSSMSVALGQTARITCGGDNIGGKNVHWYQQTPGTSPRLVIYNDNKRPSGIPDRFSGSNSGNTAALTISGAQAEDEADYYCQVWDSSDRI
Tupaia belangeri V533 ighv AAPY01784143.1 1205 VLSQVQLQESGPGLVKPSQTLSLSCAVSGYSITTSGYCWNWIRQPPSKGVEWVGQICSDGSTYYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCAR
Tupaia belangeri V535 iglv AAPY01787307.1 4637 SLSQPVLTQPPSLSASSGASVRLTCTLSNGFAVGGYWIEWHQQKPESAPCYLLRHDSDSSKHQGSGVPSRFSGSKDISANAGVLHISGLQPDDEAVYYCGT
Tupaia belangeri V537 ighv AAPY01787569.1 625 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYYWSWIRQPPGKGLEWVGYISSGGSTYYSPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCA
Tupaia belangeri V538 ighv AAPY01787721.1 2916 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTSYDVHWVRQAPGKGLEWVGVIGSTGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCTR
Tupaia belangeri V539 ighv AAPY01787722.1 3473 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSISSGYCWDWVRQPPNKALQWVGEICANGNTYYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCAR
Tupaia belangeri V540 ighv AAPY01789032.1 1831 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSISNADWSWIRQPPGKGLEWIGYIYSSGSTYYSPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V544 iglv AAPY01799925.1 38596 RGGSAALPLCISWGIYQTHLYPEQWLQCHNDFGLCWYQQKPGSPACYLLWYHTDSNKHQGSGIPSCFSGSKDILANAGVLHISGLQPEDEPDYYCNIRHENSKA
Tupaia belangeri V545 iglv AAPY01799926.1 6761 SEALGQSVTLSSVSEALGQSVTLSCTGSSDNIRKDYGVQWYQQLPGTAPRLLIYSNSIRPSGSLHQFSGSESGTSASLTISGLQGEDKADYYCQSWDSSLR
Tupaia belangeri V546 iglv AAPY01799928.1 14492 SLSQPVLTQPPSLSASPGASVRLTCTLSSCFSVGSYNIYWYQQKPGSPPHYLLWYFSDSSKHQSSSVPSRFSGSKDFSANVGVLHISGLQPEDEANYYCKI
Tupaia belangeri V547 trav AAPY01801241.1 1111 ANGENQVEQSPRSLELQEEGASFMSCTYSVSGFNNLQWYRQDSGKGPQHLFSMYSPGDGKSKGRVRATLQKNGSSLHITALQLEDSATYFCAVA
Tupaia belangeri V548 trav AAPY01802277.1 1220 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSRSPYLFWYVQYPNQGLQFLLKYISGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia belangeri V549 trav AAPY01802277.1 5085 GLRAQSVNQSEDQVNVAEGDPLTLRCTYSVSGSPYLFWYVQYPNQGLQFLLKYVTGDSLVKGSYGFEAEFNKSQTSFHLKKPSALWSDSALYFCAVS
Tupaia belangeri V551 igkv AAPY01802849.1 154 SSGDVVMTQTPLSLPINPGETVSISCKSSQSLLHSDGNTYLHWLQQKTGQGPQGLIYSVSKRFSGVPDRFSGSGSETDFTLKISRVEPEDVGIYFCVQG
Tupaia belangeri V552 iglv AAPY01802850.1 981 SLAQPVLTQSPSTSASPGASAKLTCTLSREHSTYTIRWYQQQPGKAPRFVMRLKSDGSHSKGDGIPDRFSGSSSGADRYLTISDLQPEDEADYFCGVSYSGG
Tupaia belangeri V553 igkv AAPY01804957.1 894 ARCDIQMTQSPSSLSASLGDRVSLSCRASQGISNNLHWYQQKPGKAPKLLIYYASNLHSGVPSRFSGSGSGTDFSLTIMNLEPDDFGLYYCQQSNSYP
Tupaia belangeri V554 ighv AAPY01805614.1 2952 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYCWHWVRQPLSKGLEWVGWICANGNTYYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V556 ighv AAPY01808234.1 8820 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTDYYLNWIRQAPGKGLEWVGGISSGGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V558 iglv AAPY01811253.1 3956 AASQVVVTQEPSLSMTPGGTVTLTCGSSAGAVTTSNHATWVQQMPYQAPRGLISGTNYRIPGVPARFSGSLLGGKAAFTITGAQPEDEAEYFCAL
Tupaia belangeri V559 iglv AAPY01812019.1 552 AVVSYDLTQPSSVSVALGQTVTIACSGDLMDKKYTRWFQQHPGQAPVLVIYKDTERPSGVPDRFSGSSSGKTVTLTITGAQAEDEADYYCQSWDSDNN
Tupaia belangeri V561 iglv AAPY01812892.1 3583 SVASYDLTQQSSMSVTLGQAARIPCEGDGIGGKYVHWYQKKPDQAPKLVMYEDDDRPSGIPDQFSGSNSGNTATLTISGAQAEDEADYYCQLWDSSNDI
Tupaia belangeri V563 ighv AAPY01820346.1 4129 VLSQEQLQESGPGLVTPLQTLSLTCTVSGFSITTSDYCWHWVRQLPGKGLEWVGQIYHNGNSYYSPFLKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCA
Tupaia belangeri V565 iglv AAPY01823983.1 1396 CWAQSALTQLSSISGNPGERVRLSCVGSSSDIGGYGASWYQQHPETRPKLIIRNDNTRPSGIPDRFSGSKSGNTAFLTMSDIRPEDEATYYCASYRSGGT
Tupaia belangeri V568 ighv AAPY01825031.1 288 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTDYALNWVRQAPGKGLEWVGVIGSTGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V571 ighv AAPY01828200.1 1475 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYDWSWIRQLPGKGLEWLGTSAMVVAQATTPALKSRSSISRDTSKNQFSLQLSSVTPEDMAMYYCAG
Tupaia belangeri V572 ighv AAPY01828202.1 1486 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTNNALNWVRQAPGKGLEWVGAIGTGGGTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTAMYFCAR
Tupaia belangeri V574 iglv AAPY01828825.1 4809 SVASYDLTQQSSMSVALGQTARITCGGDNIGGKNVQWYQQTPGTSPRMVIYNDNKRPSGIPDRFSGSNSGNTATLTISGVQAEDEADYYCQVWDSSNDI
Tupaia belangeri V575 iglv AAPY01828825.1 8687 SVTSSALTQPPALSVALGETVSITCQGGNLESSYANWYQQKPAQSPALLIYYDDEQASGVPDRFSGSRSGGTATLTITGAQAEDEADYYCQSADS
Tupaia belangeri V576 iglv AAPY01828828.1 2006 SVASSALTQPSTVSVVLGQTARITCQGGDLKTYAAHWSQQKPGQRPALLLYGDRRKASGVSDRFSGSSSGGTAALTITRAQVEDEAEYYCHSADSSGKY
Tupaia belangeri V578 iglv AAPY01830897.1 313 SWAQSVLTQPPSVSGALEETITISCLGSSNDIGRYSDISWYQQHPGSPPKPLMYAVSSRPSGIPTRFSGSKSGNTASLTISELQKEDEALYFCQSYAGSNT
Tupaia belangeri V579 iglv AAPY01832461.1 6991 SEALGQSVTLSSMSEALGQSVTLSCTGSSDNIRKDYGVQWYQQLPGTAPRLLIYSNSIRPSGSLHRFSGSESGTSASLTISGLQGEDKADYYCQSWDSSLR
Tupaia belangeri V580 ighv AAPY01832892.1 2413 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYDWSWIRKPPGKGLEWVGAISSGGSTYYSPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V585 iglv AAPY01835758.1 5200 SWAQPVLTQLPSVSGALGQRVIISCTGSSSNIGSGYYVHWYQQLPGTATRLLIYEDSRRPSGVPDRFSGSKSISSASLTISGCQTEDKADYYCQSYDSSLK
Tupaia belangeri V586 trbv AAPY01836279.1 3641 PMEAQVTQTPRYLITKTGKTLTMTCSQNMDHESMYWYRQDPGLGLKLIYYSINVEIIDKGDIPDGYTVSRKEKKNFPLSLKSPSTNQTSLYLCASSV
Tupaia belangeri V587 trav AAPY01836643.1 5681 GSKEDSVTQTEGQMTLSEGVSLTINCSYTTTRYPTLFWYVQYPGEGPQLLFKVSKANEKGRNKGFEATYNQEATAFHLEKASVQESDSAVYFCVLG
Tupaia belangeri V589 iglv AAPY01839672.1 9426 SLSQPVLTQPPSLSASPGASARLTCTLSSDFSVGDYWIKWYQQNPESPPRFLLNYYSESNKQQGSRLPSHFSGSKDTLASAGVLHIAGLQPVDEADYFCAI
Tupaia belangeri V596 iglv AAPY01016769.1 771 SSAQSVPTQLLLVPGSLGQQVTISCTGNSNNISGNDVNWYQQFPGMAPRCFIYYNTKQPSRVSDRFSGSNTETLASMTISGLKAENEADYHCHSYDDSLRG
Tupaia belangeri V614 trav AAPY01041030.1 381 GLRAQSVNQPEDQVNVAEGDPLTLRCTYSVSWNPSLFWYVQYPNQGLQFLLKYVTGDSLVKGSYGFEAEFNKSQTSFHLKKTSALWSDSALYFCAVS
Tupaia belangeri V630 trbv AAPY01093215.1 5924 YTDAGVSQSPKHRVTVRGQNVTLKCDPISGHDFLYWYRQTLGQSLEFLAYFQNKYLSDKSGLPSDRFTPERPEGSFSMLRIQPAEPGDSALYLCASSL
Tupaia belangeri V631 trbv AAPY01093216.1 6117 SVDAGVTQTPRYLITEKRGQASLKCYPVPGHNYVYWYQLAPDQVPQFLISFYEKMLREKGIIPDRFSVEQFGDYHSEMNMSSLELGDSASYLCASSV
Tupaia belangeri V632 trbv AAPY01093219.1 2222 PVDAGITQSPRHKVTVKGKNVTLRCHQNDNHYYMYWYRQDLGHGLRLIHYSLDVNSTTKGDIPDGYRVSRANTEDFPLTLESPTPSQTSVYFCASSN
Tupaia belangeri V633 trbv AAPY01093220.1 1433 SVDVGVIQTPRYLITEKRGQATLKCFPVPGHSYVYWYQQAPHHQSLQFLSSYYKEREYAKGIIPDRFSAEHFSDNHSEMNMSSLELGDSALYLCASSV
Tupaia belangeri V634 trbv AAPY01093222.1 1189 SADVGVTQTPRYLITEKRGEATLKCYPVPGHATVYWYKQAPDQGLQFLISYYEKTENDKGIIPDRFSAKQFSDYHSEMNMSSLELGDSASYLCASSV
Tupaia belangeri V635 trbv AAPY01093227.1 371 LIAAGVTQSPRLKISEKGQIIAFWCDPISGHNTLYWYRQRPGQGPELLTYFQNEAMVGESLLPKDRFSAERTKGADSTLKILRAELGDSAVYLCASS
Tupaia belangeri V636 trbv AAPY01093228.1 2420 PTDAGITQSPRQKVTVKGKNVTLQCHQNDNHGYMYWYRQDLGHGLRLIHYSFGVNDTNKGDIPDGYRVSRSKTENFPLTLESATPSQTSVYFCATSD
Tupaia belangeri V637 trbv AAPY01093229.1 1267 SVDVGVTQTPRYLIREKKGQATLKCYPISGHKSIYWYQKALDQGPQFLVSYFEESEYYKGIISDRFSAKQFSDNHSEMNMSSLELGDSASYLCASSL
Tupaia belangeri V638 trbv AAPY01093237.1 925 SVDVGVTQTPRYLIREKKGQATLKCYPISGHKSIYWYQKALDQGPQFLVSYYEKTEYSKGIITDRFLAEQFSDYHSEMNMSSLELGDSAVYLCASSV
Tupaia belangeri V639 trbv AAPY01093239.1 2020 PVETGVTQNPRHLIKTKGQKATLRCSPMSGHNSVYWYQQILGQGLQFIFEYYREDQGAKGNFPSRFSAHQFRNYSSEMNVSSLQLEDSALYLCASSL
Tupaia belangeri V640 trbv AAPY01093243.1 4107 PVETGVTQTPRHLIKPKGQKVTLRCSPMSGHNSVSWYQQILGQGLQFLFEYYREEERAKGNFPSRFSAHQFRNYSSEMNVSSLALEDSALYLCASSL
Tupaia belangeri V641 trbv AAPY01093243.1 424 LAASEVTQTPKHLIKARGQQGTLRCSPVSGHLSVYWYQQTSDQGLQFLVQHYNGEERERGNIPDRFSAQQFSNYSSELNLSSLTVGDSALYLCASSL
Tupaia belangeri V652 igkv AAPY01106397.1 1295 ARCDIQMTQSPSSLSASIGERVTISCRASQSISKWLAWYQQKPGKAPKLLIDEASKLHTGVPSRFSGSGSGTDFTLTISSLESDDFGDYFCQKYDNTP
Tupaia belangeri V697 iglv AAPY01198827.1 9146 SWADVMFTQPSSVSGSPGQKVTISCTRSSGNIGDKYVYWYQQHPGSAPTLLIYRDNQRPSGVPDRFSGSIDGSSNSAYLTISDVQPEDEADYYCQSGYDNY
Tupaia belangeri V698 iglv AAPY01198827.1 5414 SWADVTFTQPSSVSGSPGQKVTLPCTRSSGNIGNYYVHWYQQHPGSAPTTVIYKDNQRPSGVPNRFSGSIDGSSNSAYLTISDVQPEDEADYYCQSGYDN
Tupaia belangeri V699 iglv AAPY01198827.1 1926 TVAQARLTQVPSVSQTLGHTVTLTCTGNSNNVGYEGAAWLQQHPGLVPKLLTHRNNNRALGVSERFSGSRSGDIASLTISDLQPEDEADYYCTAWDRSVG
Tupaia belangeri V723 ighv AAPY01232418.1 505 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSISSGYCWHWARQATSKGLEWVGDICASGSTYYNPALKSRSSISRDTSKNQFFLQLSSVTPEDTAMYYCAR
Tupaia belangeri V746 ighv AAPY01284670.1 734 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLTSYAVHWVCQAPGKGLEWVGAIGTDGGTYYNPALKSRASISRDTSKSQSYLSLRSLTPEDTATYFCTR
Tupaia belangeri V783 trdv AAPY01347912.1 2337 KGMLCNQVTQSSRELAAASGSGVVLPCTYRTSYSNPGLYWYRQKPDGTFQFILYRDNSRSHNAEFTKDRFSVKHDQKQKTFHLVINPVRMEDSALYFCAL
Tupaia belangeri V793 ighv AAPY01373216.1 2645 VLAQVVLKESGPGLVKPGETLTLTCTVSGFSLSTSGIGVGWIRQPPGKSLEWLSNIWWDDDKYYSPPLKSRLTISKDNSKNQVFLKMSSMDPADTATYYCAR
Tupaia belangeri V798 iglv AAPY01392044.1 5029 AMASYQLTQPSSVSVALGQAATITCSGDLLDKIYTQWYQQHPGQAPVTVIYKDTERPSGVPDRFSGSSSGKMVTLTITGAQAEDEADYYCQSGDCDNK
Tupaia belangeri V800 igkv AAPY01395185.1 909 ARCDIQMTQSPSSLSASLGDRVSISCRASEGISSYLHWYQQKPGKSPKLLIRRASSLQPGVPSRFSGSGSGTDFALTISNLELDDFGIYYCQQSSSYP
Tupaia belangeri V804 ighv AAPY01397926.1 3955 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTDYGVHWVRQAPGKGLEWVGVIGTGGGTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTAMYFCAR
Tupaia belangeri V809 iglv AAPY01420604.1 2292 SWAQPVLTQPPSVSGTLGQRVTISCTGSSSNVGGYYVHWYQQFPGMPPNLLIYKDTIRFLEVSDRFSGSKSGNTASLTITDLRPEDEASYHCKS
Tupaia belangeri V810 trbv AAPY01421052.1 1666 SMDARITQSPRHKVTTVGKTVTLRCHQTYKHDYMYWYRQDLGHGLRLIHYSYDVNDTQKGDIPDGYSVSRSNTEDFPLTLESPTRSQTSVYFCASS
Tupaia belangeri V811 ighv AAPY01421662.1 1708 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYDWSWIRKPPGKELEWVGAISSGGSTYYSPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V812 trgv AAPY01423145.1 1297 SQASSNLERRILAVTGKTGSSAEISCDFLQLSPTYVHWYQFQEGKPPRRFLYYDYYRSSMVVDSGISPAKYHAYAITRSSFMLVIRRAEERDSGVYYCAAWE
Tupaia belangeri V813 trgv AAPY01423146.1 739 SQLSSNLEARTMTVTGKTGSSVVITCDLARGNNYIHWYQFEQGKVPQHLLYYDYHSSTVVVDLGISSSGKYHAYESTRSYKFVIRYLQESDSGVYYCAVWK
Tupaia belangeri V814 iglv AAPY01424624.1 2261 SVASFVLTQPPLVSVALGQTARITCQGRGLRESYANWYQQKPGQGPWLLISEENNRASGVPDRFSSSSSGERAMLTITGAQAEDEADYYCQSLERINYH
Tupaia belangeri V819 ighv AAPY01436791.1 2019 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLRSYHMQWVRQAPGKGLEWVGVIWSSGNTDYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V823 ighv AAPY01448835.1 2028 VLSQVQLQESGPGLVKPSGTLSLTCKVSGFSLTDYPLSWVRQAPGKGLEWVGAIGTGGSTYYNPALKPRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V824 ighv AAPY01448836.1 7384 VLSQEQLQESGPGLVTPSQTLSLTCAVSGFSLTTSDYCWHWVRQLPGKGLEWVGQIYHNGNSYYSPSLKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCA
Tupaia belangeri V827 ighv AAPY01462811.1 1442 VLAQVVLKESGPGLVKPGETLTLTCTVSGFSLSTSGTRVGWIRQPPGKPLEWLTYIKWDDDKYYNPSLKSRLAISKDNSKNQVFLKMSIMDPADTATYYCAR
Tupaia belangeri V830 ighv AAPY01468646.1 4184 VLSQVQLQESGPGLVKPSEMLSLTCKVSGFSLTDYALSWVRQAPGKGLEWVGGISSGGSTGYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V832 iglv AAPY01472741.1 5695 CWAQSALTQLSSISGNPGERVRLSCVGSSSDIGGYGASWYQQHPETRPKLLMYDDNTRPSGIPDRFSGSKSGNTAFLTMSDIRPEDEATYYCASYRSGGT
Tupaia belangeri V836 igkv AAPY01477199.1 2407 SSGDIVMTQTPLSLSINPGEPASISCRSSQSLLHSNGNIYLQWLLHKPGQAPRLLINKASNRLSDVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCTQDMQQP
Tupaia belangeri V838 iglv AAPY01479867.1 633 SVFPGSLSQPALTQPPSASASLGQAVTLTCTLNGGYNYYVEWYQQRPGKGPWFVMTVGIRGTSGSKGDGIPDCFSASGSGLDQFLTIQNLQEDDESDYHCGVS
Tupaia belangeri V839 iglv AAPY01482875.1 469 CADSAILLSASLGASARFTCTLSSDLSVELYPISWFQQKPGNPPCSLLRYNSDCNKHQGSEVSSHFSGSKDTSASSGVLHILGLQPEDEADYYCQSWDVDS
Tupaia belangeri V842 igkv AAPY01487938.1 1701 ARCDIQMTQSPSSLSASLGDRVTISCLASQGISKWLAWYQQKPGKAPKPLIYEASKLHSGVPSRFSGSGSGTDFSLTISNLEPDDFGIYYCQQYNSNP
Tupaia belangeri V843 iglv AAPY01488919.1 1309 SLSQPVLTQPPSLSASSGASVRLTCTLRNGFGVGGYWIEWHQQKPESAPCYLLRHDSDSSKHQGSGVPSRFSGSKDISTNAGVLHISGLQRDDEAVYYCGT
Tupaia belangeri V845 ighv AAPY01492450.1 2087 VLSQVQLQESGPGLVKPSQTLSLSCAVSGYSISSGYCWHWARQATSKGLEWVGRICASGSTYYNPVLKSRSSISRDTSKNQFFLQLSSVTPEDTAMYYCAR
Tupaia belangeri V846 iglv AAPY01492803.1 7580 SVTSSAVTQSPSVSVALGQTVKITCQGGDLRILPANWYQQKPDQSPALLIYGDSSRASGVPERFSGSRSGGTATLTITGAQAEDEADYFCQSTDSLTL
Tupaia belangeri V855 ighv AAPY01505359.1 457 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTDYNLHWVRQAPGKGLEWVGAIDYSGSTYYNPALKSRASISRDPSKSQGYLSLRSLTPKNTATYFCAR
Tupaia belangeri V857 ighv AAPY01506501.1 502 VLSQVQLQESGPGLVKPSQTLSLTCAVSGLSITTSGYWWSWIRQLPGKGLEWMGNINNAGSTAYNPSLKSRSSISRDTSKNQFSLQLSSVTPEDTAMYYCA
Tupaia belangeri V858 ighv AAPY01506504.1 5121 VLSQVQLQESGPGLVKPSETLSLTCTVSGFSLRSYHMQWVRQAPGKGLEWVGVIWSSGSTDYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCAR
Tupaia belangeri V860 iglv AAPY01507669.1 702 SLSQPVLTQPPSLSASLGASARLTCTLSSGFSVGDYYIYWYQQKPGSRPRYLLYYYSDSYKHQGSRVPSHFSGSKDTSDNAGVLHISGLEPEDEADYYCGTEHA
Tupaia belangeri V863 igkv AAPY01512570.1 8145 SSGDIVLTQSPALLPGSPGDTVTITCQTSEGISTNLHWYQQKRDQAPKLLIKYASQSVSGVPSRFSGSGSGTDFALTIKNMEAEDAAVYHCHQGNSYP
Tupaia belangeri V864 igkv AAPY01512570.1 1011 SAGDIVLTQSPTTLAVSPGDKVTISCRTSQSVSGLIISYLHWYQRKPGQPSKLLIYEATSRQSGVPARFSVSGSITDFTLTINPVEADDVANYYCQQGK
Tupaia belangeri V865 iglv AAPY01512746.1 840 SLSQPVLTQPPSLSASPGASARITCTVSSGFNVGDYWIKWYQQNPESPPRFLLNYYSESNKHQGSEVPSRFSGSKDTSANAGVLHIAGLQPEDEADYYCAI
Tupaia belangeri V870 ighv AAPY01531910.1 975 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSGYYWSWIRQPPGKGLEWVGYISYDGSTNYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V872 iglv AAPY01533354.1 1463 SVASSALTQSSALSVALGQTTRITCQGGELEILGANWYQQKPGQRPALFIYDDSDRESGVPERFSGSRSGGTATLTITGAQAEDEADYYCQSADSSGTI
Tupaia belangeri V873 iglv AAPY01533355.1 2069 SVASSALNQPSSVSVALGQTVRITCQGGGIGSYYADWFQQKPGQRPALLLYGNNNRPSGVPDRFSSSLSGGTATLTLTRAQAEDEADYYCYSADSSGN
Tupaia belangeri V874 iglv AAPY01533356.1 888 SVASYDLTQQSSMSVALGQTARITCGGDNIGGKNVQWYQQTPGTSPRLVIYNDNERASGIPDRFSGSNSGNTAALTISGAQDGDEADYYCQVWDSSNGI
Tupaia belangeri V875 iglv AAPY01533357.1 793 AAASYQLTQPSSVSVALGQTATITCSGDLLDKIYTQWYQQHPGQAPVRVIYEDSKRPSGVPDRFSGSSSGKTVTLTITGAQAEDEADYYCQSGDNDKN
Tupaia belangeri V877 trbv AAPY01535443.1 3931 AGAQTIQQWPASKLQLVGSPLSLNCTVKGASSPNLYWYRQARGEALHRLSYSVGLDQIESEGPQHLSATRPQDGQFILSSKGVLLSDSGFYLCAWS
Tupaia belangeri V880 iglv AAPY01541397.1 8162 CADSATLFSASPGASVRFTCTLKSDISVGNYRVHWYQQKPGSPPHYLLYYHTDSDKHQDSGVPSRFSGSKDTSSNAGVLHISGLQIKHGADYYCMMGYNT
Tupaia belangeri V883 iglv AAPY01542691.1 15484 SLSQPGLNQLPSLSASPGASVRLTCTMSGGFSIGSYGIMWYQQKPGSPPHYLLMYHTESIKHQGSGVPSRFYGSQDASANAGVLHISGLQPEDEADYYCQTYH
Tupaia belangeri V893 iglv AAPY01553042.1 11039 SVTHARLTRLPLVSQNLRHTATLTCTGDSNNVGNEGTAWLQQHPGRVPKVLTHRNNYRAPGISERFSGSRSGNTASLTISELQPEDEADYYCTAWDSSVS
Tupaia belangeri V923 trbv AAPY01593495.1 505 FNSAVVLQFPRHRVSETGKELTLQCSQNMSHLAMYWYRQDPGSGLQLVYYSPSTGITEKGEVSEGYHVSREQIDYFPLTLESASSTQTSVYICASSS
Tupaia belangeri V924 trbv AAPY01593504.1 1860 PVDARITQSPRHKVTVKGKNVTLRCHQNDNHNYMYWYRQDLGHGLRLIHYSYGVNSTTKGDIPDGYRVSRSNTEDFPLTLESPTPSQTSVYFCASSD
Tupaia belangeri V925 trbv AAPY01593505.1 1109 SVDVGVTQTPRYLITEKRGQATLKCYPFPGHDTVYWYQQTPDQGPQFLISYYAKMEYSKGNIPDRFSAEQFSDHHSEMNMSSLELGDSALYLCASSI
Tupaia belangeri V926 trbv AAPY01593512.1 651 PLDTAVSQTPKYLVTQMGNTRSLYCEQNLGHDTMYWYKQDSKQLLKIMFSYNNKELIINETVPSRFLPNSPDKAHLELYIKSLEPGDSALYLCASS
Tupaia belangeri V927 trbv AAPY01593513.1 1593 HTEPGVTQTPSHQVTRMGHKVLLECDPVSGHLYFYWYRQILGQKMEFIVSFYDKPMEKSEIYKEDRFSVKKPSASYFTLKIEPTELEDSAVYFCASSI
Tupaia belangeri V934 igkv AAPY01600527.1 508 SSGDVVMTQTPLSLPIIPGETVSISCKSSQSLLHSDGKTYLNWLLQKPGQAPRRLIYWVSNRDSGVPDRFSGSGSGTDFTLKISRVEPEDVGVYYCLQAMYV
Tupaia belangeri V935 igkv AAPY01600535.1 306 SSGDVVMTQTPLSLPINPGETVSISCKSSQSLLHSNGNTYLHWLQQKPGQGPQSLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVKPEDAGIYYCAQS
Tupaia belangeri V943 igkv AAPY01614348.1 6343 ARCDIQMTQSPSSLPASLGDKVTISCRASQGISSTLHWYQQKPGKSPKLLIYGASSLQTGVPSRFSGSGSGTDFTLTINNLEAEDVGIYFCQQGYSTP
Tupaia belangeri V964 iglv AAPY01651356.1 1423 TVAQARLTQVPSVSQTLGHTVTLTCKGDSNNVGYEGAAWLQEPLDQVTKLLTHRNNNRALGVSERFSGSRSGDTASLTISDLQPEDEADYYCTAWDSSEN
Tupaia belangeri V965 iglv AAPY01651439.1 5635 SSAQSVPTQLPLVPGSLGQQVTISCTGNSNNISGNDVNWYQQFPGMAPRCFIYYNTKQPSRVSDRFSGSNTETLASMTISGLKADNEADYHCHSYDDSLRG
Tupaia belangeri V971 trav AAPY01666541.1 914 GTGAQSVTQPDSHVSVSEESRLELKCTYSYSGAPFLFWYVQYPGQSLQFLLKDTTEAHLVKGIKGFEAELRKNETSFYLRKPSAHWSDSAQYFCALS
Tupaia belangeri V992 ighv AAPY01697791.1 850 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSITTNGYGWHWVRQLPGKGLEWMGIISYAGGTAYNPNLKSRSSISRDTSKNQFSLQLSSVSPEDTAIYYCAR
Tupaia belangeri V1012 trdv AAPY01733840.1 1088 KGMLCNQVTQSSRELAVDSGSGVVLPCTYSTSHSNPDLYWYRERPDGTFQFILYRDNTQSHNAEFTKDRFSVKHNQNQKTFHLAINPVRMEDSALYFCAL
Tupaia belangeri V1023 ighv AAPY01759895.1 789 VLSQVQLQESGPGLVKPSETLSLTCTASGFSLTSYVVHWVRQAPGKGLEWVGVIWGDGSTYYNPALKSRASISRDTSKSQGYLSLRSLTPEDTATYFCTR
Tupaia belangeri V1025 iglv AAPY01761493.1 1997 SVSAGSLSQSPSISASYGASARLTCTLNSDFSVGSYYIYWYQQKTGSPPHYLLWYHSDSSKHQGSGVLSCFSGSNDVSANTVILQISGLQLEDEANYHCQT
Tupaia belangeri V1027 iglv AAPY01773092.1 1526 SVSAGSLSQSPSISASYGASARLTCTLNSDFSVGSYYIYWYKQKTGSPPHYLLWYHSDSSKHQGSGVLSCFSGSNDVSANTVILQISGLQPEDEANYHCQT
Tupaia belangeri V1028 trbv AAPY01773207.1 987 DADTGVSQSPKYRITVRGQNVTLWCDPISGHAVLYWYRQTLGQSPEYLLYFQNNFMSDNSGLPSDRFSAERPGGSSSTLRIQPAEAGDSALYLCASSL
Tupaia belangeri V1030 iglv AAPY01774176.1 5912 SVASSALTQPPSVSVALGQTARVTCQGGGLGTYTVYWYQKDPGQRPVLIISRDSNRPSGVPDRFSGSRSGGTATLTITGAQAEDEADYYCQSWDSSGNN
Tupaia belangeri V1031 iglv AAPY01774176.1 1325 FVASYDVTQPSSVSVALGQTARITCGGDDIERNVVHWYQQTPGLTPKPVIRNNNERPSGIPDRFSGSNSGNTAALTISGAQSEDEADYYCQVWDSINGI
Tupaia belangeri V1034 iglv AAPY01775188.1 1023 RGGSAALPLCISWGIYQTHLYPEQWLQCHNDFGLCWYQQKPGSPACYLLWYHTDSNKHQGSGIPSCFSGSKDILANAGFLHISGLQPEDEPDYYCNIRHENSKA
Tupaia belangeri V1039 ighv AAPY01785610.1 600 VLSQVQLQESGPGLVKPSQTLSLTCAVSGYSISSGYCWHWVRQPPNKGLQWVGDICASGSTYYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V1040 igkv AAPY01787519.1 612 SSGDVVMTQTPLSLPIIPGETVSISCKSSQSLLHSDGNTYLHWLQQKPGQGPQGLIYVVSNRVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCVQDLHAP
Tupaia belangeri V1043 ighv AAPY01792187.1 3589 VLSQVQLQESGPGLVKPSETLSLTCKVSGFSLTSYHMHWVRQAPGKGLEWVGAIWSDGSTNYNPALKSRASISRDTSKSQVYLSLSSLIPEDTAMYFCAR
Tupaia belangeri V1045 ighv AAPY01794231.1 1141 VLSQVQLQESGPGLVKPSQTLSLSCTVSGYSISSGYCWHWARQATSKGLEWVGYIGYDGSTYYSPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V1050 igkv AAPY01799165.1 1632 SSGDVVLTQTPLSLTVMPGEPASISCRSSHSLLHTDGNTYLSWYVQKPGQFPQLLIYKVSSHVSGVSDRFSGSGSGTDFTLKISRVEAEDVGVYHCQQARHTP
Tupaia belangeri V1051 iglv AAPY01801517.1 2350 CWAQSALTQLSSISGNPGERVRLSCVGSSSDIGGYGASWYQQHPETRPKLLMYDDNTRPSGIPDRFSGSKSGNTAFLTMSDIRPEDEATYYCASYRSGGT
Tupaia belangeri V1052 ighv AAPY01804423.1 582 MLSQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYWSWIRQPPGKGLEWVGYISYSGSTNYNPALKSRCSISRDTSKNQYSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V1053 igkv AAPY01808566.1 6616 TRAEITLTQSPGLVSAVLGDKVDITCKASQDIDDDLHWYQQKPGEAPTLIIKGVSTLISGVPSWLSGSGYGTDFTLTINNMQQEDAAYYFCQQDDS
Tupaia belangeri V1055 iglv AAPY01812895.1 759 SVASYDLTQQSSMSVALGQTARITCGGDNIGGKNVQWYQQTPGTSPRLVIYNDNKRPSGIPDRFSGSNSGNTAALTISGVQAEDEADYYCQVWDSSNYI
Tupaia belangeri V1058 trbv AAPY01817550.1 798 HTDAGVTQTPRHKVTEMGRAVTLNCEPISGHAALLWYRQTIRTLEFLIYFNNKSPVDDSGMPKGRFFAKMPNASLSTLEIQSTEPRDSAVYFCASST
Tupaia belangeri V1059 ighv AAPY01820063.1 2866 VLSQVQLQESGPGLVTPSQTLSLSCAVSGLSITTSGYCWDWVRQPPGQALQWMGCIHYDGSLYYGPSFVGRVTISRDTSKNLFSLQLSSVTPEDTAIYYCTRE
Tupaia belangeri V1064 igkv AAPY01832899.1 2984 SSGDIVLTQSSTLLPGSPGDTVTITCRTSEGISTNLHWYQQKRDQASKLLIKYASQSVSGVPSRFSGSGSGTDFTLTIKNMEAEDAAVYHCHQGNSYP
Tupaia belangeri V1065 ighv AAPY01834342.1 2804 VLAQVVLKESGPGLLKPGETLTLTCTISGFSLSTSGIVVSWIRQPPGKPLEWLSLIYWDDDKRYSPSLKSRLAISKDNSKKHVFLEMSSMDPADTATYYCAQ
Tupaia belangeri V1067 ighv AAPY01836061.1 610 VLSQVQLQESGPGLVKPSQTLSLTCTVSGYSITSDYAWSWIRQPPGKGLEWVGYISYSGSTNYNPALKSRSSISRDTSKNQFSLQLSSVTPEDTAIYYCAR
Tupaia belangeri V1072 iglv AAPY01840399.1 551 SWAQSVLTQTPLVSGPPGQRVTISCSGHSNNFGSGYSVHWYQQLPGMAPRLLIYEDTERPSGVPDRFSSSRFGTSASLTISGLQAEDEADYHCQSWDG